CLUSTAL format seed alignment for MF_00472

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UBIG_HAEPS            ------------------------------------------------------------
UBIG_HAEDU            ------------------------------------------------------------
UBIG_PASMU            ------------------------------------------------------------
UBIG_COXBU            ------------------------------------------------------------
UBIG_XYLFA            ------------------------------------------------------------
UBIG_SODGM            ------------------------------------------------------------
UBIG_ECOLI            ------------------------------------------------------------
UBIG_PROMH            ------------------------------------------------------------
UBIG_SHEAM            ------------------------------------------------------------
UBIG_PHOPR            ------------------------------------------------------------
UBIG_SACD2            ------------------------------------------------------------
UBIG_MARHV            ------------------------------------------------------------
UBIG_AZOVD            ------------------------------------------------------------
UBIG_ACIAD            ------------------------------------------------------------
UBIG_PSET1            ------------------------------------------------------------
UBIG_COLP3            ------------------------------------------------------------
UBIG_RHOFT            ------------------------------------------------------------
UBIG_LEPCP            ------------------------------------------------------------
UBIG_RALSO            ------------------------------------------------------------
UBIG_CHRVO            ------------------------------------------------------------
UBIG_DECAR            ------------------------------------------------------------
UBIG_BORPE            ------------------------------------------------------------
UBIG_METCA            ------------------------------------------------------------
UBIG_NITOC            ------------------------------------------------------------
UBIG_ALKEH            ------------------------------------------------------------
UBIG_IDILO            ------------------------------------------------------------
UBIG_NEIMB            ------------------------------------------------------------
UBIG_PSYA2            ------------------------------------------------------------
UBIG_HYDCU            ------------------------------------------------------------
UBIG_RICPR            ------------------------------------------------------------
UBIG_PELUB            ------------------------------------------------------------
UBIG_RHORT            ------------------------------------------------------------
UBIG_MAGSA            ------------------------------------------------------------
UBIG_RHOPB            ------------------------------------------------------------
UBIG_AZOC5            ------------------------------------------------------------
UBIG_SINFN            ------------------------------------------------------------
UBIG_RHILO            ------------------------------------------------------------
UBIG_BARBK            ------------------------------------------------------------
UBIG_DINSH            ------------------------------------------------------------
UBIG_PARL1            ------------------------------------------------------------
UBIG_CAUSK            ------------------------------------------------------------
UBIG_MARMM            ------------------------------------------------------------
UBIG_METSB            ------------------------------------------------------------
UBIG_METS4            ------------------------------------------------------------
Q0DEH4_ORYSJ          ---------------------------MLRRVAPSLRRAILTSSAHGRAGAQLTEP-GLS
A0A3Q7HDE6_SOLLC      --------------------------MASKLVLNRLRSLCRVSQLSDVRFDKLRDPVSIF
W1PMS0_AMBTC          ---------------------------------MAYRSSQHLWRQTYRTVFRSTNPNVLC
M0TZ52_MUSAM          ---------------------------MAWRLLRVLQRTSFSNHTISLPNPNCSRLNPLA
COQ3_ARATH            --------------------------MLASVRVNQLQRLLLSARRLSSS--PIIPPSRLL
E9G9E5_DAPPU          ------------------------------------------------------------
E9HTS9_DAPPU          -----------------------------------------------MLLKHCVTS----
E9HTS6_DAPPU          ------------------------------------------------MLERLTTI----
B3S9Y1_TRIAD          ----------------------MGSLFAESRCRIYSILQKNRLGYACRNVGKLRFP----
COQ3_RAT              ---------MWRGGRLSSRGVRFLETLGFACPSAVAEPPRVTSWTAFSGNQLTRNLQIKP
COQ3_HUMAN            ---------MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISS-AVYVKNQLSGTLQIKP
F7F1Z8_MONDO          ---------MWGGCGLRAARGRALGLAGVRRVGRKVEPPRATG---LEGKQTNRTLLVIP
F1R9X2_DANRE          ---------------MYSKKFTRLAFGLLADSGLKIPLIQNVS----SKVKAARSLCSWT
W4Z4G0_STRPU          -------MATIGGSSSSFIRGTVQSIPMFRQRSMRPFSSIASRNLPSINTRSRRLQYERV
H2YX78_CIOSA          --------------MMSL-NCRSCGRLLTRWWMLLKSQP-------ARDVHCFRKK----
F7B383_CIOIN          --------------MLNI-SCHSCGRLLTTLSSIPKFRN-------LKNFHFFENY----
A7S2R8_NEMVE          --------------MKNLRSCLSCGVYGFSRVSKPAPRK-------LDDIFAKRQK----
A0A2H2HUE5_CAEJA      -------------------------------------MLNTLNGLKYIRLTKIRCP----
H3F3N5_PRIPA          -------------------------------------------------MVARSVA----
C3YXC3_BRAFL          ---------MISLSLTKMHACKLCGRMFRVVLRSNRALLSRFNGVLDSTGRNTSVR----
Q7Q8W0_ANOGA          ----------------------MLPQHCVRLLRPTILLTRTS--RCFSSPSET-------
Q17BU7_AEDAE          ----------------MFNSGLSLRFTKMLVLKPHRIFTVTLSPKRYLSQETT-------
E1JHN2_DROME          ----------------------MMRNALLVSGKLRHLLSCSIG--RNSTRSSS-------
Q16Z38_AEDAE          -------MSPYYGMYVVLGLVFKILETVIKVLKLNSVVKALEAQFGNFIIGLNDNR----
Q7Q8W1_ANOGA          ------------------------------------MFEKTSIAFLSLVEGLS-------
A0A087ZYC5_APIME      -----------------------MNIIKIRSFRSISTGPTLRNRLTEQTDQLTKS-----
E0VD98_PEDHC          -----------------------MTDYYINEIFFFFFFLSSRS-----TTTILEE-----
H9JPL1_BOMMO          ------------------------------------------------------------
A0A1X7VJD9_AMPQE      ---------------------MATYDVTASPIKINDVTKIMGKISLFRKINILSFL----
G4VGT4_SCHMA          ----------------------------MARHYLFPAVKLLKKKCLPSLSGMKSQN----
COQ3_DICDI            ---------------MIYHLISKSCQRLNKPNLINNLIKSQKQSIIYSSSSSSGSS----
D3AZU6_POLPP          -----------------------------MIKNISNLI-----------TKSRYIS----
A0CP72_PARTE          ------------------------------------------------------MI----
V5BT82_TRYCR          ------------------------------------------------------------
Q38DV8_TRYB2          ------------------------------------------------------------
A4HN95_LEIBR          ------------------------------------------------------------
D0NUY8_PHYIT          ------------------------------------------------------------
F4NYX5_BATDJ          ------------------------------------------------------------
E3KPS0_PUCGT          ----------------------MYRLNL-NKIPSGSRLLLAPSKGLASRFKKSSQE----
A8N8V4_COPC7          -------------------------MSL-RFL--RPRLPRTPSASTAKRSLHASKP----
Q5K9S4_CRYNJ          ----------------------MNRQQLCRRLYFSRSATAFPSTRIAARSITTASP----
COQ3_YEAST            -------------------MLLRSRFLKVIHVRKQL------------------------
Q75A09_ASHGO          -------------------MLKRTLPLLTKFNPKLLG-----------------------
Q5A4P2_CANAL          -----------MMVFLVSFISVEMKSMHCAPLFRQLV-----------------------
C4R3R0_KOMPG          --------------------------MHH-------------------------------
Q6CEG2_YARLI          MELSTLFEYIFSCSYPRSSPQCRMKNYHCHTLLKFVQTTGTSTSSNTRMCFEPTCRPKFY
A7F1A1_SCLS1          ------------------MPLTISTPLLHPTSFRNINL----------------------
C7YLQ7_NECH7          ----------------MPAPSRPAGALLRSLARSGRRP----------------------
Q7S214_NEUCR          -----------------MLPPSPLRQLAPTIARRVRNPRT--------------------
M2UHG6_COCH5          -----------------MKPSNPTRAIGSIRTHISQSPCF--------------------
G2WSG0_VERDV          ----------------MATPRAATAALLRQLRRARPSA----------------------
D5GMB5_TUBMM          ----------------MSSRIPPLLRIRSPLIRFSKSL----------------------
Q4WPT3_ASPFU          -----------------MNSIRTTSFRSLVPLFRRLDT----------------------
C8VLC5_EMENI          ---------------MAMTPVRPAFRKISLLRCPSVRR----------------------
A0A0D8JT44_COCIM      ----------------MTPDLRAAAARNLSLLLRHAPRR---------------------
COQ3_SCHPO            -----------------MNSMNILNKVKNVKSYTRLVR----------------------
Q4UDP6_THEAN          ------------------------------------------------------------
                                                                                  

UBIG_HAEPS            --------------------------------------------MNNIDQQEVEKFEKMA
UBIG_HAEDU            --------------------------------------------MHNVDQQELSKFEQMA
UBIG_PASMU            --------------------------------------------MQNIDQQELDKFEKMA
UBIG_COXBU            ----------------------------------------MTLSEQNIDKEELAKFSDLA
UBIG_XYLFA            ------------------------------------MSSAYDRVSKNYRQSELDKFAAFT
UBIG_SODGM            ----------------------------MIPEVSNEASQPAAHRQENVDPNEIAKFDAVA
UBIG_ECOLI            ---------------------------------MNAEKSPVNH---NVDHEEIAKFEAVA
UBIG_PROMH            ---------------------------------MNDKTTSLHA---NVDQHEIDKFESVA
UBIG_SHEAM            ---------------------------------MSEAL--------NVDIQEIAKFEKMA
UBIG_PHOPR            ---------------------------------MTKQL--------NVDPAEISKFEDMA
UBIG_SACD2            ---------------------------------MTTQEL-------NVDSAEIAKFERLA
UBIG_MARHV            ---------------------------------MNNQ---------NVDQNEIAKFEALA
UBIG_AZOVD            -------------------------------------MS-------NVDHAEIAKFEALA
UBIG_ACIAD            -----------------------------------MSQL-------NVDPQEIAKFEALA
UBIG_PSET1            ---------------------------------MTEHQ--------NVDHAEIAKFEAIA
UBIG_COLP3            --------------------------------MSSQPL--------NVNEDEIAKFEQVA
UBIG_RHOFT            -----------------------------MSHQPYFADNHPMTSTLNADPAELAKFSDLA
UBIG_LEPCP            --------------------------------------------MQNADPKELAKFSELA
UBIG_RALSO            ----------------------------------------MTTTYANADPGELEKFSELA
UBIG_CHRVO            --------------------------------------------MSNVDELEIDKFSQLA
UBIG_DECAR            --------------------------------------------MLNADQAELDKFGELA
UBIG_BORPE            ----------------------------------MTTATQSSAPGVNVDQAEVEKFSALA
UBIG_METCA            ------------------------------------------MATDNVHIGEIEKFGSHA
UBIG_NITOC            ----------------------------------------MNETRINVDPNEIAKFEQLA
UBIG_ALKEH            -----------------------------------MTDPATDTTRRNVHDHEVAKFDAAA
UBIG_IDILO            -----------------------------------MTTSRSKSEQKNVDPEEIAKFSALA
UBIG_NEIMB            ---------------------------------MSDKK-------YNVDEGEIAKFSRIA
UBIG_PSYA2            -------------------------------------MAENTVNAINVDPSEVEKFNKLA
UBIG_HYDCU            ------------------------------------MSQADLNKHKNADPSELNNFNQLA
UBIG_RICPR            --------------------------------------------MSSINKKELEKFEKIS
UBIG_PELUB            --------------------------------------------MNSINKKEIEKFSKIA
UBIG_RHORT            ---------------------------------------MSATTSGTASAAELAKFSAMA
UBIG_MAGSA            ------------------------------------MELKFMDHVGTASPEEIARFTAMA
UBIG_RHOPB            ---------------------------------MSMQSNSSDASSATVDPAEIAKFSRLS
UBIG_AZOC5            ---------------------------------MRMTAN------ATIDPSEVARFDALG
UBIG_SINFN            ---------------------------------------MSETARTTIDQSEVDRFSAMA
UBIG_RHILO            ---------------------------------------MPEPRRSTIDAGEVERFSALA
UBIG_BARBK            ---------------------------------------MINKTRTTVDQSEIDHFSRIA
UBIG_DINSH            ----------------------------------------MTTNTQTVDTSELAKFEAMA
UBIG_PARL1            -----------------------------------MADRADKAARSSVDPGEIARFSAMA
UBIG_CAUSK            -----------------------------------MTQSASTAPSWSIDPADVARFSAIA
UBIG_MARMM            ---------------------------------MTSAAAPNTLNRPSIDPEEVEKFSRIA
UBIG_METSB            ------------------------------------MAQREEAGPSSVDPEDVARFDRIG
UBIG_METS4            --------------------------------------MSAPTGPS-IDAREVARFERIA
Q0DEH4_ORYSJ          PRHALLPQ-WRLCSSAASTNSPPPPPPPPSSPPQGTPRPAGGSTVSSLNPAEVAKFAAIA
A0A3Q7HDE6_SOLLC      STSQNQVT-WRSYSEASQPTPINPPPPPPPSPN------TSTTTSSSLNEFELAKFSAIA
W1PMS0_AMBTC          PRLKSKSQ-LPIYSASTFVLQRFYGSKVGESGA-------ATSVSSSLKQAEVAKFAAIA
M0TZ52_MUSAM          ASSPLLPKLWKRSHTDAAPLPSPTQETRAGTESGDSRGAKSTSFRSSLNEAEVAKFAAIA
COQ3_ARATH            HQRLFSTSDTDASAASFSSSHPKIQTLEGKASN----KSRSTSSTTSLNEDELAKFSAIA
E9G9E5_DAPPU          -------------------------------MLSFLSLLRYGGKAKPSLAETSEHFDQFA
E9HTS9_DAPPU          ------------------VRDLSIRNYSIKSTLSEN---------------EIQKFSKMA
E9HTS6_DAPPU          ------------------VPHLS-RNVSLKSTVNVS---------------EVQKFSGMA
B3S9Y1_TRIAD          ------------------VNISSQRHNTNTSTANEE---------------EIKQFSDIA
COQ3_RAT              WEFSGHRTMWLRSYRITFSCLTRLKTYRSSWKKLYS---TSQT-VDSK---EVKTFQALA
COQ3_HUMAN            GVFNEYRTIWFKSYRTIFSCLNRIKSFRYPWARLYS---TSQTTVDSG---EVKTFLALA
F7F1Z8_MONDO          WLFSNNGIMCLKSNNISFAYSNKMRSLRYVGTRFHS---TSTT-VDPK---EMKIFQALA
F1R9X2_DANRE          VCLH--------------HRQKSQLSNGLTRLNVRS---ISQSTLDPA---EVRKFQAMA
W4Z4G0_STRPU          RDTAPPGPGWMRCSVPLIQQQNGFSVSLKHHHQFEAEQGNASTTMDPE---ELEKFRILS
H2YX78_CIOSA          -----------------TPKAIENVIFRTCDSKQRI----RFMTSQP----ESEKFSRLA
F7B383_CIOIN          -----------------NLHV----------SRPSI----RFMTSQSNIEYEAEKFSKLA
A7S2R8_NEMVE          -----------------VICARRFFTENANHSKSNE----WQSTIDDD---EVARLSRSG
A0A2H2HUE5_CAEJA      --------------------QKRCQSNAVSASSIDS--------------DEVEKFGKLS
H3F3N5_PRIPA          --------------------RLHSAATTAAASASAS--------------NELARFARLA
C3YXC3_BRAFL          --------------------SCSSTAYPSSDSVNESG---TKQKKTSINPEEVKKFNALA
Q7Q8W0_ANOGA          -------------------------IRTQYSNVDQR---------------EVENLSKQS
Q17BU7_AEDAE          -------------------------AHINPPNVDQR---------------EVDTLAKMA
E1JHN2_DROME          -------------------------TAKSLDAGTQK---------------EVRHHENHA
Q16Z38_AEDAE          -----------------------PKEAAPKDSVSKT---------------EIEHLAKMV
Q7Q8W1_ANOGA          -----------------------------MKGTAED---------------DVATFDQLS
A0A087ZYC5_APIME      -------------------------SLIKKSTVDLT---------------DIDHFSKLH
E0VD98_PEDHC          -------------------------EQAKISTLDEK---------------EITKHVSIA
H9JPL1_BOMMO          ------------------------------------------------------MFSKQM
A0A1X7VJD9_AMPQE      --------------------------RRLNSTVDST---------------ETEKFSLSL
G4VGT4_SCHMA          ---------------------------FSSMLIDAT---------------EDANFKRFA
COQ3_DICDI            -------------------KFISNKYFTTTSNSNNNSNNTTTTTTTTLRQDEIDFFNQQS
D3AZU6_POLPP          -------------------NYRSYNYSTNNVNNVNSNSNTTKNTFSSMKEEEIKFFNGMA
A0CP72_PARTE          -------------------RIKLLKYFSSTINQADRQN------------------FNKI
V5BT82_TRYCR          --------------------------------------------MRGVSAAEIGKFRELQ
Q38DV8_TRYB2          ---------------------------------------MSSAMARGVSAAEISKFSRLQ
A4HN95_LEIBR          --------------------------------------------MKGVAADEVAKFAALQ
D0NUY8_PHYIT          -------------------------------------------MFSTVVEDEVRKFNAAS
F4NYX5_BATDJ          ------------------------------------MHTQPTPSSASVNTDEINKFNRTA
E3KPS0_PUCGT          -------------------LRYLATATNSESQTSRSSTQEPEGGQFTVSKSEIEHFNKLA
A8N8V4_COPC7          -------------------ARTVGTTVNQD---------------------EISHFSRLS
Q5K9S4_CRYNJ          -------------------ASPASPASPSTAPSTFS----------TINASEISHFSKLS
COQ3_YEAST            ----------------------SACSRFAIQTQTRCKSTDAS-------EDEVKHFQELA
Q75A09_ASHGO          --------------------HSAPAAGAAGPSPSIGSSTSTS-------ADEISHFQQLA
Q5A4P2_CANAL          --------------------FSRSLHYSKTIFHNGRGLTSTS-------ESEMSHFNALA
C4R3R0_KOMPG          --------------------LRRQFSHVGRLLQQSK-LTATS-------EIEMSHFNQLA
Q6CEG2_YARLI          ISAYRNPVTTIIMNRSTAGRLIRAFHSTARARHGTAGSTSAS-------EEEMKHFKQLA
A7F1A1_SCLS1          ---------LFRTAP-----RYIQNQF---RCQSTTSTSNSS-----VNPDEVSHFNALA
C7YLQ7_NECH7          ---------VLSSAIPPPSLRIIGTSVAAPRWSSTTSSNSSSSNFSSVNPDEVSHFNALA
Q7S214_NEUCR          -------IARLASTPQCFAPVTESPSVRTQRWHSNHNDSRPPSS-SSVNPDEISHFNALA
M2UHG6_COCH5          -------HLFQRPVPFHRLPTFVSRSITTTPPKHHNPTPNST-----VDPTEVSHFNALA
G2WSG0_VERDV          ------------------TRQSLRAATATPPTHARLSSTFSS-----VNAEEISHFNGLA
D5GMB5_TUBMM          -------------------------RTNPTRPHSTTSS---------VDQTEISHFANLA
Q4WPT3_ASPFU          -------------------------------PRAHSTSSVSA--------NELSHFSALA
C8VLC5_EMENI          -------------------------------SHSTSTSSVSA--------SEVSHFSSLA
A0A0D8JT44_COCIM      ------------------------TTAQFLRHHSTTQSSVSS--------DELTHFASLA
COQ3_SCHPO            -----------------------------QGFLSQQRNHSVS-------VNEVDHFNELA
Q4UDP6_THEAN          -----------------------------MSFINIPVKKSYFLLSYNRFTSSVGFFDRFS
                                                                                  

UBIG_HAEPS            KTWWDP-QGD--FKPIHLLNPLRLAYIND-------------------------------
UBIG_HAEDU            HSWWDP-NGS--FKPIHLLNPLRFNYIQT-------------------------------
UBIG_PASMU            KSWWDP-QGD--FKPIHQLNPLRLSYIAQ-------------------------------
UBIG_COXBU            QDWWNP-AGK--MKPLHLINPVRLKYIEQ-------------------------------
UBIG_XYLFA            SGWWDP-HGP--QKPLHALNPVRLDYISK-------------------------------
UBIG_SODGM            ARWWDL-EGE--FKPLHHINPLRLDYILE-------------------------------
UBIG_ECOLI            SRWWDL-EGE--FKPLHRINPLRLGYIAE-------------------------------
UBIG_PROMH            SRWWDL-EGE--FKPLHRINPLRLNYIQE-------------------------------
UBIG_SHEAM            ATWWDP-DGE--FKPLHQLNPLRLNYIDQ-------------------------------
UBIG_PHOPR            SRWWDL-EGE--FKPLHQINPLRLNYVTD-------------------------------
UBIG_SACD2            ARWWDL-EGE--FKPLHDLNPLRANYIDE-------------------------------
UBIG_MARHV            SRWWDP-TSE--FKPLHDINPLRLNYIDE-------------------------------
UBIG_AZOVD            HRWWDR-ESE--FKPLHEINPLRVNWIEE-------------------------------
UBIG_ACIAD            AKWWDQ-HSE--FRPLHQINPLRLNWIDE-------------------------------
UBIG_PSET1            ERWWDL-DGE--FKPLHEINPLRLDFIA--------------------------------
UBIG_COLP3            SQWWDL-TGD--FKPLHQINPLRVQFISQHIALQVEGI----------------------
UBIG_RHOFT            HRWWDL-EGE--FRPLHQINPLRLEWINH-------------------------------
UBIG_LEPCP            HKWWDP-ESE--FRPLHQINPLRLNWIEQT------------------------------
UBIG_RALSO            HRWWDP-NSE--FKPLHEINPLRLDWIQST------------------------------
UBIG_CHRVO            HKWWDK-DSE--FKPLHEINPLRLDFIDRH------------------------------
UBIG_DECAR            HRWWDP-NSE--FKPLHDINPLRIDWIDQA------------------------------
UBIG_BORPE            ARWWDP-ESE--FKPLHAINPLRLGWIQET------------------------------
UBIG_METCA            HRWWDP-DGE--LKTLHAVNPLRMQFIQAH------------------------------
UBIG_NITOC            HRWWDQ-EGE--FKPLHDINPLRLEYIRNH------------------------------
UBIG_ALKEH            SRWWDP-QGE--CKPLHDINPLRLDYVAQC------------------------------
UBIG_IDILO            SRWWDP-DGE--FKPLHKINPVRLGFIENH------------------------------
UBIG_NEIMB            DKWWDK-SGE--FKTLHDINPLRLDYIDGH------------------------------
UBIG_PSYA2            GEWWNK-TGA--FATLHEINPLRLNWIEENVKCGYVSAD---------------------
UBIG_HYDCU            NTWWDE-SGE--FGALHKINPLRIEFIKQF------------------------------
UBIG_RICPR            HNWWNK-NGE--FGILHRINHIRIEYIIE------KIK----------------------
UBIG_PELUB            EEWWDP-NGK--FKPLHNFNPIRIRYIKENIIKDFKIR----------------------
UBIG_RHORT            DAWWDP-EGD--FKPLHKFNPVRIAFLRDHFAAHFG------------------------
UBIG_MAGSA            EAWWDP-QGK--FKPLHRFNPVRLAFMRRHFAAHFG------------------------
UBIG_RHOPB            AQWWDP-TGK--MAPLHKINPLRLSFIRDAACRKFE------------------------
UBIG_AZOC5            AQWWDP-KGK--MAPLHAINPVRLGFVRDVLVRHFG------------------------
UBIG_SINFN            AEWWDP-TGK--FRPLHKFNPVRLAYIRDKVCEQFG------------------------
UBIG_RHILO            AEWWNP-NGK--FRPLHKFNPVRLSYIRDQIAARFG------------------------
UBIG_BARBK            AEWWNP-QGK--FRPLHKFNPTRLAYIKEKICLAFD------------------------
UBIG_DINSH            AEWWDP-MGK--FRPLHLMNPVRLDYITRQIAAEYG------------------------
UBIG_PARL1            AEWWDP-AGK--FRPLHKFNPTRLSYIRERTSAHFG------------------------
UBIG_CAUSK            AEWWDP-RGK--FAPLHVFNPCRLSFIREQALARFE------------------------
UBIG_MARMM            AEWWDP-DSK--FKPLHKFNPIRLGFMRDTICDHFG------------------------
UBIG_METSB            EDWWSA-DGP--MAALHKLNPVRVAYLRDLMSRHFRVEG---------------------
UBIG_METS4            ATWWDE-AGP--MRVLHRFNPVRLAYIRDAACRHHG------------------------
Q0DEH4_ORYSJ          ETWWDS-EGP--FKPLHLMNPTRLSFIRSTLCRHFR------------------------
A0A3Q7HDE6_SOLLC      ETWWDA-EGP--FKPLHLMNPTRLAFIRSTLCRHFR------------------------
W1PMS0_AMBTC          ETWWDI-EGP--FKPLHAMNPTRVSFIRSTLCRHFR------------------------
M0TZ52_MUSAM          ETWWDF-QGP--FQPLHLMNPTRISFIRSTLCRHFR------------------------
COQ3_ARATH            DTWWHS-EGP--FKPLHQMNPTRLAFIRSTLCRHFS------------------------
E9G9E5_DAPPU          QGWWRG-EGP--FEVLHAINPIRLHWLKHRLCGQFQ------------------------
E9HTS9_DAPPU          NEWWDV-NGP--FNGLHSLNKLRVPFIRNGICSHQKSAV---------------------
E9HTS6_DAPPU          SEWWDV-NGP--LKAIHSLNKLRTPFFEQGIRSRQKSTV---------------------
B3S9Y1_TRIAD          SKWWQW-NNK--NMPLHALNMVRVPLIRDALLGDEKSHK---------------------
COQ3_RAT              HSWWDE-QGK--FAPLHSMNDLRVPFIRDNLLKTSTNHD---------------------
COQ3_HUMAN            HKWWDE-QGV--YAPLHSMNDLRVPFIRDNLLKTIPNHQ---------------------
F7F1Z8_MONDO          FKWWDE-QGI--YAPLHSMNDLRVPFIRDNLLKMVARHQ---------------------
F1R9X2_DANRE          SKWWDL-QGE--LSALHSMNDLRVPFIRDNLLNVHGVRQ---------------------
W4Z4G0_STRPU          QQFWKE-SGD--FQALHSMNDLRVPLIRDTLLNQKGGAN---------------------
H2YX78_CIOSA          RNWWDE-DGE--MKALHSMNELRVPFIRDALISLEIAVP---------------------
F7B383_CIOIN          ENWWDE-NGA--MKALHSMNRVRVPFIRDGLISMGCGEP---------------------
A7S2R8_NEMVE          MDWWDA-NGE--FIALHTMNRVRVPYIKKAVLGVQGEML---------------------
A0A2H2HUE5_CAEJA      SEWADE-LGS--FHALHSLNRIRVPWIVENVNK---------------------------
H3F3N5_PRIPA          HEWSDE-KGA--FRALHSMNELRVPWIVEETTKGVP--L---------------------
C3YXC3_BRAFL          SKWWDT-KGE--LKGLHSMNRLRVPMIRDTLVKHHS--I---------------------
Q7Q8W0_ANOGA          SEWWDP-QGP--IRGLHAMNSLRVPLIRDGLIATGAVDK---------------------
Q17BU7_AEDAE          EEWWNP-TGP--LKGLHSMNSLRVPLIRDGLIATNVIPQ---------------------
E1JHN2_DROME          SEWWNQ-NGT--MGALHALNEIRVPFIRDGIVSRGTVKP---------------------
Q16Z38_AEDAE          EFWWDT-KGP--ARMLHTFYQVRVPLVLEGLADTGRIAK---------------------
Q7Q8W1_ANOGA          KRWWEP-NGP--MILLHRLNKLRVPMVVEGLIKVGKLDR---------------------
A0A087ZYC5_APIME      NKWWDV-NGE--IRPLHALNPLRIQLIRDGLA-NIGVKI---------------------
E0VD98_PEDHC          DGWWNE-HGD--LKALHSMNKLRIQLVRDGLMYTKKADV---------------------
H9JPL1_BOMMO          SEWWDV-NGY--LKSLHAMNKVRIPLIRDGLIQTSERTL---------------------
A0A1X7VJD9_AMPQE      KEWWDDRKGP--AAALHSMNTVRVPLIKEALIGTRDEAG---------------------
G4VGT4_SCHMA          QHWWDY-DGD--LQPLHTMNRLRVPFIQNGLCPITLLST---------------------
COQ3_DICDI            SDWWNP-EGT--MKPLHRMNPFRVKYICDRLKIYNEKVS---------------------
D3AZU6_POLPP          KDWWDI-NGP--MRPLHKMNPVRVQYMVDRLKQSGVIKT---------------------
A0CP72_PARTE          QDWWSV-GGS--MAPLYSYNHLRVQFIHEILNRPQKGK----------------------
V5BT82_TRYCR          NHWWNP-DGP--LRTLHFFNPLRVKYINDTCRNFSKRSS---------------------
Q38DV8_TRYB2          KYWWCP-QGP--LRTLHQFNPVRVEFINKACRCAFTPSD---------------------
A4HN95_LEIBR          KHWWDP-TGP--LRSLHLLNPIRVSYVNDIVRSYAKAGG---------------------
D0NUY8_PHYIT          SDWWTP-KSTTGVGPLHQINPVRVKYIRSHVIEHFGHTT---------------------
F4NYX5_BATDJ          AEWWDP-NGQ--YKLLHKMNPVRVKYVRDMLVAHNAVTS---------------------
E3KPS0_PUCGT          STWWNE-HGA--FGLLHRMNPVRVQFIKERLLYDLSRPE-SGSG----------------
A8N8V4_COPC7          SEWWDE-QGE--FSFLHRMNPTRVQFIQEKLAEIASDE----------------------
Q5K9S4_CRYNJ          SQWWSE-TGE--FALLHRMNPVRVEWIRQKVALAPPPEEEWSFE----------------
COQ3_YEAST            PTWWDTDGSQ---RILHKMNLTRLDFVQRTVRNQVKIQN------PEIFVPGFNYKEFLP
Q75A09_ASHGO          PTWWDTNGSQ---RILHKMNLSRMDFIQRILSEQMKVTT------PDVYVPGFNYKAHLP
Q5A4P2_CANAL          SSWWDVNGPQ---RILHKMNLLRMDFIHDTIRQNLKLNENTDD---EVYIPPFSVD-LLP
C4R3R0_KOMPG          STWWDVNGPQ---RILHKMNLLRMDFINDTIKSHLKLNKGVTDPEEQIYIPPFNVDNVLP
Q6CEG2_YARLI          ATWWDTNGPQ---RILHKMNLLRMDFMNENLKVLQQNTS---------------QSAVKP
A7F1A1_SCLS1          STWWDPHGSS---RLLHLMNPLRHDFIRTCHASQPVAPAT--------------------
C7YLQ7_NECH7          ADWWDPHGSS---RLLHLMNPLRHDFIRACHSAQADAPAT--------------------
Q7S214_NEUCR          ATWWDPHGSS---RALHLMNPLRHDFIQTCRSSSPTSSFTVLT----------------E
M2UHG6_COCH5          SSWWDPHGPS---RPLHLMNPLRHEFITRCRSTAVTATPG--------------------
G2WSG0_VERDV          ASWWDPHGSS---RLLHLMNPLRHDFIRACQASTADAPPP--------------------
D5GMB5_TUBMM          STWWDPHGSS---RLLHLMNPIRLSFIQRCILKGSPIPATSST----------------R
Q4WPT3_ASPFU          SSWWDPVGPS---RILHLMNPLRHEFIASCLAES---LPPPRQ----------------T
C8VLC5_EMENI          SSWWDPMGPS---RVLHLMNPIRHEFIASCLAES---SPDSLT----------------K
A0A0D8JT44_COCIM      SSWWDPLGPS---RILHLMNPLRHEFIASCLSEGKSGVPDSAE----------------K
COQ3_SCHPO            KTWWDWDGGS---RLLHLMNSTRLDFMTEVFRERNCFSGK--------------------
Q4UDP6_THEAN          HNWWDI-DGD--MSVLHDYNQVRIPFIANSYINRKKDKVETGSYN------SDNTSNPFL
                        :            ::     *   .                                 

UBIG_HAEPS            -----------------KTNGLFGKKVLDIGCGGGILSE-SMAGLGAI------------
UBIG_HAEDU            -----------------KANGLFGKKVLDVGCGGGILSE-AMAQAGAI------------
UBIG_PASMU            -----------------QANGLTGKKVLDVGCGGGILSE-SMAKQGAI------------
UBIG_COXBU            -----------------QIT-LKGKHVLDVGCGGGLLSE-ALAKHGAI------------
UBIG_XYLFA            -----------------RVP-LSGARVLDVGCGGGLLSE-ALARQGAH------------
UBIG_SODGM            -----------------RSGGLFGKNVLDVGCGGGILAE-SMAREGAK------------
UBIG_ECOLI            -----------------RAGGLFGKKVLDVGCGGGILAE-SMAREGAT------------
UBIG_PROMH            -----------------RADGLFGKKVLDVGCGGGILSE-SMARVGAE------------
UBIG_SHEAM            -----------------TSGGLFGKKVLDVGCGGGILSE-SMARLGAN------------
UBIG_PHOPR            -----------------HAGGLFGKKILDVGCGGGILAE-SMAIEGAD------------
UBIG_SACD2            -----------------RAQ-VAEKKLLDVGCGGGILCE-AMAQRGAI------------
UBIG_MARHV            -----------------RVS-LAGKRALDVGCGGGLLSE-GMALRGAH------------
UBIG_AZOVD            -----------------HVR-LAGKKVLDVGCGGGILSE-AMALRGAA------------
UBIG_ACIAD            -----------------HAGGLAGKKVLDVGCGGGILAE-SMARRGAD------------
UBIG_PSET1            ----------------NKTGGLFDKETLDVGCGGGILSQ-SMARMGAK------------
UBIG_COLP3            ----------------DSKNGFYDMQIIDVGCGGGILSE-SLAKLGAN------------
UBIG_RHOFT            ------------------LCPVAGQQVLDVGCGGGILAD-SMARLGAQ------------
UBIG_LEPCP            ------------------VGKLDGLKVLDVGCGGGILSE-AMAQRGAQ------------
UBIG_RALSO            ------------------A-PLAGKRVVDVGCGGGILSE-SMARAGAN------------
UBIG_CHRVO            ------------------A-SIAGKKVLDVGCGGGILAE-SMALRGAQ------------
UBIG_DECAR            ------------------I-SLAGKRVLDVGCGGGLLSE-GMAVRGAN------------
UBIG_BORPE            ------------------AGSLSGKRVLDMGCGGGILSE-SMAVAGAQ------------
UBIG_METCA            ------------------T-SLAGRKAVDVGCGGGILTE-ALAKAGAD------------
UBIG_NITOC            -------------------ASLAGKRILDVGCGGGILTE-ELTRLGAK------------
UBIG_ALKEH            ------------------LGGLEGRRILDVGCGGGLLAE-GMARRGAE------------
UBIG_IDILO            ------------------TDGLFGKKVLDVGCGGGLLSE-AMAERGAQ------------
UBIG_NEIMB            -------------------ADLCGKRVLDVGCGGGILAE-SMARRGAAF-----------
UBIG_PSYA2            ------H--QK-----TAEMGLAGKKVLDVGCGGGILSE-AMARRGAD------------
UBIG_HYDCU            -------------------QSIENKTILDVGCGGGILSE-SLAKAGGN------------
UBIG_RICPR            ----------------SNYNDISKLQILDVGCGGGLIAA-PLALQGFN------------
UBIG_PELUB            ----------------SSDKPLKNIKLLDIGCGGGLLSE-PMCRLGAS------------
UBIG_RHORT            --------RDI-----EAPRPFEGLSLLDIGCGGGLLCE-PFARLGFA------------
UBIG_MAGSA            --------RDE-----SLMRPFEGLTLLDVGSGGGLLSE-PLARMGFA------------
UBIG_RHOPB            --------RNA-----KSLNCLSGLRMIDIGCGAGLLCE-PFTRLGAQ------------
UBIG_AZOC5            --------HDA-----RSLRPLKGLRILDIGCGGGLLSE-PLARMGAD------------
UBIG_SINFN            --------RDP-----KSPQPLKGLRLLDIGCGGGLLSE-PMARMGAD------------
UBIG_RHILO            --------RDP-----RAARPFEGLRILDIGCGGGLLCE-PMARLGAE------------
UBIG_BARBK            --------RDP-----FSLAPFAGLKILDIGCGGGLLCE-PMVRLGAT------------
UBIG_DINSH            --------RDL-----KSPNPFKGLRILDIGCGGGLLAE-PMARLGAT------------
UBIG_PARL1            --------LDA-----RAVRPFEDLRFLDIGCGGGLLSE-PMARLGAA------------
UBIG_CAUSK            --------RDG-----NGRTPFEGLRLLDIGCGGGLLSE-PMARLGFT------------
UBIG_MARMM            --------LSG-----E--RPFEGLRILDIGCGGGLVCE-PMARLGAH------------
UBIG_METSB            ------LPRDR-----YAPRPLEGLRILDAGCGAGLLAE-PLARLGAR------------
UBIG_METS4            --------RDP-----LGPEPLAGLTLVDIGCGGGVLSE-PLARLGAR------------
Q0DEH4_ORYSJ          --------RDP-----NSSKPLEGLKVIDVGCGGGILSE-PLARMGAT------------
A0A3Q7HDE6_SOLLC      --------KDP-----NCTRPFEGLKFVDVGCGGGILSE-PLARMGAT------------
W1PMS0_AMBTC          --------KDP-----NCARPLEGLKIIDVGCGGGILSE-PLARLGAT------------
M0TZ52_MUSAM          --------KDP-----FSARPFEGLKIVDVGCGGGILSE-PLARMGAT------------
COQ3_ARATH            --------KDP-----SSAKPFEGLKFIDIGCGGGLLSE-PLARMGAT------------
E9G9E5_DAPPU          --------RDE-----KDPLALKGLRLMDVGCGGGLVTE-PLCRMGAQ------------
E9HTS9_DAPPU          ------VNNS-------PTSPLAGCSILDVGCGGGILST-SLGRLGAS------------
E9HTS6_DAPPU          ------ANAR-------QAFPLAGFKVLDVGCGAGILTE-SLGRLGAE------------
B3S9Y1_TRIAD          ------ID---------QPRPLSGYKILDVGCGGGILCE-PLARLGAQ------------
COQ3_RAT              ------PG-----------KPLSGMKILDVGCGGGLLTE-PLGRLGAS------------
COQ3_HUMAN            ------PG-----------KPLLGMKILDVGCGGGLLTE-PLGRLGAS------------
F7F1Z8_MONDO          ------LE-----------SPLSGMKILDVGCGGGLLCE-PLGRLGAL------------
F1R9X2_DANRE          ------LG-----------KPLSGLRILDVGCGGGLLSE-PLGRLGAD------------
W4Z4G0_STRPU          ------RSN---------TRPLHGATIVDVGCGGGILAE-PLARLGAT------------
H2YX78_CIOSA          ------NT----------SKPLQGVKILEVGCGAGVLCE-PLARLGAS------------
F7B383_CIOIN          ------YT----------SKPLQGIKILEVGCGAGVLCE-PLARLGAS------------
A7S2R8_NEMVE          ------TS----------SKPLDGFKMLDVGCGGGLLAE-PLARLGAK------------
A0A2H2HUE5_CAEJA      ------------------IKRTNPPRLVDVGSGGGLLSI-PLAKCGFD------------
H3F3N5_PRIPA          ------P-----------AEAARAPQVLDVGCGGGILSM-ALARRGLR------------
C3YXC3_BRAFL          ------SKK---------SRPLEGLRILDVGCGGGILSV-PLAKLGAQ------------
Q7Q8W0_ANOGA          ------SLIQ-------KPNVLESLNILEVGCGGGILTE-ALAKLHSN------------
Q17BU7_AEDAE          ------EQIQ-------SPQVLKGVNILEVGCGGGILTE-ALARIHAN------------
E1JHN2_DROME          ------GYVN-------TTKVLLGQNILEVGCGGGLLTE-HLARLGAQ------------
Q16Z38_AEDAE          ------ADIT-------KQDALKGVRILEAGCGGGVLAE-DLARLGAY------------
Q7Q8W1_ANOGA          ------KQRY-------TTDALKGLNILDVGCGGGIYAE-ALAKLHAN------------
A0A087ZYC5_APIME      ------ECPY---------LPLEGIKILDVGCGGGLLSE-SLARIGAD------------
E0VD98_PEDHC          ------ENPN-------GPRPLNGVKILDVGCGGGILSE-PLARIGAD------------
H9JPL1_BOMMO          -------------------TPLQDKKILDVGCGGGILAE-GLARLGAN------------
A0A1X7VJD9_AMPQE      ------ELG---------PHPLKGFSILDVGCGGGILCE-SLGELGSD------------
G4VGT4_SCHMA          ------MDS--------VYLPLKGKKILDVGCGGGILAE-ALSMLGAE------------
COQ3_DICDI            ------KNP--------IHLPLEGLNVIDVGCGVGLLTE-SLSRLGASK-----------
D3AZU6_POLPP          ------SGGGG------SGKSLAGLKIIDVGCGAGLLTE-SFSRLGAD------------
A0CP72_PARTE          --------------------SLAGLHSLDVGVGGGILSE-SLRRLGSK------------
V5BT82_TRYCR          --------------LLASSGITPGMRILDVGCGGGILSE-SLVRLGGN------------
Q38DV8_TRYB2          --------------LAATAGIRPGMSVLDVGCGGGILSE-SIARLGGD------------
A4HN95_LEIBR          ------SLTDASIGLLGSHGITPQHQILDVGCGGGILAE-SLARIGGT------------
D0NUY8_PHYIT          ------DED---------PMPLRGLRVADVGCGGGILSE-ALCRIGGT------------
F4NYX5_BATDJ          ------ESTL--------ALPFAGMRLLDIGCGGGFLSE-ALARLGAQ------------
E3KPS0_PUCGT          ----AGSGLDERQSDADSYDFLAGKRVLDVGCGGGIFSE-VLARLGAQ------------
A8N8V4_COPC7          ---------NKNGSIVDPRAVLQGLDVLDVGCGGGLLSE-SLARLGAN------------
Q5K9S4_CRYNJ          ----TRHMDAQREAARGTGAWLTGLRCLDVGCGGGILSE-ALARLGAT------------
COQ3_YEAST            EYVCDNIQREMQESIETNLDKRPEVSVLDVGCGGGILSE-SLARLKWV------------
Q75A09_ASHGO          AAVSEQIQSELNTEVRSLLRQQ-RLQVLDVGCGGGILAE-SLGRQPYV------------
Q5A4P2_CANAL          QGIKNKIDEDQEMRRDEILNDS-SLTVLDVGCGGGILSE-SMARLSFV------------
C4R3R0_KOMPG          KEIADRINGEQEIRRQQLWQQL-KLDALDIGCGGGILSE-SLARLPVV------------
Q6CEG2_YARLI          AGVSLDILPDSDPRKTNAIQLTDKKRVLDIGCGGGILAE-HMARLPWT------------
A7F1A1_SCLS1          ----------------------SGLRYLDVGCGGGIFAE-SAARLRSS------------
C7YLQ7_NECH7          ----------------------TDLTFLDIGCGGGIFAE-SAARLPTT------------
Q7S214_NEUCR          DSGDELPSSSPDAPTYSTTANVQKLRYLDIGCGGGIFAE-SAARLPTT------------
M2UHG6_COCH5          ----------------------QKLRYLDIGCGGGIFAE-SAARLPST------------
G2WSG0_VERDV          -------------------SSAATARYLDVGCGGGIFAE-SAARLPTT------------
D5GMB5_TUBMM          TYTEKLDPTVAVQDAD----NPQKLCFLDIGCGGGILTE-ALARLPST------------
Q4WPT3_ASPFU          ------------TPAATTTTTTNTLRYLDVGCGGGIFAE-SLARTIPISPSS---PITPT
C8VLC5_EMENI          ------------QPG----TPPNTLHYLDVGCGGGIFAE-SLARTIPIPGSTESKSGTVT
A0A0D8JT44_COCIM      ------------NDRQEEEVEKPGLRYLDIGCGGGIFAE-SLARTIPLSYST---FSTQT
COQ3_SCHPO            -------------------------KILDIGCGGGILSE-SMARLGAS------------
Q4UDP6_THEAN          FTQFGIFKEPYKRSTVHIESVLKGLKILDVGCGGGILTE-SLAKFGSK------------
                                                  : * * *.                        

UBIG_HAEPS            ----VTGIDMAADALLVARQHAE--------------SNHLNICYQQITVEDFL--KQHC
UBIG_HAEDU            ----VTGIDMTTEPLEIAKQHAI--------------ENGLTIHYQQTTVEDLR--LNHT
UBIG_PASMU            ----VTGIDMSSAPLQVARKHAL--------------ESGLHIDYQQITIEEFL--QNQT
UBIG_COXBU            ----VTGVDMSESLIDVAKNHAE--------------QQQLNINYQCQDIEILT--KDAQ
UBIG_XYLFA            ----VTAIDLAPELIKVARLHGL--------------ESGIQVDYRIQAIEDLL--AEQP
UBIG_SODGM            ----VTGLDMGAEPLAVARLHA--------------LESGVMLAYHQQTVEEHA--EAHP
UBIG_ECOLI            ----VTGLDMGFEPLQVAKLHA--------------LESGIQVDYVQETVEEHA--AKHA
UBIG_PROMH            ----VTGLDMGKEPLEVARLHS--------------LETGIPVTYIQDTVENHA--AEYP
UBIG_SHEAM            ----VTGIDMGNEPLEVARLHA--------------LETGVSLNYERCTAEEHR--EVNR
UBIG_PHOPR            ----VTGLDMGKEPLTVARLHA--------------LETGAKLDYVLRTAEEQA--ELHP
UBIG_SACD2            ----VTGIDMGDAPLEVAKLHS--------------LESGVNVDYIKTTAEEFA--AKHP
UBIG_MARHV            ----VTGIDMGEAPLSVAKLHG--------------LESGVKVDYRQTTIEELARDPEHA
UBIG_AZOVD            ----VTAIDMGEAPLAVARLHQ--------------LESGVEVDYRQSTVEALA--AEMP
UBIG_ACIAD            ----VLGIDMGEAPLNVARLHAE-------------QEQVANIEYRQIPVEELA--QEQA
UBIG_PSET1            ----VTGIDMGQEPLTVAKLHS--------------LETGVNVEYIKVPAEQYA--SEHP
UBIG_COLP3            ----VTGIDMGTEPLNVAKLHA--------------LETGVSINYQKITAEEKA--LENP
UBIG_RHOFT            ----VTGIDLASKALRVAQLHAL-------------EAQTPNLQYQEISVEALA--AQQP
UBIG_LEPCP            ----VLGIDLAERSLKVAQLHAL-------------ESGQTRVEYREIAAEALA--AEQP
UBIG_RALSO            ----VKGIDLSRKALRVADLHSL-------------EAG-VAVDYEEIAAEALA--AREP
UBIG_CHRVO            ----VTGIDLAKKSLKVAQLHSL-------------ESG-VPIDYRCVAVEDLA--AEMP
UBIG_DECAR            ----VTGIDLSEKPLGVAKLHLL-------------ETG-QKVDYRKISVEELA--EQMP
UBIG_BORPE            ----VTGIDLAEKSLKIARLHGL-------------ESG-VKVDYRAVPVEELA--AEQP
UBIG_METCA            ----ALGIDLSEDLLGTAEEHCR-------------ESG-LTVAYRQISAEALA--DSQP
UBIG_NITOC            ----VTGIDLGKAPLSVARLHAL-------------EEG-LEIDYQQISVERLA--ETKA
UBIG_ALKEH            ----VTGIDMSKAALQVARLHAL-------------EME-VEVAYRQITVEELA--DSDE
UBIG_IDILO            ----VTGVDLAEQSLKVARLHA--------------LESGRQIDYQCIAIETLA--DQQP
UBIG_NEIMB            ----VKGIDMAEQSLETARLHAA-------------LNNVADIEYECIRVEDLA--EAEP
UBIG_PSYA2            ----VTGIDLGTENLKAASLHAEQ------------SNLQDTLRYQHIPVEALA--ATHA
UBIG_HYDCU            ----VTGIDLAEDVLTIARLHS--------------LDTETKVNYHLISAEDHA--QTHE
UBIG_RICPR            ----VTAIDALKSNVETATIYAQ--------------KNGLKINYLQATIEELENDKL--
UBIG_PELUB            ----VVGIDASKKNIEVAKFHAK--------------KNKLKIDYKVASPEMLKDKKK--
UBIG_RHORT            ----VTGIDAAERNIGTASVHAE--------------RAGLPLTYRCAMPEDL-VAEGK-
UBIG_MAGSA            ----VTGIDAGDKNVAVARLHAE--------------QTGVPVDYRVSTPEQL-DPN-E-
UBIG_RHOPB            ----VIGVDPSATNIAAAKLHAE--------------KSQLLIDYRCTTVEQM-DPRE--
UBIG_AZOC5            ----MVGVDPAPGNIVVAQSHAD--------------EAGVRVDYRQGTAEELADAGE--
UBIG_SINFN            ----VLGADASEKNIGIARTHAA--------------GSGVNVDYRAVTAEALAEAGE--
UBIG_RHILO            ----VVGADASETNIEVAKLHAA--------------EGNVIVDYRATTAEDLADAGE--
UBIG_BARBK            ----VIGADAAQNNIEVAKIHAT--------------QSGLSIDYRATTAEKLADKGE--
UBIG_DINSH            ----VVGADAAEGNLPVARLHAE--------------KSGLEIDYRHTTAEALVAAGE--
UBIG_PARL1            ----MVSADASEQNIKTASVHAA--------------EQGLGIDYRCTTAEALAAAGE--
UBIG_CAUSK            ----VTAVDASEKNIKTAATHAA--------------EQGLEIGYRPATAEQLLAEGAG-
UBIG_MARMM            ----VTGVDAAEANIKTASVHAD--------------EQGLEIDYRHGVAEQLIEQDEA-
UBIG_METSB            ----VTAIDPAPRNIEVARRHAE--------------KSGLSIDYRMTTIEALSGEAA--
UBIG_METS4            ----VTGLDPAPTNIRVAKAHAE--------------EAGVPVDYRPQTIESVVAAGE--
Q0DEH4_ORYSJ          ----VTGIDAVDKNIKIARVHAAS------------DPSTASIEYFCTTAEDLVKENK--
A0A3Q7HDE6_SOLLC      ----VTGVDAVDKNIKIARLHADL------------DPQTSSIEYRCTTAESLVEEQR--
W1PMS0_AMBTC          ----VTGIDAVEKNIRIARLHAGL------------DPSTSSIEYSCATAEQLVELNR--
M0TZ52_MUSAM          ----VTGIDAVEKNIKIAQIHAAS------------DPLTSSIEYRCTTAEELVKENE--
COQ3_ARATH            ----VTGVDAVDKNVKIARLHADM------------DPVTSTIEYLCTTAEKLADEGR--
E9G9E5_DAPPU          ----VTGIDLVPQNIACAEEHAL--------------QQGLSLIYKASSLEDFAASSENE
E9HTS9_DAPPU          ----VTGIDPSEENITAASLHANKMR-------------LQNVTFEVNTIEHFQALN---
E9HTS6_DAPPU          ----VTGIDPSEENIEVAYRHAKRIN-------------LRNVAYEANTIEHFQTCN---
B3S9Y1_TRIAD          ----VTGIDASSEIINVAKAHASKCDR-----------VAANVSYQCTTIEQLTTTE---
COQ3_RAT              ----VVGIDPVAENIKIAQHHKSF------D-----PVLDKRIQYRVCSLEETLNE----
COQ3_HUMAN            ----VIGIDPVDENIKTAQCHKSF------D-----PVLDKRIEYRVCSLEEIVEE----
F7F1Z8_MONDO          ----VTGIDPLNENIKTAQQHKSF------D-----PILDKRIQYKACILEDIVEE----
F1R9X2_DANRE          ----VLGIDPVEDSVRTAELHCSY------D-----PDFRERVRYQACTLEELAED----
W4Z4G0_STRPU          ----VIGVDATPENIEVAQHHVSH------D-----PTIRGNVKYICGTAEDLVCT----
H2YX78_CIOSA          ----VLGIDTSDGALAAAKMHRG-------D-----AADLSELQYIDATLEDIVGA----
F7B383_CIOIN          ----VLGIDASDNVLEVAKIHRD-------G-----NTELSDLQYIDADLEDIVGA----
A7S2R8_NEMVE          ----VTGIDASARNTHVAMRHASL------D-----PSLAGKLQYRCITVEQLAQE----
A0A2H2HUE5_CAEJA      ----VTGIDATQRAVEAANRSLEAKPL--NL-----SGVSERLRFQHTSVEEFCQRA---
H3F3N5_PRIPA          ----VRGVDACVESIDVAKKMAE-QAV--IP-----PAVRARLQFDVVEETALGEGK---
C3YXC3_BRAFL          ----VTGLDASEEAVKAATAHMA------RD-----PSLKDTLTFTHGTVEDL-VAS---
Q7Q8W0_ANOGA          ----VVGIDPSEKLISVAKEHAKE-----SA-----TLRPEHLQYHVETIEQHAAK----
Q17BU7_AEDAE          ----VVGIDPGEKLINVAREHKER-----DQ-----KISP-RIQYLVETVEEHAQK----
E1JHN2_DROME          ----VAGIDLGEKLIEAAREHLKC-----SS-----PELASNVVYKIEPVDQHAKA----
Q16Z38_AEDAE          ----VVGVDPGKEMIDLAKTHLDT-----KS-----SELKNLIEYHDITVEEHVKK----
Q7Q8W1_ANOGA          ----VVGIDPARHLIEVAKAHAEA-----QS------DIKDRCHYYEQSMEEHWQG----
A0A087ZYC5_APIME      ----VTGIDASSELITAAKQHA-V-----LD-----ASLDGKLNYFQTIIEDFALN----
E0VD98_PEDHC          ----VTGIDPGQKLIDIAKTHA-A-----ED-----PTVSGKIRYLCESIEDHANG----
H9JPL1_BOMMO          ----VTGIDASEDLINLAREHSET-----NP-----KIINNKPTYYHCTIENHIKT----
A0A1X7VJD9_AMPQE      ----VLGIDPNPVAINVATTHLMLTK---NS-----SDIKDRVKYQSCSLEDLIKADSEP
G4VGT4_SCHMA          ----VLGIDLIEEGIKIAQEHVEATSYRWAD-----HPDLYKPTYKLTSIQSITQEY---
COQ3_DICDI            ----VVGLDAAKNNILMAISHASF-----DQ-----KLNENIQNKSLNYLESTIENF---
D3AZU6_POLPP          ----VVGLDAAGNNISMAIAHAKQ-----DK-----TLSDNIDRNTLQYIESTVEQ----
A0CP72_PARTE          ----VTGIDVSENSIETAIQHKNT-----DP-----ELNDSDLEYKLISIEELSKN----
V5BT82_TRYCR          ----VLGIDMCEESIAVAQQRREQVLQDVASCT-L-QNGAASLEYRYASLNTIAVEEKQ-
Q38DV8_TRYB2          ----VLGIDMCKESIAVAEERRQRVLRDITP--------QASLAYRCVPLHEVVEGEGR-
A4HN95_LEIBR          ----VTGIDACAESIEVAEKRRQEMAANFGASSSP-SNWSQRLSYRHVSLFDIVEQEKQ-
D0NUY8_PHYIT          ----MVSADPGEDNIAAAKKHAAMSRHTN------------TIDYRQCTSDDLVVQGE--
F4NYX5_BATDJ          ----VVGADASGENINVATAHYALDRLLKKG--------PGSIDYRHTTAEKLAQQGE--
E3KPS0_PUCGT          ----VLAIDAAEDSIKAARLHAQSDPLLNDLLSS----PNPNLLYRHCSVESLLQPDN--
A8N8V4_COPC7          ----TTGIDASEANIGIASLHASADPALRS---------GGNLKYLHTTTGDLLTPSPST
Q5K9S4_CRYNJ          ----VVSVDASESNIGIATTHANQDPYLAKKME------KGELEYRFSTAEALRDAGE--
COQ3_YEAST            --KNVQGIDLTRDCIMVAKEHAKKDPMLE-----------GKINYECKALEDV-------
Q75A09_ASHGO          --EKVYGIDLTPDCIAAARAHRDKDPVLR-----------EKIQYDVLPLEEV-------
Q5A4P2_CANAL          --SSVKGIDLSADVLEAAKLHKQKDPMLK-----------DKLSYTLNAIEDI-P-----
C4R3R0_KOMPG          --NRVKGIDLSTEVLEVARQHKKLDPMVR-----------EKLTYELKAVEDLDP-----
Q6CEG2_YARLI          --SSVDGIDMSPDVLQVAVEHAKKDASLT-----------KKLNYRRIALEDL-P-----
A7F1A1_SCLS1          --GSVTAIDPSPVVLSVAKAHARKDPALA-----------GKLTYLNTSIEGLSI--PKT
C7YLQ7_NECH7          --RRVTAIDPTPEVLAVARAHARRDPGLR-----------NKLEYRQTSIENLPV--PAT
Q7S214_NEUCR          --ESVLAIDPSPGVLAIARSHAKKDPSLS-----------PKLTYLSSTIESLPTLKPEA
M2UHG6_COCH5          --TSVTAIDPTPQVLTIAEAHKRRDPVLTS---------PGKLTYLNTSIEDFPR--PSS
G2WSG0_VERDV          --ASVTAIDPSPEVLAIARAHARRDPALR----------PPQLTYLPATIETLPV--PAT
D5GMB5_TUBMM          --ESVVAIDPSKEVLSVALEHARQDPMLT----------GSKLRYINTTIEQLPK-ELEG
Q4WPT3_ASPFU          RAASITAIDPSPTLIKIARDHARLDPNIDSH------LRTGRFSYLNRTLEDLVAEVLRQ
C8VLC5_EMENI          RAASITAIDPTTTLIQIARDHARKDPKVLAH------LNEGRFQYVNCTLEDVIASSPNA
A0A0D8JT44_COCIM      NASSLLAIDPSPVMIEIALSHARKDPTLHSH------LQSGKFKYETTTLESLVS---RS
COQ3_SCHPO            ----VTAVDASPMAIEVAKKHASLDPVLN-----------GRLEYIHGSVEGSQL-----
Q4UDP6_THEAN          ----VLGIDPNEQLIEVAKSHKKTHFDDYHLRLGLRNDYCNNLDYKSISVYDFLTDKTRA
                            . *        *                                          

UBIG_HAEPS            ITDTE----------------KFDIITCMEVLEHVPNPHS-----IIQSCKNLLKED-GL
UBIG_HAEDU            ACNAE----------------KFDVVTCMEMLEHVPDPLS-----VIQSCKALLKPD-GV
UBIG_PASMU            ALFAE-----------RGEDEKFDVITCMEMLEHVPDPSS-----IIACCKQLLKPN-GV
UBIG_COXBU            ---------------------RFDIITCMELLEHVPDPQR-----MIKNCAALIKPG-GK
UBIG_XYLFA            A--------------------PFDAIACMEMLEHVPDPAA-----IVDACAHLLKPG-GR
UBIG_SODGM            G--------------------AYDVVTCMEMLEHVPDPAS-----IVRACARLVKPG-GE
UBIG_ECOLI            G--------------------QYDVVTCMEMLEHVPDPQS-----VVRACAQLVKPG-GD
UBIG_PROMH            Q--------------------RYDVVTCMEMLEHVPDPSS-----IVRSCAKLVKPG-GH
UBIG_SHEAM            E--------------------AYDVVTCMEMLEHVPDPLS-----VIAACCDMVKPG-GY
UBIG_PHOPR            E--------------------TYDIVTCMEMLEHVPNPAS-----VIAACAKMVKPN-GH
UBIG_SACD2            Q--------------------SYDVVTCLEMLEHVPDPAQ-----TIAACAQLVKPG-GD
UBIG_MARHV            G--------------------QYDVVTCLEMLEHVPDPAS-----VIRACASMLKPG-GH
UBIG_AZOVD            G--------------------RFDVVTCLEMLEHVPDPAS-----VIHACHTLVKPG-GQ
UBIG_ACIAD            G--------------------QYDIVTCMEMMEHVPDPAS-----IIKACQTLVKPG-GH
UBIG_PSET1            A--------------------RFDVVTCMEMLEHVPDPAS-----IIHAVAELAKPG-AD
UBIG_COLP3            G--------------------TFDVVTCMEMLEHVPDPAS-----VIQACSTLVKPG-GL
UBIG_RHOFT            G--------------------SFDVVTCMEMLEHVPDPAS-----VVRACATLVKPG-GW
UBIG_LEPCP            A--------------------RYDVVTCMEMVEHVPDPAS-----IVQACSQLVKPG-GW
UBIG_RALSO            G--------------------SFDVVTCMEMLEHVPDPAS-----VVRACATLVKPG-GH
UBIG_CHRVO            G--------------------AFDAVTCMEMLEHVPDPES-----VVRACSTLVKPG-GW
UBIG_DECAR            G--------------------EFDAVTCLEMLEHVPNPSS-----VITACARLVKPG-GQ
UBIG_BORPE            G--------------------QYDVVTCMEMLEHVPDPAS-----VVRACAALAKPG-GW
UBIG_METCA            G--------------------EFDVVTCMEMLEHVPDPAS-----VVAACTRLAKPG-GT
UBIG_NITOC            G--------------------SFDVITNLEMLEHVPYPAS-----VVAACGQLLKPG-GK
UBIG_ALKEH            P--------------------RFDAVTCLEMLEHVPDPAS-----AVHACARLVKPG-GH
UBIG_IDILO            A--------------------SFDVVTCLEMLEHVPDPKA-----IVKACAKALKPG-GK
UBIG_NEIMB            H--------------------SFDVVTCMEMMEHVPDPAA-----IVRACANLVKPD-GM
UBIG_PSYA2            G--------------------QFDVVTCMEMLEHVPDPAA-----IVDACFKLLAPG-GV
UBIG_HYDCU            E--------------------EYDIVTCMEMLEHVPDPAS-----IIHAAAKAVKPG-GW
UBIG_RICPR            ----------------------YDVVICLEVIEHVANIQQ-----FILNLVQHIKPN-GI
UBIG_PELUB            ----------------------FDVILNMEIVEHVNDIDF-----FIKESSKLLKKN-GI
UBIG_RHORT            ---------------------TFDAVLTMEVVEHVADVRL-----FLDSVGQLCRPG-GA
UBIG_MAGSA            ---------------------AFDVVLSMEVVEHVPDVSA-----FLGHATARLKPG-GV
UBIG_RHOPB            ---------------------RFDIVLAMEVIEHVTDVGA-----FLARCAAITKPG-GL
UBIG_AZOC5            ---------------------RFDVVLALEVVEHVADVGL-----FLRRAGEMVNPN-GI
UBIG_SINFN            ---------------------SFDIVLNMEVVEHVADVDF-----FMTTCAHMVRPG-GL
UBIG_RHILO            ---------------------TFDVILNMEVVEHVADIDL-----FVAKCGQMVRPG-GI
UBIG_BARBK            ---------------------KFDIILNMEIVEHVADVDL-----FISATAKMLKPQ-GL
UBIG_DINSH            ---------------------QFDSVLNMEVVEHVADPLA-----YLTACKDLLKPG-GI
UBIG_PARL1            ---------------------TFDVILNMEVIEHVADPMA-----FLKDCASMLRPG-GL
UBIG_CAUSK            ---------------------PFDVVLTMEVVEHVADPGE-----FLRTCAKLLAPG-GL
UBIG_MARMM            ---------------------PFDVVLNLEVMEHVANPHT-----FLVDCARLVKPG-GL
UBIG_METSB            ---------------------TFDAVLAMEVLEHVLDVAG-----FVRCCGALVRPG-GL
UBIG_METS4            ---------------------RFDLVVAMEVVEHVADMAS-----FVRTACAAVRPG-GL
Q0DEH4_ORYSJ          ---------------------QFDAVISLEVIEHVANPSG-----FCESLSALTVPN-GA
A0A3Q7HDE6_SOLLC      ---------------------QFDAVIALEVIEHVADPAG-----FCKSLSALTIPG-GA
W1PMS0_AMBTC          ---------------------EFDAVIALEVIEHVANPSE-----FCQSLAALTAAN-GA
M0TZ52_MUSAM          ---------------------KFDAVISLEVIEHVADPSD-----FCKSLAALTVPL-GA
COQ3_ARATH            ---------------------KFDAVLSLEVIEHVANPAE-----FCKSLSALTIPN-GA
E9G9E5_DAPPU          K--------------------AFDGVIAFEVIEHGPDPEG-----FLRHAAQILSSG-GL
E9HTS9_DAPPU          ----------------TSLSTTFDAVVASEVIEHVENPKF-----FIQTCTELLKPG-GS
E9HTS6_DAPPU          ----------------STL---FDAVIASEVVEHVDNPEL-----FIEKCSESLKPG-GS
B3S9Y1_TRIAD          ----------------NAQS--FDAVIASEVIEHVDNVDL-----FVSSCCQLIKPG-GK
COQ3_RAT              -----------------NAE-CFDAVVASEVVEHVNNLEM-----FIQCCYQVLKPG-GS
COQ3_HUMAN            -----------------TAE-TFDAVVASEVVEHVIDLET-----FLQCCCQVLKPG-GS
F7F1Z8_MONDO          -----------------TAE-SFDAVVASEVVEHVNDLET-----FIQCCCKVLKPG-GS
F1R9X2_DANRE          -----------------EAE-GFHAIVASEVVEHLADLDA-----FANCCHQVLKPG-GS
W4Z4G0_STRPU          -----------------EDE-AFDALVCSEVLEHVSHKEN-----FIKTCAELVKPG-GS
H2YX78_CIOSA          -----------------GTL-RFDVVVASEVVEHVDNKAE-----FVTQCCDVLKPN-GS
F7B383_CIOIN          -----------------GTL-RFHAVVASEVVEHVEDKTK-----FINNCCSLLMPN-GS
A7S2R8_NEMVE          -----------------KK--VFDCVVSSEVIEHVTEKES-----FIGAISQLLKPR-GS
A0A2H2HUE5_CAEJA      ----------------ENKS-GYDAVVGSEIVEHVADLNR-----FVNSLAELARPG-AP
H3F3N5_PRIPA          ----------------E-CG-AYDAVVASEVVEHVPSVPA-----FVRSLVAAAKPG-AP
C3YXC3_BRAFL          ----------------EVRD-YYDALVASEVIEHVDALDD-----FVGSSCDLVKPG-GS
Q7Q8W0_ANOGA          -----------------HAE-RYDAVVASEVLEHVNDKVA-----FVEQCLAALKPG-GS
Q17BU7_AEDAE          -----------------NVE-RYDAVIASEVLEHVNDKPA-----FLEHCIMALRPG-GS
E1JHN2_DROME          -----------------NCE-CYDAVIVSEVLEHVKDKVS-----LLEASVRSLKPG-GS
Q16Z38_AEDAE          -----------------FAG-TYDAIVCSEVMEHVDEKES-----ILAACCRCLKPG-GS
Q7Q8W1_ANOGA          -----------------AAN-KYDVVVLSETIEHVVDKSS-----LLKHVAEVLKPG-GS
A0A087ZYC5_APIME      -----------------NKE-VYNAVVASEVIEHVNNKEL-----FLKCCISSLKPG-GS
E0VD98_PEDHC          -----------------HKE-KYDAVVASEVIEHVASKEI-----FLESCANVLKPG-GS
H9JPL1_BOMMO          -----------------HKE-HYDAVVASEVIEHITDKQL-----FVNSCVAATKPG-GR
A0A1X7VJD9_AMPQE      I--DT-----------DSSSEDFDCVVASEVLEHVADVDM-----FVHQLSQMAKPG-GS
G4VGT4_SCHMA          -------------------PCQFDAVVASEVFEHVTDWED-----MLNNLKQCLKLD-GM
COQ3_DICDI            ---YN-----------IENDQQFDAVCSLEVIEHVDNPKQ-----FIDYLSKIVKPG-GS
D3AZU6_POLPP          ---HA-----------IDHHSSYDIVTTMEVVEHVENVPE-----FIKQCTSLIKPG-GC
A0CP72_PARTE          ------------------QEKQFDIITAMEVIEHVENLPL-----FIESLGKLLKPD-GK
V5BT82_TRYCR          ---------------------QFDLVVASEVIEHVDDAPR-----FLQDLCDATKPG-GL
Q38DV8_TRYB2          ---------------------QFELVVASEVIEHVSDAAA-----FLHDICAATKPG-GV
A4HN95_LEIBR          ---------------------QFDIVVASEVIEHVSDARA-----FLQALCEATRPG-GL
D0NUY8_PHYIT          ---------------------QFDVVCSLEVIEHVSDVSA-----FLHSLTPLVKPG-GL
F4NYX5_BATDJ          ---------------------QFDAVVALEILEHVNDPKS-----FVRTCTQLVKPD-GL
E3KPS0_PUCGT          ----------------LNHRAQYDIVCAMEVIEHVENPAG-----FLTALAELTKPG-GQ
A8N8V4_COPC7          P---------------TQPPKQYDVVASLEVLEHVDNPAH-----FLDTCCQLVKPG-GH
Q5K9S4_CRYNJ          ---------------------KFDVVCSMEVLEHVDEPGE-----FMKCLGEMVKPG-GH
COQ3_YEAST            -------------------TGQFDIITCMEMLEHVDMPSE-----ILRHCWSRLNPEKGI
Q75A09_ASHGO          -------------------EGQFDVVTMFEMLEHVENPSA-----VLEHAWRRLRPE-GI
Q5A4P2_CANAL          ------------------ETERFDIVTMFEVLEHVDYPSR-----VLLEGLKRLESG-GW
C4R3R0_KOMPG          ------------------NTEQYDVVTMFEMLEHVNYPAE-----VLKAALRHVKPG-GW
Q6CEG2_YARLI          ------------------RDEKFDIVTMYEVLEHITYPAE-----FMKHALSKVNPG-GW
A7F1A1_SCLS1          KEEQ------------------YDVLSLFEVIEHITYPSS-----FLDKCMPFVKPG-GW
C7YLQ7_NECH7          PEEA------------------YDVVSLFEVIEHVDAPAA-----FLEKVRPFVKPG-GW
Q7S214_NEUCR          VEKK------------------FDVVSCFEVIEHVDHPAL-----FLDHVAKFVKPG-GW
M2UHG6_COCH5          DTEA------------------FDIVSLFEVIEHVNAPGP-----FLEHVLPHVKPG-GW
G2WSG0_VERDV          PADR------------------FDVVSVFEVVEHVDSPAE-----FLARCAPFVKPG-GW
D5GMB5_TUBMM          QRNQ------------------FDVVTLMEVIEHVPRPSS-----FLRTTMEHVRPG-GW
Q4WPT3_ASPFU          DTSSTSPVPETAPQAEAEADRRFDVVTLFEVLEHVDSSAGSSPLAFLTDCLRLVRPG-GW
C8VLC5_EMENI          NQSSNSTDASRAGAGVRRKDG-FDVITLFEVIEHIDTNASITPLTFLTNCLRLLKPG-GW
A0A0D8JT44_COCIM      TPSSSSTMPSAPPPPTTNSSD-FDIVTIFEVLEHVDPSTS-SPRQFIENCLRLVRPG-GW
COQ3_SCHPO            -------------------PTTFDVVTCMEVLEHVEQPRD-----FLFSLMEKVKPN-GR
Q4UDP6_THEAN          ---------------------SFDIVVASEVIEHVENREK---ERFLEALTSLVKPG-GL
                                            :. :   * .**                        . 

UBIG_HAEPS            LFISTINRTAKAYMLIIIGAEY---VLKMLPKGTHNFEKFIKPSELLRWCSQEDFECKEI
UBIG_HAEDU            LFLSTINRTLKAYMLVVIGAEY---LLKMLPKGTHEFEKFIKPAELLTWCDQASLECKEM
UBIG_PASMU            IFFSTINRTLKAWALVIIGAEY---VLKMLPKGTHDYDKFIKPAELLHWCDEAQLTCLDM
UBIG_COXBU            LFFSTINRNFKAYLYTIVGAEY---VFNLLPKGTHDYAQFIRPSELTQWAESGGLRLLDI
UBIG_XYLFA            LFVSTINRTLAAFMLAVVGAEY---VVRLLPKGTHQYKDFIRPAELAAWLRHAGLHLEDV
UBIG_SODGM            VFFSTLNRNPKAWLMAIVGAEY---VLRMVPRGTHDITKFIKPAELLGWVDDTPLREQHI
UBIG_ECOLI            VFFSTLNRNGKSWLMAVVGAEY---ILRMVPKGTHDVKKFIKPAELLGWVDQTSLKERHI
UBIG_PROMH            VFFSTINRNKKAWFMLVVGAEY---ILNMVPKGTHDANKFIRPSELLSWVDETNLRSKNM
UBIG_SHEAM            VFFSTINRNLRSYVETILGAEY---LLKMLPVGTHDHGKFIRPSELIAMVDQTELLCKDA
UBIG_PHOPR            VFFSTLNRNAKSYLFAIVGAEQ---LLKLVPKGTHDHKKFIRPSELIAMIDQTPLQDRHI
UBIG_SACD2            IFFSTINRNPKAYLFAVVGAEY---VLKMLPKGTHDYNKFIRPSELAQWMRNAGLELQEM
UBIG_MARHV            MFVSTINRNPKSFLFAIVGAEY---VLNLLPKGTHEWKKFIRPSEMSDHLRHAGLEVREL
UBIG_AZOVD            VFFSTINRNPKAYLLAIIGAEY---LLKLLPRGTHDFRKFIRPSELGAWCRASGLAIGDI
UBIG_ACIAD            VFFSTINRNPKSYLFAIIGAEY---VLRLLPKGTHDYHKFIRPSEMAHDIREAGLKLKDM
UBIG_PSET1            VFFSTLNKTPKAYLYAIIGAEK---LLKMVPEGTHDHKKFIKPAQLIAWAEQAGLKVRAS
UBIG_COLP3            IFFSTLNKSIKSYLLAILAAEK---LLKIVPDGTHDHDKFIRPSQLIGWAEEHGLKCIDA
UBIG_RHOFT            VFFSTLNRSPKSFVLAIVGAEY---VLNLLPRGTHEYAKMIRPSELASYCRSVELDLRHT
UBIG_LEPCP            VFLSTINRNPKSFLLAIVGAEY---VLKMLPAGTHEYAKFIRPSELLRWCRDTGLDLRHT
UBIG_RALSO            VFFSTIHRNAKAYLLAVIGAEY---VLNMLPRGTHDYAKFIRPSELAGFARTAGLEPAQL
UBIG_CHRVO            VFFSTLNRNAKAYLLAVVGAEY---VLNMLPRGTHEYARFLKPSELGRMARHAGLGLQTL
UBIG_DECAR            VFLSTLNRNPKSYLFAVIGAEY---VLQMLPKGTHDYARFIKPSELARWAKMANLEPEEL
UBIG_BORPE            VFFSTLNRNPKSFLFAIVGAEY---VLRLLPRGTHSYDSFIKPSELATSARQAGLEPTGM
UBIG_METCA            VFFSTLNRSLKAYLLAIVGAEY---LLRMIPRGTHDFASFIRPSELSRWARDGGLDLAGM
UBIG_NITOC            VFFSTLNRTPKAYLFAVIGAEY---ALRLLPKGTHDYHRFIRPAELETWCRKGGIELQNL
UBIG_ALKEH            VIFSTLNRNPKSYLFAILGAEY---LLQLLPKGTHDWQQFIRPSELDRWAREADLVLRSM
UBIG_IDILO            IFFSTLNRNVKSWLLGIVAAEH---VLGWVPKGTHQHQRFIKPSELLRMTDAAALEDIAI
UBIG_NEIMB            VFFSTINKNPKSYLHLIVAAEY---LLKFVPKGTHDWKKFIAPAELARMCRQAGLDVADT
UBIG_PSYA2            CVLSTINRNPKSYLFAIVGAEY---VLRLLDRGTHDYAKFITPAELDKMAIDAGFTRQDI
UBIG_HYDCU            VFFSTLNRNYKSYLLAIFAAEQ---VLNLVPKGTHTHDKFIQPSELDAMARQAGLFLKEG
UBIG_RICPR            AIISTMNRTKKAYLFGIIVAEY---ILGWVPKNTHDYSKFVKPSEIYEILTDTNIEIKEL
UBIG_PELUB            MFIATLNKTLKSYVFAIVGAEY---ILKWLPIGTHDWEKFVKPSELIDISKKNNLSLKKL
UBIG_RHORT            VGAATLNRTLKSLALAKVGAEY---VLRWLPRGTHDWRKFMKPSELTAGLREAGLSVDAI
UBIG_MAGSA            FMGATLNRTAKAWALAVVGAEY---VLGWLPKGTHDWNKFVRPSEFAAMLRDRGITVRQM
UBIG_RHOPB            MVVATLNRNWKSFALAIVGAEY---VMRWLPRGTHQWDKFVTPDELTKHLHNNKLAVTEQ
UBIG_AZOC5            MIVSTLNRTVKSFALAIVGAEY---VLRWLPRGTHRWDKFITPAELEAEMGAAGFEMSEL
UBIG_SINFN            MFVATINRTLKAAALAIFAAEN---VLRWLPRGTHQYEKLVRPEELEKPLEASGMQVTDR
UBIG_RHILO            MFVATINRTLKALGLAIIGAEY---VLRWLPRGTHQFGKLVRPEELEKALGGASLTIIDR
UBIG_BARBK            MFIATLNRTWKSWGLAIVGAEY---ILRWLPKGTHDYKKFLKPQELKKLLLTNSLKVIDE
UBIG_DINSH            MLCSTLNRNPKSFAMAIVGAEY---VLKWLPKGTHDWRKFLTPDELTKLLEQAGLEPVDK
UBIG_PARL1            MFIATLNRTLKAHAFAIVGAEY---VLGWLPRGTHDWKKFITVNEMETGIADAGLRLKEL
UBIG_CAUSK            MIVATLNRTLKALALAKIGAEY---VLRWVPPGTHDWKQFLKPDELRAFLAGEPVDVHGP
UBIG_MARMM            MICATINRTSKAFALAIVGAEW---VMGWLPRGTHRFHKLVKPSQIRTALREGGMSLRAP
UBIG_METSB            MFAATLNRTLKSFAFAIVGAEY---VLGWAPRGTHDWRRFISPRELARAMAAADLSAFDE
UBIG_METS4            FFAATINRTMRSFALAIVGAEY---VLGWLPRGTHDWEKFVTPEELARAVESGGLVVADT
Q0DEH4_ORYSJ          TVISTINRSMRAYATAIVAAEY---ILNWLPKGTHQWSKLVTPEELVLILERASISVQEM
A0A3Q7HDE6_SOLLC      TVISTINRSMRAYATAIVAAEY---LLHWLPKGTHQWSSFLTPEELVLILQRASISVQEM
W1PMS0_AMBTC          TVISTINRSMRAYAAAIVAAEY---ILRWLPRGTHQWSSFLTPEELVLLLQRASISVQEM
M0TZ52_MUSAM          TVISTINRSMRSYATAIVAAEY---LLNWLPRGTHQWSRFLTPEELVLILERASISVQEM
COQ3_ARATH            TVLSTINRTMRAYASTIVGAEY---ILRWLPKGTHQWSSFVTPEEMSMILQRASVDVKEI
E9G9E5_DAPPU          LMLSTLNRTFRSYLSGIVAAEY---LLRWVPRGTHTWQAFLTPSDLRWHLRRAGLEEPAF
E9HTS9_DAPPU          LFITTLNRTPASLALAICGAEY---ILNVVPRGTHDWNKFITPGELIDYINSSGCQLRQL
E9HTS6_DAPPU          LFITTQNRTAASWALVICGAEY---IMNVVPRGTHDWNKFITLDEMTSILDKNNCQLRQL
B3S9Y1_TRIAD          HIVTTINRTPLSYAVMIIGGEY---ISRIIPAGSHDWKKFITPKELTKKLEEGGLNVDFI
COQ3_RAT              LFITTVNKTQLSYVLGIVFSEQ---IAGIVPKGTHTWEKFVSPEKLESILEPNGLSVETV
COQ3_HUMAN            LFITTINKTQLSYALGIVFSEQ---IASIVPKGTHTWEKFVSPETLESILESNGLSVQTV
F7F1Z8_MONDO          LFITTINKTQLSYALAIIFAEQ---IAGIVPKGTHTWEKFVSPEQLESFLESNGLLVQTI
F1R9X2_DANRE          LFITTINKTNLSYVFGIVAAEQ---LLRIVPSGTHDWEKFISPEDLERLLESFGFYVEAI
W4Z4G0_STRPU          IFFTSVNQTWLSYALGIVMAEK---VLGLVPDGTHDWNKFISPGYIQRVLEENDCSVRLT
H2YX78_CIOSA          LFLSTINRTQMSYFLAIMMAEK---VLGVVPDGTHDWKSFVTHSEIKSYLDQGNAQIQRL
F7B383_CIOIN          LFLSTINRTQVSYLLAVLMAEE---VLGVVPPGTHDWEMFVTTDEIKSYLNQGNCEIQKI
A7S2R8_NEMVE          LILTTMNRTPQAYVLAIVAAEY---IAHAVPIGTHDWNKFPKISELTELLQENGLETEDI
A0A2H2HUE5_CAEJA      LFITTINRTMMSKLTAIWLAEN---VMKIVPAGVHNWEKFVTPEELSAVLFDSGCSVVAT
H3F3N5_PRIPA          IFLTTINRTTLSRVAAIWLAEE---VLRVVPSGMHDWRQFVKPEELTAELEANGCKVHQV
C3YXC3_BRAFL          LFFTTINRTTQSYYLAVIAAEY---IVGVVPRGTHNWNKFVKPEELKDELKANNCHPRLI
Q7Q8W0_ANOGA          MFLTTINKTTPSWLGAIVAAEQ---IFHLVPEGTHDWDKFISPLDLQRILSSYNCTTILV
Q17BU7_AEDAE          IFITTLNQTTASWVGGIVAAEY---ILKLVPENTHDWDKFIAPLDLERILKSFNCTTVLV
E1JHN2_DROME          IFITTLNKTIPSWFGGVLLSEY---VLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLV
Q16Z38_AEDAE          LFVTTENQTMLAWFVFIIIPEY---ILKFIPKGTHFYEKFVSPHVISKIASKYGCKTRSV
Q7Q8W1_ANOGA          VFISTWNKTSWSWLLAVVVLEN---IMKRLPKGSHDYDKFVSPEETEAILEAYGCRTIEQ
A0A087ZYC5_APIME      IFLTTINKTLPSWLGGIIAAER---ILKVVPKGTHDWNKFVTPTEMQSLLETYGCKTKLI
E0VD98_PEDHC          IFITTINRTTQAWIAGVITAEY---LLHLVPKETHDWEKFITPHELQFMCEKYDCFTKLV
H9JPL1_BOMMO          LFFTTPNKTRISQFLTIFVVEN---IIKIVKKGTHQYDKFITPNELTFLLERNNCLVESI
A0A1X7VJD9_AMPQE      VVFSTINRTIPSLFLAKMAAEY---IFNILPRGTHDWNKFVTPEELDEIVKRHSMSTVSV
G4VGT4_SCHMA          LFVTTINHTAASLLLGIGVAEY---VARIVPRGTHNWNKFIEPSRLQIACIKRGFQPRQL
COQ3_DICDI            IFISTINKTFLSYISAILGAEY---IFRMVPVGTHHWDQFIKPKDLESYFDSNNCQITDL
D3AZU6_POLPP          FFLSTMNKTTLAYLTTIVGAEY---ICKFVPVGTHHWDQYVKPEDLQSYLSGNQVNLKDI
A0CP72_PARTE          LFISSINKSYESYLKLIIGAEY---IARVVPQGTHDWNNFKTPEQVWLQLNKQKINIDVL
V5BT82_TRYCR          LIISTMDKSIRAAISHIAVAEY---LTALVRPGTHDWSKFVPPKDLSRCALQHQVRQVDL
Q38DV8_TRYB2          LVISTMDKSLFTALSFIVVAEH---ITGIVEPGTHDWAKFIPPADLSRCALNHGVSQIEM
A4HN95_LEIBR          LFLSTIDKSLTTAIVYIGVAEM---LTGFVEPGTHDWRKFIPPDDVTAFAQRFSVRKVDQ
D0NUY8_PHYIT          LFLSSINRTALSAALAIGAAEY---VMRIVPPGTHDWNKFVRPDEIETELRKNGFTVKDV
F4NYX5_BATDJ          MFYSTINRTPASYIFTILLAEH---FLKWVPVGTHSHDKYIAPEELEMYLRAAQSSMLNT
E3KPS0_PUCGT          IILSTISRTPLSKLLTITLAESNLPIVGIVPPGTHTYNKFIKPDELTEFFRGQLGWATSH
A8N8V4_COPC7          LFLSTIARTPLAYTLTILMAEH---VLGKVSKGTHTWSKYVNPDELVEFFKNYPEGAPKD
Q5K9S4_CRYNJ          LLLSTISRTPLSHLLTITLAED---ILRLVTPGTHTYRKFIKPEELRRFVYSDMGGFKTW
COQ3_YEAST            LFLSTINRDLISWFTTIFMGENV---LKIVPKGTHHLSKYINSKEILAWFNDNYSG----
Q75A09_ASHGO          LFVSTINRNLLSWFTTICMAEHV---LRVVPKGTHHLEKYLDATEVQDWFQQHTPG----
Q5A4P2_CANAL          LFLSTINRDFVSWFTTIFMGEHV---LRIVPVGTHTLEKYINQSEIKDWLQEDSNR----
C4R3R0_KOMPG          IFISTINRDLISWFTTIFMGEHI---LKIVPLGTHTYDKYINEKELEKWVEDGHENSDL-
Q6CEG2_YARLI          VFLSTINRTPISWFTTIFVAEHL---MRLVPPGTHTYSKYINEEEIRDFFATQKDW----
A7F1A1_SCLS1          IIMSTMARTWTSWLTTKVVAEDV---MGIVPRGTHDWYQYINEEELRGHFLRERG-----
C7YLQ7_NECH7          LVMSTIARTWMSWFTTNFIAEDV---LGMVPKGTHDWNKYLNEEELR-HFLANQG-----
Q7S214_NEUCR          LVMSTIARTWTSWFTTNFMAEDV---LGIVPKGTHDWNKYINEYELRGYFEETEEKRRF-
M2UHG6_COCH5          LVMSTIARTWTSWLVTNVIAEDV---LGMVPKGTHEWSKYVNEEELRNWFAKQPG-----
G2WSG0_VERDV          LVGSTIARTWVSWLTTNFLAEDV---LGIVPKGTHDWNKYINDAELTAWFAGQSG-----
D5GMB5_TUBMM          LVLSTIARTWASFLTTKFVAEDI---LGIVPRGTHDWNKYINAEELGEFFKETGG-----
Q4WPT3_ASPFU          LIGSTIARTLPSWLVNQVIAEAPW-PIGVVPRGTHEWSKFVNPDELEGWMQEGLMRSSD-
C8VLC5_EMENI          LIGSTIARTFPSWLVNQVIAEAPW-PVGVVPKGTHEWKKFVNPDELESWASEGLMRSVDL
A0A0D8JT44_COCIM      LIGSTIARTWPSFIVNQLLAEAPW-PIGVVPRGTHEWSKFVNVDELRTWSRTVRVEEEGL
COQ3_SCHPO            LVLSTISRTLLARLLTITLAEHV---LRIVPVGTHTFEKFIRADELSNFLKEQNWI----
Q4UDP6_THEAN          FVITTPGSSLLSYFVNVFLAEN---LLSKVPKHTHDFDLFISPRNCSRILKKLNFDPVSI
                         ::      :        *             *                         

UBIG_HAEPS            V--------------------GYHFNPLTKNFWI-N---------KDINCNYIAVLQNS-
UBIG_HAEDU            K--------------------GYHFNPLTEKFWL-N---------NDVSCNYIAMLKAK-
UBIG_PASMU            V--------------------GYHYNPLTGKFWL-N---------KDVSANYMASFRIQS
UBIG_COXBU            T--------------------GIHYHPLKNEFDL-S---------RDVSVNYLACFTHE-
UBIG_XYLFA            S--------------------GMRYEPWRNRARL-T---------DRTDINYLACAISPE
UBIG_SODGM            I--------------------GLHYNPLRDRFYL-G---------GNVDVNYMLHTRRQA
UBIG_ECOLI            T--------------------GLHYNPITNTFKL-G---------PGVDVNYMLHTQNK-
UBIG_PROMH            I--------------------GLHYNPITDKFRL-A---------PNVDVNYMVHTQATD
UBIG_SHEAM            T--------------------GVTYNPITGTFRY-T---------SSVEVNYMIATVKPL
UBIG_PHOPR            T--------------------GLHYNPLTDNYWL-G---------KSVEVNYIVHTVKL-
UBIG_SACD2            C--------------------GMTYNPITKHYKLNA---------KDVSVNYIMHARKI-
UBIG_MARHV            T--------------------GMTYNPITKVYKL-G---------RDVDVNYLMHARDTR
UBIG_AZOVD            V--------------------GLTYNPLTRHYKL-G---------TDVDVNYMIQTWREE
UBIG_ACIAD            T--------------------GLHYNPLTKHYWL-A---------PNVDVNYMVHTLKEG
UBIG_PSET1            A--------------------GLSYNPLSKQYSL-N---------TDVSVNYILHFEKLA
UBIG_COLP3            S--------------------GIHYNPITGNHKL-N---------DSLDVNYILCCRKL-
UBIG_RHOFT            R--------------------GMQYNPLTRRYWM-S---------DDTSVNYLFATQKSN
UBIG_LEPCP            R--------------------GMEYNPLTRRYWL-S---------ADTSVNYLVACRKET
UBIG_RALSO            R--------------------GLEYNPLTGRYAL-T---------HDTSVNYLIATRRPD
UBIG_CHRVO            S--------------------GMGYNPVTRIYSL-N---------DDTAVNYLMATRRAD
UBIG_DECAR            V--------------------GMSYNPLTKKYSL-G---------KDTSVNYLMRTIRHV
UBIG_BORPE            R--------------------GMEYNPITQVYSL-S---------ANTSVNYLMSTRK--
UBIG_METCA            E--------------------GIGYNPITGQFHL-T---------SDIGVNYLAAFRKPA
UBIG_NITOC            T--------------------GLHYNPLTQRYRL-G---------KDINVNYLAYGAKKE
UBIG_ALKEH            K--------------------GLTYNPLNQRYKL-T---------DDTSVNYLAHYQHSP
UBIG_IDILO            N--------------------GLIFNPLKGFVLS-E---------KDVDVNYIIALKKPE
UBIG_NEIMB            K--------------------GMTYHVLSQTYAL-C---------DSTDVNYMFACRPAF
UBIG_PSYA2            I--------------------GLHYNPLTKRYWL-A---------QNVDVNYMMAVQKPR
UBIG_HYDCU            A--------------------GIDFNPLLKRYRL-T---------DRLDVNYLLAYQKSA
UBIG_RICPR            K--------------------GLVFNLAKNEWKLS----------NDIDVNYFMCLEKKM
UBIG_PELUB            D--------------------GMNFNILDNSWKVT----------NDTSVNYITKFIKN-
UBIG_RHORT            A--------------------GMTFDPFSGTWSQT----------TDVSVNYMLFATRAA
UBIG_MAGSA            A--------------------GMAFNPLSDTWRET----------DNLDVNYMLFGVKG-
UBIG_RHOPB            A--------------------GLVYNPLADKWSLS----------ADMDVNYMVVAETAA
UBIG_AZOC5            A--------------------GMVFDPLRGEWKIA----------ADTDVNYFLVGKPAF
UBIG_SINFN            T--------------------GVFFNPLANQWNLS----------KDMDVNYMIVAKRPL
UBIG_RHILO            T--------------------GVTYNPLADRWARS----------KDMDVNYMVLAEKGS
UBIG_BARBK            L--------------------GITYNPLNDSWNRS----------KDMDVNYMLLVKRLQ
UBIG_DINSH            K--------------------GMVFNPLSQQWSLSD---------RDLSVNYVTASIRPA
UBIG_PARL1            T--------------------GVSYNPLTDKWSLS----------RDTDVNYMALAERAR
UBIG_CAUSK            F--------------------GVAYNPLTGRWSRS----------ADCDINYMMTVTKD-
UBIG_MARMM            V--------------------GVSYNPLTDQFSLG----------EDTAVNYMMVAEKPA
UBIG_METSB            T--------------------GVVFDPLQGGWRLA----------HDTDINYMMAASKRR
UBIG_METS4            T--------------------GVVYHPLSGRWSAA----------RDTAVNYMITAERPA
Q0DEH4_ORYSJ          A--------------------GFVYNPLRGEWSLS----------DDLTVNYIAYGMKKV
A0A3Q7HDE6_SOLLC      A--------------------GFVYNPLTGRWSLS----------DDISVNFIAFGTKSA
W1PMS0_AMBTC          A--------------------GFVYNPLTGKWALS----------DDVSVNFIALGAKQI
M0TZ52_MUSAM          A--------------------GFFYNPLTGDWSLS----------DDTSVNFIAFATRRN
COQ3_ARATH            A--------------------GFVYNPITGRWLLS----------DDISVNYIAYGTKRK
E9G9E5_DAPPU          Q--------------------GLSFALLRQEWHLS----------TDLSVNYFASAQKPF
E9HTS9_DAPPU          C--------------------GMAYNPFINKWKWS----------GITSVNYAVHATKSS
E9HTS6_DAPPU          R--------------------GYTYNPFLNHWDWI----------KSTDINYALHATKTV
B3S9Y1_TRIAD          G--------------------GIFYNPLTNNAGWL----------DNTKVNYAIVAHKPS
COQ3_RAT              A--------------------GMVYNPFSGYWHWT----------ENTSLNYAAHAVRAR
COQ3_HUMAN            V--------------------GMLYNPFSGYWHWS----------ENTSLNYAAYAVKSR
F7F1Z8_MONDO          I--------------------GMLYNPFSGYWRWT----------ENTSLNYATHAVKSS
F1R9X2_DANRE          R--------------------GMMYNPLTGAWSWQ----------QSTAINYALHAVKRK
W4Z4G0_STRPU          H--------------------GMMYNPATKRWSWM----------EDTSVNYAICAVKRT
H2YX78_CIOSA          E--------------------GMAYNPVLNKWTWC----------KNTDVNYILHAYKID
F7B383_CIOIN          V--------------------GMNYNPLNNKWTKC----------QNTSVNYILHAVKKN
A7S2R8_NEMVE          Q--------------------GLAFNPVTSRWSYC----------EGTDINFALHAIKV-
A0A2H2HUE5_CAEJA      Q--------------------GIMYHPVGNHWTWI----------NSTQCNYAILAVKN-
H3F3N5_PRIPA          L--------------------GMDYNPLLDRWKWT----------ECTQINYAVLARRIL
C3YXC3_BRAFL          H--------------------GMFYNPFLNRWNWT----------GSTEMNYALHAIKEP
Q7Q8W0_ANOGA          H--------------------GMFYQFWSNQWCWT----------KNTEINYALHAVKMK
Q17BU7_AEDAE          H--------------------GMSYEFWRNSWTWC----------KRMDINYALQAVKLV
E1JHN2_DROME          N--------------------GSTYDFWSNTWRWI----------NNNQMCYALQAVKQA
Q16Z38_AEDAE          R--------------------GFFYDRLYNSWNFI----------DNDDCNYGLHAVKE-
Q7Q8W1_ANOGA          R--------------------PFYLKFWESEWVWV----------PFNQLTYALHAVKG-
A0A087ZYC5_APIME      H--------------------GMFYNILKNEWSWM----------ASTAINYAIHAVKKK
E0VD98_PEDHC          H--------------------GMFYNFLCNEWYWV----------QNAAVNYALHAVKKN
H9JPL1_BOMMO          Y--------------------GLFYNPLNNSWHFT----------NSQLLLYALQAIKLK
A0A1X7VJD9_AMPQE      I--------------------GLGYNPLTNVWNYQ----------SDTNMNYFLHAIKQ-
G4VGT4_SCHMA          S--------------------GMLYNPLSRRWCWS----------SNLSLNYAFSAMKID
COQ3_DICDI            K--------------------GLVYNPLTCEWDFT----------NDLNVNYLLHAIKK-
D3AZU6_POLPP          S--------------------GLFMNPLTMNWSLI----------NNTNVNYILFAMKST
A0CP72_PARTE          R--------------------GVEYNLLNGEMKYS----------NNETQYIMACSKQKM
V5BT82_TRYCR          QYI----------VACPNILMSLSTRQMQLAFSLTK---------RFDTGHYFWSGLKVT
Q38DV8_TRYB2          RHI----------VACPDVLKTFASRQLHLSFRLSS---------RLYTGHYIWAGVKRS
A4HN95_LEIBR          HYI----------VTYPDFFQSAVSGDFQVNFCLSN---------SVNTGHYFWAGRKSP
D0NUY8_PHYIT          S--------------------GIVGDPIFRSWRI---------HPTCTDINYILCATKPQ
F4NYX5_BATDJ          S--------------------GIGYNLLTKTWSLLDE-----TRPCGLDMNYIMAARKSI
E3KPS0_PUCGT          E-------------RSDLEVRGCTYDPLASRWKLF-----PRDAFWAEWCNYFFGVKKPL
A8N8V4_COPC7          QKWISPD-ASTYLPRHQAELKGLIYNPLSGNWSLG-----PRNLFAAAQCNYIFWVRKPH
Q5K9S4_CRYNJ          HR--NDD-ASDIRENEVGETRGIIYDPLKGAWRLWDGVEGSWWKEAGEVCNYMYHAKKRS
COQ3_YEAST            -------------QFRLLDLKGTMYLPYQGWVEHD-CSDVG---------NYFMAIQRLN
Q75A09_ASHGO          -------------AHRILDLKGNMYVPMWGWVEHD-LSSIG---------NYCMAVKKLR
Q5A4P2_CANAL          -----------KSEFRVADTKGCVYLPAYGWKFTS-CPDVG---------NYFMAIQRVK
C4R3R0_KOMPG          --------GDLRKQFEVAGSKGCVYLPCYGWKFTD-NVEVG---------NYFMALKRRD
Q6CEG2_YARLI          ---------------EFVDSKGCMYVPGCGWVWTP-NERMG---------NYMMAFRKKD
A7F1A1_SCLS1          --------------WNSPIVRGVVYVPGLGWKVVPGSEKVG---------NYFFGIRRDE
C7YLQ7_NECH7          --------------WSHPMVQGVVYVPGLGWKEVKGSEKVG---------NYFFAVRKTG
Q7S214_NEUCR          --------------WGQPRAMGVVYVPGLGWKEVPGSEKVG---------NYFLGVQRLA
M2UHG6_COCH5          --------------WGSVKSMGVMYVPGLGWKEVRGSEQWG---------NYFFGVRREA
G2WSG0_VERDV          --------------WASPRIMGVVYVPGVGWREVAGSEKVG---------NYFFAFRREI
D5GMB5_TUBMM          --------------WGDVLVMGCVYVPGFGWREVRGGERVG---------NYFFGVRRGL
Q4WPT3_ASPFU          --GAAARAGSEALQGMKWKCTGVMYFPGLGWKLIPGSESWG---------NYFWAVRKGG
C8VLC5_EMENI          ERNSVARSGSEALDGMRWKCAGVVYFPGLGWKFVPGSESWG---------NYFWAIRRGV
A0A0D8JT44_COCIM      ESGVSTR-GPPRYLDTKWKCVGAVYLPGIGWKLVPGSEEWG---------NYFWGIQKLR
COQ3_SCHPO            ----------------INDIRGVCYNPLKQQWTLDKPGSSGL----GLSCNYFLSAQKPM
Q4UDP6_THEAN          Q--------------------GLLYLPFLRRFFHIN----------SPDLLYMYSFTTSD
                                                                                  

UBIG_HAEPS            -----------------------------------
UBIG_HAEDU            -----------------------------------
UBIG_PASMU            -----------------------------------
UBIG_COXBU            -----------------------------------
UBIG_XYLFA            APHATE-----------------------------
UBIG_SODGM            -----------------------------------
UBIG_ECOLI            -----------------------------------
UBIG_PROMH            NSDL-------------------------------
UBIG_SHEAM            E----------------------------------
UBIG_PHOPR            -----------------------------------
UBIG_SACD2            -----------------------------------
UBIG_MARHV            ED---------------------------------
UBIG_AZOVD            -----------------------------------
UBIG_ACIAD            QS---------------------------------
UBIG_PSET1            -----------------------------------
UBIG_COLP3            -----------------------------------
UBIG_RHOFT            AAIL-------------------------------
UBIG_LEPCP            A----------------------------------
UBIG_RALSO            AP---------------------------------
UBIG_CHRVO            -----------------------------------
UBIG_DECAR            -----------------------------------
UBIG_BORPE            -----------------------------------
UBIG_METCA            AAG--------------------------------
UBIG_NITOC            -----------------------------------
UBIG_ALKEH            ARAGS------------------------------
UBIG_IDILO            S----------------------------------
UBIG_NEIMB            -----------------------------------
UBIG_PSYA2            A----------------------------------
UBIG_HYDCU            V----------------------------------
UBIG_RICPR            NSLSSTCNGIPQLKRVI------------------
UBIG_PELUB            -----------------------------------
UBIG_RHORT            A----------------------------------
UBIG_MAGSA            -----------------------------------
UBIG_RHOPB            G----------------------------------
UBIG_AZOC5            HTSEG------------------------------
UBIG_SINFN            -----------------------------------
UBIG_RHILO            V----------------------------------
UBIG_BARBK            -----------------------------------
UBIG_DINSH            -----------------------------------
UBIG_PARL1            D----------------------------------
UBIG_CAUSK            -----------------------------------
UBIG_MARMM            G----------------------------------
UBIG_METSB            -----------------------------------
UBIG_METS4            A----------------------------------
Q0DEH4_ORYSJ          ETPSESN----------------------------
A0A3Q7HDE6_SOLLC      KKDETLD----------------------------
W1PMS0_AMBTC          HRKAL------------------------------
M0TZ52_MUSAM          E----------------------------------
COQ3_ARATH            DLGDI------------------------------
E9G9E5_DAPPU          EA---------------------------------
E9HTS9_DAPPU          QVVTDDFIQNLN-----------------------
E9HTS6_DAPPU          -----------------------------------
B3S9Y1_TRIAD          ENYEKSNA---------------------------
COQ3_RAT              AQEHLEPAESA------------------------
COQ3_HUMAN            VQEHPASAEFVLKGETEELQANACTNPAVHEKLKK
F7F1Z8_MONDO          VQAENEEHHAKAPGVHGMGASQK------------
F1R9X2_DANRE          EEPQPDRV---------------------------
W4Z4G0_STRPU          LTDEDQAAL--------------------------
H2YX78_CIOSA          DTSANNTEC--------------------------
F7B383_CIOIN          DINADTQ----------------------------
A7S2R8_NEMVE          -----------------------------------
A0A2H2HUE5_CAEJA      -----------------------------------
H3F3N5_PRIPA          -----------------------------------
C3YXC3_BRAFL          EL---------------------------------
Q7Q8W0_ANOGA          EQ---------------------------------
Q17BU7_AEDAE          DN---------------------------------
E1JHN2_DROME          QREYN------------------------------
Q16Z38_AEDAE          -----------------------------------
Q7Q8W1_ANOGA          -----------------------------------
A0A087ZYC5_APIME      EQK--------------------------------
E0VD98_PEDHC          -----------------------------------
H9JPL1_BOMMO          SL---------------------------------
A0A1X7VJD9_AMPQE      -----------------------------------
G4VGT4_SCHMA          E----------------------------------
COQ3_DICDI            -----------------------------------
D3AZU6_POLPP          TSTTNNS----------------------------
A0CP72_PARTE          E----------------------------------
V5BT82_TRYCR          APA--------------------------------
Q38DV8_TRYB2          TAASAASNIGSNMKSEKDAK---------------
A4HN95_LEIBR          QTEEKRATMPPGG----------------------
D0NUY8_PHYIT          EK---------------------------------
F4NYX5_BATDJ          L----------------------------------
E3KPS0_PUCGT          -----------------------------------
A8N8V4_COPC7          ETAS-------------------------------
Q5K9S4_CRYNJ          -----------------------------------
COQ3_YEAST            -----------------------------------
Q75A09_ASHGO          -----------------------------------
Q5A4P2_CANAL          -----------------------------------
C4R3R0_KOMPG          -----------------------------------
Q6CEG2_YARLI          -----------------------------------
A7F1A1_SCLS1          VRRV-------------------------------
C7YLQ7_NECH7          EL---------------------------------
Q7S214_NEUCR          SEDA-------------------------------
M2UHG6_COCH5          -----------------------------------
G2WSG0_VERDV          AAWEAMHVTRGEL----------------------
D5GMB5_TUBMM          GEGVGGR----------------------------
Q4WPT3_ASPFU          Y----------------------------------
C8VLC5_EMENI          -----------------------------------
A0A0D8JT44_COCIM      -----------------------------------
COQ3_SCHPO            SA---------------------------------
Q4UDP6_THEAN          TG---------------------------------