CLUSTAL format seed alignment for MF_00473

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G6PI_BORBU       ----MLNYKNLNELENFKILEGI-----APEVLKTALTG----KRIKEYDITIEGDSVHY
G6PI_TREPA       -----MNWRNLDECAAYARLQAI-----RAPSLKTVLCGPEGIERVRRY-CTDAGAGLRY
G6PI_CHLMU       ------MGKSFLDCESLIALQEI-----ATNPVDLTLPGTLSQDRIQQY--ALSAEGFTY
G6PI_CHLTR       -----MMGKGFLDCESLVALQEM-----ALHPIDLTASGCLSEERIQKN--SLSAEGFTY
G6PI_CHLPN       -----MERKRFIDCDSTKILQEL-----ALNPLDLTAPGVLSAERIKKF--SLLGGGFTF
G6PI_XANAC       ----------MTQTNGFDALHAH---AQRLRGAAIPALLAAEPERPTQY-ARQVGP-LYF
G6PI_XYLFA       ------------MHNGFDALQLH---ANRLRGVTIPDLLAAELKRPEQY-ARQVGP-LYF
G6PI_ZYMMO       -------MARIANKAAIDAAWKQ---VSACSEKTLKQLFEEDSNRLSGL-VVETAK-LRF
G6PI_ACIAD       MNKNIEQFPRKTTLTPQQKLEQL---MEQHKTVHLTELFDKEQDRFAKY-CVGCED-LVF
G6PI_ACILW       -MNYKQPLIVKSQQQALSALRNL---KMQTQDTHLNQFFSDDSGRFERF-SVEQEQ-LVL
G6PI2_NEIMA      ---------MNAFTRAWYALERH---YQDTRHVLLRDRFACEPDRFERM-HERLDG-MLF
G6PI2_NEIMB      ---------MNAFTRAWYALERH---YQDTRHVLLRDRFACEPDRFERM-HERLDG-MLF
G6PI_PSEAE       -MKHHLTPLDATQLDSWRALAAH---RQELQDFRMRQAFIDDPERFKRF-SFSACG-LFL
G6PI_HAEIN       -----MKNINPTHTHAWKSLEAH---KAELSNITIQDLFKQEKNRFDDY-SLTFNNQILI
G6PI_PASMU       -----MKNINPTTTNAWKALQQH---HKTQSAVTIQQLFAQEKDRFTDY-SLSFNNEVLV
G6PI_ECOLI       -----MKNINPTQTAAWQALQKH---FDEMKDVTIADLFAKDGDRFSKF-SATFDDQMLV
G6PI_VIBCH       ----MLKNINPTQTQAWKALTAH---FESAQDMDLKALFAQDSERFAKY-SARFGQDILV
G6PI_BUCAI       -----MKNINFNNTQSYQDLKNH---FRKIKNIHLRDLFASDLNRFKKF-SIIFENEMLI
G6PI_HELPY       ---------MLTQLKTYPKLLKH---YEEIKEVHMRDWFFKDKERASRY-FLQFES-LSL
G6PI_HELPJ       ---------MLTQLKTYPKLLKH---YEEIKEVHMRDWFSKDKERASRY-FVQLES-LSL
G6PI1_NEIMA      -------MKHLHDLPAWSKLWNH---FDDSKTLHMREMFEQDPQRAERY-WLQVGG-LTL
G6PI1_NEIMB      -------MKHLHDLPAWSKLWNH---FDDSKTLHMREMFEQDPQRAERY-WLQVGG-LTL
G6PI_CAUVC       ---------MADLDAAWTRLEA--A-AKAAGDKRIVEFFDAEPGRLDAL-TLDVAG-LHL
G6PI_RHILO       ----------MDKSAFQKQLAALRD-HRSAAPASMRQAFAADPQRFQAF-TATDGD-LLL
G6PI1_STRCO      ----MSDTPKLNQRPEWTALADH--AKGTLPHPDLRELFAQDPGRAERY-VVRVGD-LRI
G6PI2_STRCO      --MNADGRTRLHQTPEWAALVKH---REQLGEVRLREMFAADPGRGTGW-TLRVGD-LHV
G6PI_DEIRA       -------MSRLTDLPAWQALEDH---YYELQGTHLRELFAADPERGEKM-NAEGAG-LYL
G6PI_MYCLE       -MTSMQAIPDITATPAWDALRRH---HDEIGATHLRQFFADNPNRGREL-VITVGD-LYI
G6PI_MYCTU       --MTSAPIPDITATPAWDALRRH---HDQIGNTHLRQFFADDPGRGREL-TVSVGD-LYI
G6PI_LEGPN       --MIRNSMKSHTELLSWNLLQKE----ADRVRLNSDSLTCVVPDSNNYE-SSKQINCIEY
G6PIA_GEOSE      ------------------------------------------------------MTHIRF
G6PI_BACSU       ------------------------------------------------------MTHVRF
G6PI_BACHD       -----------------------------------------------------MSGKVCF
G6PIB_GEOSE      -------------------------------------------------------MAISF
G6PI_CLOAB       -----------------------------------------------------MSECFKL
G6PI_STRPN       ------------------------------------------------------MSHIKF
G6PI_STRP1       ------------------------------------------------------MSHITF
G6PI_STRMU       ------------------------------------------------------MTHIKF
G6PI_LACLA       ------------------------------------------------------MAHIKF
G6PI_MYCPU       ------------------------------------------------------MRRIRL
G6PI_MYCGE       -----------------------------------------------------MSDKLLT
G6PI_MYCPN       -----------------------------------------------------MESKWLT
G6PI_MYCGA       ---------------------------------------------------------MIK
G6PI_THEMA       -----------------------------------------------MSLKFDFSNLFEP
G6PI_HALSA       -----------------------------------------------------MRIDIGA
G6PI_CAMJE       ----------------------------------------------------MLNNTLFF
G6PI_METJA       ----------------------------------------------------MLSYDYEN
G6PI_SYNY3       -------------------------------MNNQQLWQRYQDWLYYHGGLDFYLDVSRM
                                                                             

G6PI_BORBU       NYASKQINETHLKIFQNLSDEANLIEKYKEVLDG---EKIN-----ISENRKVLHHLTRG
G6PI_TREPA       HYAAKTVNEEILTALAALADEQELVAKYDALRAG---AQIN-----TGEKRKVLHHLTRL
G6PI_CHLMU       SYATERVDDRSLNALRMLAEERELIKQMESMQQG---AVMNYIEGFQSESRSVLHTATRA
G6PI_CHLTR       SYATERVDDRCLEALQGLTEERELIKQMECMQQG---AIMNRIEGFQSESRPVLHTATRA
G6PI_CHLPN       SFATERLDDAILAALISLAEERGLHESMLAMQQG---QVVNYIEGFPSEMRPALHTATRA
G6PI_XANAC       NFARQKYDRAALDALFAIARERDLSGAFQRLFRG---EQVN-----VTEQRAALHTALRG
G6PI_XYLFA       NFARQKYDCVALEALFALARNHNVAGAFQRMFCG---EQVN-----VTEGRAVLHTALRG
G6PI_ZYMMO       DFSKNHLDSQKLTAFKKLLEACDFDARRKALFAG---EKIN-----ITEDRAVEHMAERG
G6PI_ACIAD       DFSKQRINQPILDALVQLAESKQLNKWIDTLFSQ---NKIN-----YTEQREAMHWALRL
G6PI_ACILW       DFSKHRIDQNVLNGLVDLAHAQDLTQWIQRLFSL---EEIN-----YTEQRAAMHWALRV
G6PI2_NEIMA      DYSKNRLGEDTLQLLCRLAETADLEGKMRALRTG---AKVN-----NSEGRAALHTALRL
G6PI2_NEIMB      DYSKNRLGEDTLQLLCNLADAADLEGKMRALRTG---AKVN-----GSEGRAALHTALRL
G6PI_PSEAE       DFSKNLIRQDTIDLLVKLAEEARLSDAIRAMFDG---EAIN-----ASERRPVLHTALRR
G6PI_HAEIN       DFSKNNINQTTLSHLRQLAQECALDSAKEAMFTG---EKIN-----RTENRAVLHTALRN
G6PI_PASMU       DFSKNNVTKETLGLLRQLAQECALSEAVDAMFSG---AKIN-----KTEDRAVLHTALRN
G6PI_ECOLI       DYSKNRITEETLAKLQDLAKECDLAGAIKSMFSG---EKIN-----RTENRAVLHVALRN
G6PI_VIBCH       DYSKNLVNAETMQHLFALAKETDLQSAITAMFKG---EAIN-----QTEDRAVLHTALRN
G6PI_BUCAI       DFSKNRITDETLIYLLNLAKETDVKSGIKLMFSG---AKIN-----KTENRSVLHIALRN
G6PI_HELPY       DYSKNRLNDTTLKLLFELANDCSLKEKIEAMFKG---EKIN-----TTEKRAVLHTALRS
G6PI_HELPJ       DYSKNRLNDTTLKLLFELAKDCSLKEKIEAMFKG---EKIN-----TTEKRAVLHTALRS
G6PI1_NEIMA      DYSKNRINDETMSLLFELAHEAGVPERMRQMFHG---KKIN-----TTENRAVLHVALRN
G6PI1_NEIMB      DYSKNRINDETMSLLFELAREAGVPERMRQMFHG---EKIN-----TTENRAVLHVALRN
G6PI_CAUVC       DLSKQAWDEAGLEAALDLAHAADVEGARARMFDG---EAIN-----SSEGRAVLHTALRA
G6PI_RHILO       DWSKCAVDATTMDLLEKLAAAADLEGRRAAMFAG---KKIN-----ITEDRAVLHTALRN
G6PI1_STRCO      DYSKHLVTDETLALLQELAAATGVSGLRDAMFRG---ERIN-----ITEDRAVLHTALRA
G6PI2_STRCO      DYSKHLVTDETLALLQELAAATGVSGLRDAMFRG---ERIN-----ITEDRAVLHTALRA
G6PI_DEIRA       DYSKHRVTDETLRLLRELAQATGVEARRDAMFRG---EKIN-----VTEGRAVLHTALRA
G6PI_MYCLE       DYSKHRITHDTVQLLVDLARAANLEQRRDQMLAG---VHVN-----TSENRSVLHTALRL
G6PI_MYCTU       DYSKHRVTRETLALLIDLARTAHLEERRDQMFAG---VHIN-----TSEDRAVLHTALRL
G6PI_LEGPN       DYSRQRVNRTIIDLLIDLANEVKLQEKIDNLING---KKIN-----ISENRPALHTALRD
G6PIA_GEOSE      DYSK-ALSFFGEHELTYLRDAVKVAHHSLHEKTGVGND-------------------FLG
G6PI_BACSU       DYSK-ALTFFNEHELTYLRDFVKTAHHNIHEKTGAGSD-------------------FLG
G6PI_BACHD       DYSK-ALDFIQEHELDNLQDQVHAAHRALHDGTGAGND-------------------FLG
G6PIB_GEOSE      DYSN-ALPFMQENELDYLSEFVKAAHHMLHERKGPGSD-------------------FLG
G6PI_CLOAB       ELKN-TKPYLQDEELKNLKPAVAAAHEAIHNGTGAGND-------------------FLG
G6PI_STRPN       DYSKVLDKFVAPHEVEYMQSQVTAADELIRKGTGAGSD-------------------FLG
G6PI_STRP1       DYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSD-------------------FLG
G6PI_STRMU       DYSKVLGKFLASHELDYIQMQVTAADEALRKGTGPGAE-------------------MTG
G6PI_LACLA       DYSK-LTPFVAENELDEIQWQIDGAAKLLHEGKGAGSD-------------------YIG
G6PI_MYCPU       NLQN----AINEEKLKEYVSEVEQINTKMNNLSLEGFE-------------------YLG
G6PI_MYCGE       IDLSHVYGFDKEIIFKKYQKKVDQIHQDFLAHKLADGH-------------------MTG
G6PI_MYCPN       VDTKHLYGFDEAIFIQKYQKKVNQIHQQFLNQQLPDGH-------------------MNG
G6PI_MYCGA       LTFNLIKGLDYKKLDKNYQAKLDEIFSQLKNKKTPSAN-------------------MLG
G6PI_THEMA       NISGGLTDEDVKSVEEKVTSAVRNFVENTPDFAK--------------------------
G6PI_HALSA       ALDATATPGVPPDALDRLDDRVAHAHDRITAGMD---------------------GDEFG
G6PI_CAMJE       KQSEIHTISSYANRINDEVKSGDIGYYHLI------------------------------
G6PI_METJA       ALKVGEISLEDINKVDFANAYSNLMEKLDNGVVG--------------------------
G6PI_SYNY3       GFSDALVEDLQPKFAKAFQDMVALEKGAIANPDE---------------QRMVGHYWLRN
                                                                             

G6PI_BORBU       QIGK---DVIED---NKENMREFFQSELEKIYNFAKQIHSGNIKSSNGKKFKNVVQIGIG
G6PI_TREPA       GVQG---SSLASLPCEVRDMHAFYTKEYERVCAFARQVHEGGLRTSRGAPFTDVVQIGIG
G6PI_CHLMU       WVRD---HDLKD---EAASIANHSEREAHRLAEFLYAARS---------KFSTLVQIGIG
G6PI_CHLTR       WVRD---QDLHE---EAAAIARHSKEEALRLAEFLYIARA---------KFSTLVQMGIG
G6PI_CHLPN       WVTD---SSFTG---EAEDIAVRSRVEAQRLKDFLTKVRS---------QFTTIVQIGIG
G6PI_XANAC       DLTD---APVAS---EAYATAEEVRQRMGSLIQQLEAT-----------DVTDIVSVGIG
G6PI_XYLFA       DLSG---TSVAV---AAYTAAAKVRERMYALIAGLDAS-----------EVTDIISVGIG
G6PI_ZYMMO       QGAP---ASVA--------RAKEYHARMRTLIEAIDAGAFG--------EVKHLLHIGIG
G6PI_ACIAD       PADN---Q-VYP---ELA---KQVSDQLERMYQLVNKIHEGQYRGATGEVIQDVVNIGVG
G6PI_ACILW       PEQN---QQVLP---EIT---AQVHTQLERMYSLVEKIHAGQYRGATGEVIQDVVNIGVG
G6PI2_NEIMA      PDGA---GAVYA---DGRDVLPEIRRELNRALKFAHSLDDGSYQGTTGKRITDFVHIGIG
G6PI2_NEIMB      PDGA---DAVYV---DGRDVLPEIRRELNRALKFAHSLDDGSYQGITGKRITDFVHIGIG
G6PI_PSEAE       PIG----DKVLV---DGVDVMPEVHRVLHQMTELVGYVHNGLWRGYTEKPITDVVNIGIG
G6PI_HAEIN       RTN----TPVLV---DGKDVMPEVNAVLAKMKDFCQRIISGEWKGYTGKAITDVVNIGIG
G6PI_PASMU       RSN----SPVLV---DGKDVMPEVNAVLAKMKDFCHRVISGEWKGYTGKAITDVVNIGIG
G6PI_ECOLI       RSN----TPILV---DGKDVMPEVNAVLEKMKTFSEAIISGEWKGYTGKAITDVVNIGIG
G6PI_VIBCH       RSN----SPVLV---NGEDVMPAVNAVLAKMKAFSERVIGGEWKGFTGKAITDVVNIGIG
G6PI_BUCAI       RTN----RPIIL---NNCNIMLEVNALLEKMKNFSKMVIHGEWKGYTGKSISNVVNIGIG
G6PI_HELPY       LND----TEILL---DNMEVLKSIRSVLKRMRAFSDSVRSGKRLGYTNQVITDIVNIGIG
G6PI_HELPJ       LND----AEILL---DNMEVLKSVRSVLKRMRAFSDSVRSGKRLGYTNQVITDIVNIGIG
G6PI1_NEIMA      RTN----SPIVV---DGEDVMPKVNRVLQRMGEFAHEVRSGSWLGYTNQVITDVVNIGIG
G6PI1_NEIMB      RTN----SPIVV---DGEDVMPKVNRVLQRMGEFAHEVRSGSWLGYTNQVITDVVNIGIG
G6PI_CAUVC       PAG----ADVKA---LGQPVMAEVDAVRQRMKAFAQAVRSGAIKGATGKPFKAILHIGIG
G6PI_RHILO       LSG----TGVTV---DGQDVKADVLSVLDAMGAFADAIRSGKALGATGKKITDIVNIGIG
G6PI1_STRCO      PRD----AVIEV---DGENVVPQVHAVLDKMAGFADRVRSGEWTGHTGRRIRNVVNIGIG
G6PI2_STRCO      PRD----AVIEV---DGENVVPQVHAVLDKMAGFADRVRTGEWTGHTGRRIRNVVNIGIG
G6PI_DEIRA       PRD----AVIEV---DGKNVVPEVHEVLDRMATFADAVRSGEWLGYTGKPIKNIVNIGIG
G6PI_MYCLE       PRD----TELIV---DGQNVVQDVHAVLDVMGDFTDRLRSGEWTGATGKRINTVVNIGIG
G6PI_MYCTU       PRD----AELVV---DGQDVVTDVHAVLDAMGAFTDRLRSGEWTGATGKRISTVVNIGIG
G6PI_LEGPN       LGN----KSIMI---DGLDIMSAVINTREKIKVISNQIREKKWLGHSGLPITDIVNIGIG
G6PIA_GEOSE      WLDLPVNYD---------------KEEFARIQKAAAKIQAD---------SDVLLVIGIG
G6PI_BACSU       WVDLPEHYD---------------KEEFARIKKSAEKIKSD---------SDVLLVVGIG
G6PI_BACHD       WIDLPVNYD---------------REEFSRIQKAAEKIRND---------SDVLLVIGIG
G6PIB_GEOSE      WVDWPIRYD---------------KNEFSRIKQAAERIRNH---------SDALVVIGIG
G6PI_CLOAB       WVDLPVNYD---------------KDEFERIKKSAEKIRNS---------VDAFIVIGIG
G6PI_STRPN       WLDLPEKYD---------------REEFDRILKAAEQIKSD---------SDVLVVIGIG
G6PI_STRP1       WLDLPENYD---------------KDEFARILTAAEKIKAD---------SEVLVVIGIG
G6PI_STRMU       WLNLPQNYD---------------KEEFARIKKAAEKIKSD---------SEVLVVIGIG
G6PI_LACLA       WLDLPEDYD---------------KEEFARIQKAAKKIQSD---------SEVLIVIGIG
G6PI_MYCPU       WKDLPENIN---------------KNEIDKIIETANFFKKEG--------IEVLVVIGIG
G6PI_MYCGE       WYDQPDQNH---------------QFLLKTINQIDKKFKSLK--------VTDIVYVGIG
G6PI_MYCPN       WYSQPDQDH---------------KGLLKQINTIAKQFNALK--------VTDIVYLGIG
G6PI_MYCGA       WIDYVDQDH---------------TKIYKSIDNKITEWDKLK--------VTDVVVIGIG
G6PI_THEMA       ----------------------LDRSWIDSVKSLEDWIIN----------FDTVVVLGIG
G6PI_HALSA       YAAL----------------NLPRTVDVDAITAAADAVADA----------DTLVTVGIG
G6PI_CAMJE       ------------------------DTSLNLIDESLQFIQDKE-------YVKNIVLVGMG
G6PI_METJA       -----------------------FRDVIYDENLDKYKSLNG---------YENVVVIGMG
G6PI_SYNY3       PALAP-----------NDGIRAEITEPLRQIKAFVADVHQGNIKPPTAPKFTDLLAIGIG
                                                                      .: :*:*

G6PI_BORBU       GSSLGPKALYSSIKNYAKK-----HNLALMNGYFISNIDPDESEEVLSSINV----DETL
G6PI_TREPA       GSDLGPRALYLALEGWAQR-----HQAVKMRTHFISNVDPDDAALVLSKLPL----ETTL
G6PI_CHLMU       GSELGPKAMYFAMQGICPS-----DK----RIFFVSNIDPDNAAEVLKEVDL----KQTL
G6PI_CHLTR       GSELGPKAMYFAMQGSCPS-----DK----RIFFVSNIDPDNAAEVLREIDL----EQTL
G6PI_CHLPN       GSELGPKALYRALRAYCPT-----DK----HVHFISNIDPDNGAEVLDTIDC----AKAL
G6PI_XANAC       GSDLGPRLVADALRAPSG--------A-RFRVHFVSNVDGAAMQRTLATLDP----ARTA
G6PI_XYLFA       GSDLGPRLVVDALRPISQ--------G-RFRVHFVSNVDGAAMRRTLDMLDP----SRTA
G6PI_ZYMMO       GSALGPKLLIDALTRES---------G-RYDVAVVSNVDGQALEEVFKKFNP----HKTL
G6PI_ACIAD       GSDLGPLMVSHALSDFKVK-----TAK-PLNIRFVSTMDGSQLSDILHQLRP----ETTL
G6PI_ACILW       GSDLGPLMVTHALSDFKVV-----TAK-PLDVHFVSTMDGSQLSDLLHQLRP----ETTL
G6PI2_NEIMA      GSDLGPAMCVQALEPF---------RR-HIAVHFAANADPACLDEVLCRLNP----ETTV
G6PI2_NEIMB      GSDLGPAMCVQALEPF---------RR-HITVHFAANADPACLDAVLCRLNP----ETTV
G6PI_PSEAE       GSFLGPQLVSEALLPFA--------QK-GVRCHYLANIDGSEFHELASRLNA----ETTL
G6PI_HAEIN       GSDLGPYMVTEALRPYK--------N--HLNMHFVSNVDGTHIAETLKKVNP----ETTL
G6PI_PASMU       GSDLGPYMVTEALRPYK--------N--HLNLHFVSNVDGTHIAETLKKVNP----ETTL
G6PI_ECOLI       GSDLGPYMVTEALRPYK--------N--HLNMHFVSNVDGTHIAEVLKKVNP----ETTL
G6PI_VIBCH       GSDLGPYMVTEALVPYK--------N--HLTMHFVSNVDGTHMAETLKNVDP----ETTL
G6PI_BUCAI       GSDLGPYMVTEALRPYK--------N--HLNMYYVSNIDGTHLTEVLKKINP----ENTI
G6PI_HELPY       GSDLGALMVCTALKRYA--------HP-RLKMHFVSNVDGTQILDVLEKLNP----ASTL
G6PI_HELPJ       GSDLGALMVCTALKRYG--------HP-RLKMHFVSNVDGTQILDVLEKINP----ASTL
G6PI1_NEIMA      GSDLGPLMMCTALKPFG--------HP-RLNMHFVSNVDGSQLRDVLSKVHP----ETTL
G6PI1_NEIMB      GSDLGPLMMCTALKPFG--------HP-RLNMHFVSNVDGSQLRDVLSKVHP----ETTL
G6PI_CAUVC       GSDLGPRLLWDALRPVK--------P--SIDLRFVANVDGAEFALTTADMDP----EETL
G6PI_RHILO       GSDLGPAMATLALAPYH--------D--GPRAHYVSNIDGAHIHDTLKGLSA----ETTL
G6PI1_STRCO      GSDLGPAMAYEALRAFT--------DR-SLTLRFVSNVDGADLHEAVRDLDP----AETL
G6PI2_STRCO      GSDLGPAMAYEALRAFT--------DR-SLTLRFVSNVDGADLHEAVRDLDP----AETL
G6PI_DEIRA       GSDLGPVMAYEALKHYA--------QR-DLTVRFVSNVDGTDLTEKTRDLDP----EVTL
G6PI_MYCLE       GSDLGPVMVYQALRHYA--------DA-GISARFVSNIDPADLTAKLSDLEP----GTTL
G6PI_MYCTU       GSDLGPVMVYQALRHYA--------DA-GISARFVSNVDPADLIATLADLDP----ATTL
G6PI_LEGPN       GSDLGPRVCINALSNYI--------SK-EFNYHFISDVDPASFNDVIAKINP----QTTL
G6PIA_GEOSE      GSYLGARAAIEMLHHSFYNALPKEKRNTPQIIFVGNNISSTYMKEVMDLLEG----KDFS
G6PI_BACSU       GSYLGARAAIEALNHAFYNTLPKAKRGNPQVIFIGNNISSSYMRDVMDLLED----VDFS
G6PI_BACHD       GSYLGAKATLEALNHSFYNIVDKSERKGPQIFFVGHHISSTYVQELFDVLEG----KDVS
G6PIB_GEOSE      GSYLGARAAIEALSHTFHNQM----NDTTQIYFAGQNISSTYISHLLDVLEG----KDLS
G6PI_CLOAB       GSYLGARAAIEMFSHSFSSSISKEERKNPEIFFCGNNISSTYLADLLEAIEG----KDIA
G6PI_STRPN       GSYLGAKAAIDFLNHHFANLQTKEERKAPQILYAGNSISSTYLADLVEYVAD----KDFS
G6PI_STRP1       GSYLGAKAAIDFLNHHFANLQTAKERKAPQILYAGNSISSTYLADLVEYVQD----KEFS
G6PI_STRMU       GSYLGARAAIDFLNSSFVNLENKEERKAPQILYAGNSISSNYLADLVDYVAD----KDFS
G6PI_LACLA       GSYLGARAAIDFLSNSFVNLQTAEERKAPRILYAGNSISSSYLADLVDYVAD----KDFS
G6PI_MYCPU       GSFLGAKSAMDFIQGNY------PTKKNMEIIFAGTSISSTELTQLLYYVEN----KKFA
G6PI_MYCGE       GSFTGIKTVLDFLKPK---------QRTGLKIHFVPDLSAFQAASVIKEIKN----KSWA
G6PI_MYCPN       GSYTGIRAILDFLKPE---------QKANIKVHFVPDISAFNIAAVARAIKG----KSWA
G6PI_MYCGA       GSFTGIKAILDVVAYLP--------SEQKRQIHFIRSLSENSFLKILEEVKD----KNWG
G6PI_THEMA       GSGLGNLALHYSLRPLNWNEMTREERNGYARVFVVDNVDPDLMSSVLDRIDP----KTTL
G6PI_HALSA       GSALGAATLVDALGDDD------------LDYHALDNVDPAHVTRLLDRIDL----STSA
G6PI_CAMJE       GSSCGVKALRDMLFNEKSN---------QRELFILDNTSSHSFNKTLEKIKL----EESL
G6PI_METJA       GSILGTMAIYYAISPFN------------NNAYFIDNSDPEKTLSILKKVDL----NESI
G6PI_SYNY3       GSALGPQFVAQALAPNFP----------PLAIHFIDNSDPDGIDRVLNCLKAQDKLKSTL
                 **  *       .                         .          .          

G6PI_BORBU       FIIVSKSGNTLETKANMQFLINKLKLNGIK---EYKKQMVIITLKDSMLAIEEKGYLEYF
G6PI_TREPA       FILVSKSGTTLETLSNELFVAHVLRQAGL----EPHTQFVAVTSETSPLANNPQ-YLASF
G6PI_CHLMU       IVVVSKSGTTLEPSVNEELFKRAYQDKGL----SVADHFVAVTAEGSPMDDKTH-YLEVF
G6PI_CHLTR       VVVVSKSGTTLEPAANEELFRQAYQNKGL----SIAEHFVAVTSQGSPMDDKSR-YLEVF
G6PI_CHLPN       VVVVSKSGTTIETAVNEAFFADYFAKKGL----SFKDHFIAVTCEGSPMDDTGK-YLEVF
G6PI_XANAC       GILISKTFGTQETLLNGSILHAWLG----GSE----RLYAVSANPERAAKAFDIAPGRVL
G6PI_XYLFA       GILISKTFGTQETLLNGRILYDWLG----GSE----RLYAVSANPERAAHAFDIVPTQVL
G6PI_ZYMMO       IAVASKTFTTAETMLNAESAMEWMKK--HGVEDPQGRMIALTANPAKASE-MGIDDTRIL
G6PI_ACIAD       FIVSSKSFSTIDTLSNAHTARKWLEKALGRESSILKSHFIGVSTKPDKMTEWGIHPDNQF
G6PI_ACILW       FIISSKSFGTIDTLSNAQTVRQWLEKALGKNSHVLKHHFIGVSTKPDKMSEWGIAPENQL
G6PI2_NEIMA      FCVASKSFKTPETLLNAEAVKAWYRGAGF-SESETGCHFCAVSADTEAAQSFGIAAERVF
G6PI2_NEIMB      FCVASKSFKTPETLLNAQAVKAWYRGAGF-SESETACHFCAVSADTAAAAAFGIAAERVF
G6PI_PSEAE       FIVSSKSFGTLETLKNAQAARAWYLAQGG-TEEELYRHFIAVSSNKEAAIAFGIREENIF
G6PI_HAEIN       FLVASKTFTTQETMTNAQSARDWLLKAAK-DESAVAKHFAALSTNAKDVEKFGIDTNNMF
G6PI_PASMU       FLVASKTFTTQETMTNAHSARNWFLATAK-DESHVAKHFAALSTNSKAVAEFGIDTNNMF
G6PI_ECOLI       FLVASKTFTTQETMTNAHSARDWFLKAAG-DEKHVAKHFAALSTNAKAVGEFGIDTANMF
G6PI_VIBCH       FLVASKTFTTQETMTNAHTARDWFLKAAG-DEAHVAKHFAALSTNGKAVAEFGIDTDNMF
G6PI_BUCAI       FLIASKTFTTDETITNAHSAKKWFLHYSQ-DQSALDKHFFALSANIKNALNFGININNIF
G6PI_HELPY       FIVASKTFSTQETLTNALTARKWFVERSG-DEKHIAKHFVAVSTNKEAVQQFGIDEHNMF
G6PI_HELPJ       FIVASKTFSTQETLTNALTARKWFVERSG-DEKHIAKHFVAVSTNKEAVQQFGIDEHNMF
G6PI1_NEIMA      FIIASKTFTTQETLTNALTAREWFLNHAG-DEEAVAKHFAAVSTNQKAVAEFGIDTANMF
G6PI1_NEIMB      FIIASKTFTTQETLTNALTAREWFLNHAG-DEEAVAKHFAAVSTNQKAVAEFGIDTANMF
G6PI_CAUVC       VMVVSKTFTTQETMANAGAARAWLVAALG--EQGANQHLAAISTALDKTAAFGVPDDRVF
G6PI_RHILO       FIVASKTFTTVETMTNAQTARDWVQKALG--KQAVGKHFAAVSTALDLVAKFGIEADRVF
G6PI1_STRCO      FIIASKTFTTIETITNATSARSWLLDGLGGDEKAVAKHFVALSTNAEKVADFGIDTANMF
G6PI2_STRCO      FIIASKTFTTIETITNATSARSWLLAGLGGDEKAVAKHFVALSTNAEKVADFGIDTANMF
G6PI_DEIRA       FIVSSKTFTTQETMTNARSARKWLLGSLK-DDAAVTRHFVAVSTNAEEVQKFGIDTANMF
G6PI_MYCLE       FIVASKTFSTLETLTNATAARRWLTDALG--EAAVSKHFVAVSTNKRLVKDFGINTANMF
G6PI_MYCTU       FIVASKTFSTLETLTNATAARRWLTDALG--DAAVSRHFVAVSTNKRLVDDFGINTDNMF
G6PI_LEGPN       FIVSSKSFTTKETLLNARKAFALYEDTAS-----IDQHFIAVTAHPERAYQMGIKT--VL
G6PIA_GEOSE      INVISKSGTTTEPAIAFRIFRKLLEEKYGKEEARKRIYATTDRARGALKTLATAEGYETF
G6PI_BACSU       INVISKSGTTTEPAIAFRIFRKLLEEKYGKEEAKARIYATTDKERGALKTLSNEEGFESF
G6PI_BACHD       INVISKSGTTTEPAIAFRIFRDYLEKKYGKEESRKRIYATTDRERGALKTLANEEGYESF
G6PIB_GEOSE      INVISKSGTTTEPAIAFRIFRDYMEKKYGKEEARKRIYVTTDRTKGALKKLADQEGYETF
G6PI_CLOAB       VNVISKSGTTTEPAIAFRIFKELLEKKYGKEEAKNRIFATTDAKKGALKTLSDNEGYETF
G6PI_STRPN       VNVISKSGTTTEPAIAFRVFKELLVKKYGQEEANKRIYATTDRQKGAVKVEADANGWGTF
G6PI_STRP1       VNVISKSGTTTEPAIAFRVFKELLVKKYGQEEANKRIYATTDKVKGAVKVEADANNWETF
G6PI_STRMU       VNVISKSGTTTEPAIAFRVFKDLLVKKYGQEEANQRIYATTDRVKGAVKVEADANGWETF
G6PI_LACLA       VNVISKSGTTTEPAIAFRVFEEMLVKKYGREEANKRIYATTDKEKGAVKVNADANNWETF
G6PI_MYCPU       INVISKSGTTLEPAIAFREFRNLLNSRLGENNAKRYIVATTDANKGLLFEMAKEKGYARF
G6PI_MYCGE       LITTSKSGRTLEPALNFRIFRNLLNKRYG-NKHYQRVVVITDEKKGLLTKMASNHGYQKL
G6PI_MYCPN       LVVTSKSGRTLEPAVTFRYFRNLLHKQYK-QKHALRTVVITDAVKGLLVGMSNQYGYAHL
G6PI_MYCGA       IVVISKSGTTLEPSVGFKLFREALYKQYG-EQAQKRIVAITDPKKGVLHDIAVKNKYEML
G6PI_THEMA       FNVISKSGSTAEVMATYSIARGILEAYGL--DPREHMLITTDPEKGFLRKLVKEEGFRSL
G6PI_HALSA       VHVVSRSGTTAETLANFLVVRDAMDDAGV---DWTARTLVTTGDDGPLRALADTHDLPVL
G6PI_CAMJE       FLIISKTGSTIEVVSLFKLLIEHFKLDMQ---ELKKYFVFITDKDSKLHQEGENLGIKCF
G6PI_METJA       IYIISKSGNTLETLVNYYLIKKRIEKLNS-----FKGKLVFITNGGKLKREAEKNNYDIF
G6PI_SYNY3       VVTTSKSGGTPEPRNGLAETKAVFEAQGL--HFADYAVAVTMPGSKLSQQAQTEQWLQAF
                     *::  * :                                               :

G6PI_BORBU       FMHDSIGGRFSPTSAVGLTLLTLCFTEKVAKEILKGANEADKKS-LNKNVKDNASLLAAL
G6PI_TREPA       YMDDFIGGRYSSSSVCGAVVLTLAFGPQVFGHFLSGAAEADRAA-QEQDIRRNAALLDAL
G6PI_CHLMU       HLWDSVGGRFSATSMVGGVVLGFAFGYEVFFEFLQGAASMDAHA-LTPIMEKNLPLLSAM
G6PI_CHLTR       HLWDSIGGRFSATSMVGGVVLGFAFGYEAFIEFLQGAAAIDAHA-LTPKMRENLPLLSAM
G6PI_CHLPN       HLWESIGGRFSSTSMVGGVVLGFAYGFEVFLQLLQGASAMDQIA-LQPNARENLPMLSAL
G6PI_XANAC       PMWDWVGGRYSLWSAVG-FPIALAIGFERFEQLLEGAAQFDAHV-LNTPLEENVAVLHGL
G6PI_XYLFA       PIWDWVGGRYSLWSAVG-FPIALAIGSQRFEELLAGAAEFDAYA-LRVPLEENVAVLHGL
G6PI_ZYMMO       PFAESIGGRYSLWSSIG-FPAALALGWEGFQQLLEGGAAMDRHF-LEAAPEKNAPILAAF
G6PI_ACIAD       LLWDWVGGRYSLWSCIG-LPIALTIGVEGFKAFLAGAHGIDEHF-RTTEFHQNIPVLMGL
G6PI_ACILW       LLWDWVGGRYSLWSCIG-LPIALTVGVDGFKQLLSGAYAIDQHF-QTAPFAQNIPVLIGL
G6PI2_NEIMA      AMYDWVGGRYSVWSPVG-LPVMVAVGGARFRELLAGAHAMDSHF-FHTPPRRNIPVLMAL
G6PI2_NEIMB      AMYDWVGGRYSVWSPVG-LPVMVAVGGARFRELLAGAHAMDRHF-FSTPTRHNIPVLMAL
G6PI_PSEAE       PMWDWVGGRYSLWSAIG-LPIAMSIGISNFKELLSGAYNMDQHF-QTAPFERNIPVLLGL
G6PI_HAEIN       EFWDWVGGRYSLWSAIG-LSIALSIGFENFEALLNGAHEMDKHF-LSTPIEQNIPTTLAL
G6PI_PASMU       EFWDWVGGRYSLWSAIG-LSIALSIGFEHFEALLAGAHEMDKHF-RTAPIEQNIPTTLAL
G6PI_ECOLI       EFWDWVGGRYSLWSAIG-LSIVLSIGFDNFVELLSGAHAMDKHF-STTPAEKNLPVLLAL
G6PI_VIBCH       EFWDWVGGRYSLWSAIG-LSIILSIGYDNFVELLAGAHEMDQHF-VNTPFESNIPVILAL
G6PI_BUCAI       KFWDWVGGRFSLWSSAG-LSIMLSIGFDNFEKFLDGAHAMDNHF-YHTNYKENIPILLAL
G6PI_HELPY       EFWDFVGGRYSLWSAIG-LSIMIYLGKKNFNALLKGAYLMDEHF-RNAPFESNLPVLMGL
G6PI_HELPJ       EFWDFVGGRYSLWSAIG-LSIMIYLGKKNFNALLKGAYLMDEHF-RNAPFESNLPVLMGL
G6PI1_NEIMA      EFWDWVGGRYSLWSAIG-LPIMLYLGEENFIEMLNGAHLMDQHF-INTPLERNLPVILAL
G6PI1_NEIMB      EFWDWVGGRYSLWSAIG-LPIMLYLGEENFIEMLNGAHLMDQHF-INTPLERNLPVILAL
G6PI_CAUVC       GFWDWVGGRYSLWSSVS-LSVAVAAGWDAFQGFLDGGAAMDEHF-RTAPLEQNAPVLVAL
G6PI_RHILO       GFWDWVGGRYSVWGAIG-LPVMIAVGPRNFRAFLDGAHEMDQHF-RTAPLAGNLPALLGL
G6PI1_STRCO      EFWDWVGGRYSFDSAIG-LSLMIAIGPDRFREMLDGFRIVDEHF-RNAEAPANAPLLLGL
G6PI2_STRCO      EFWDWVGGRYSFDSAIG-LSLMIAIGPDRFREMLDGFHLVDEHF-RTAPAESNVPLLMGL
G6PI_DEIRA       GFWDWVGGRYSMDSAIG-LSLMVAVGPEHFREMLAGFHDMDEHF-RTAPAEQNLPMLMGL
G6PI_MYCLE       GFWEWVGGRYSVDSAIG-LSLMAVVGRESFADFLSGFHIVDQHF-QNAPLESNAPVLLGL
G6PI_MYCTU       GFWDWVGGRYSVDSAIG-LSLMTVIGRDAFADFLAGFHIIDRHF-ATAPLESNAPVLLGL
G6PI_LEGPN       PIWDWVGGRFSFCSAVN-LITAIAIGYEQFVELLAGAHDIDTHV-QFTDFKNNIPVLMAL
G6PIA_GEOSE      IIPDDVGGRYSVLTAVG--LLPIAVSGANIEEMMKGAAQAREDF-SSSELEENAAYQYAA
G6PI_BACSU       VIPDDVGGRYSVLTAVG--LLPIAVSGVNIDDMMKGALDASKDF-ATSELEDNPAYQYAV
G6PI_BACHD       IIPDDVGGRFSVLTAVG--LLPIAASGLDIEAMMKGAADARDAF-RNSDLKENPAYQYAV
G6PIB_GEOSE      VIPDNIGGRYSVLTAVG--LLPIAVAGLNIDRMMEGAASAYHKY-NNPDLLTNESYQYAA
G6PI_CLOAB       VVPDDVGGRYSVLTAVG--LLPIAVAGIDIDEMMKGAAKAREVY-SEPDLEKNEAYQYAA
G6PI_STRPN       VVPDDIGGRFSVLTAVG--LLSIAASGADIKALMEGANAARKDY-TSDKISENEAYQYAA
G6PI_STRP1       VVPDNVGGRFSVLTAVG--LLPIAASGADITALMEGANAARKDL-SSDKISENIAYQYAA
G6PI_STRMU       VVPDSVGGRFTVLTAVG--LLPIAASGADLDQLMAGAEAARQDY-SSAELSENEAYQYAA
G6PI_LACLA       VVPDSVGGRFSVLTAVG--LLPIAASGADITALMEGANAARKEY-TSTNVHENDAYAYAA
G6PI_MYCPU       VVPDNVGGRFSVLTPVG--LLPLACAGIDIEKLLEGAKEANALY-KNSNLLENDAYKYAV
G6PI_MYCGE       VIDSNIGGRFSTLSPAG--LLLAKLFGHDPKAILKGTLQAKKDL-QTTSLENNSAYLYAV
G6PI_MYCPN       TIPSNIGGRFSTLSPAG--LLLAKLCGHDPKQLLLGTLTAKQEL-ANSDLNTNSAYYYAA
G6PI_MYCGA       PIYSDIGGRFSTITPSG--LLVAGLVGADYKQLIEGAKKAKADLFASSELKKNSAYTYAA
G6PI_THEMA       EVPPGVGGRFSVLTPVG--LLSAMAEGIDIDELHEGAKDAFEKS-MKENILENPAAMIAL
G6PI_HALSA       DAPRGVPGRFAALSTVA--LPAAAIAGVDVGELVAGAADGRAAL--AGSLEDCSAYAYGA
G6PI_CAMJE       FIPANVGGRFSILSAVG--IVPLCFCGYNAKALLEGAKACFEDFFTHKKDE------ILQ
G6PI_METJA       SIPENVPGRFSVFTAVG--LAPLYSLGVDISKILEGAREMDKIC-QNEDILKNPALLNGV
G6PI_SYNY3       PMQDWVGGRTSELSAVG--LLPAALQGIDIQAMLDGAKTMDEAT-RVRELRQNPAALLAL
                      : ** :                     :  *                        

G6PI_BORBU       ISIYERNVLNYSSNCIIAYSKAMENFYLHLQQLEMESNGKSVNRFNETIN-YKTVRIIWG
G6PI_TREPA       IGVYERTILGYEHTAVLPYSQALARFPAHLQQLDMESNGKSVNRFGIPIT-YKTGPVIFG
G6PI_CHLMU       LGIWNRNVLKYPTTAVIPYATGLKYFTAHLQQCGMESNGKSISRQGKEVH-FATSPIIWG
G6PI_CHLTR       LGVWNRNLLGYPTTAVIPYSTGLKYFTAHLQQCGMESNGKSISREGKEIS-FRTSPIIWG
G6PI_CHLPN       ISIWNRNFLGYPTEAVIPYSSGLEFFPAHLQQCCMESNGKSIVQDGRRVG-FSTSPVIWG
G6PI_XANAC       TAVWNRNLLGSATHAVMTYDQRLALLPAYLQQLVMESLGKRVKLDGSAVD-SDTVSVWWG
G6PI_XYLFA       TAVWNRNFLGCATYAVMAYDQRLALLPAYLQQLVMESLGKRVKCDGTPVD-RDTVPVWWG
G6PI_ZYMMO       ADQYYSAVRGAQTHGIFAYDERLQLLPFYLQQLEMESNGKRVDLDGNLID-HPSAFITWG
G6PI_ACIAD       MGIWNTNYLNLKTHAVLPYDGRLKYFTSYLQQLEMESNGKSTQRNGQKVE-NTTCPIVWG
G6PI_ACILW       LGVWNNNFLDIQTHAVLPYDGRLKYFAAYLQQLEMESNGKSTQRSGEKVD-SATCPIVWG
G6PI2_NEIMA      IAVWYNNFQHADGQTAVPYSHNLRLLPAWLNQLDMESLGKSRASDGSPAA-CKTGGIVFG
G6PI2_NEIMB      IAVWYNNFQHADGQTAVPYSHNLRLLPAWLNQLDMESLGKSRASDGSPAV-CKTGGIVFG
G6PI_PSEAE       LGVWYGDFWGANSHAILPYDYYLRNITDHLQQLDMESNGKSVRQDGTPVT-SGTGPVIWG
G6PI_HAEIN       VGLWNTNFLGAQTEAILPYDQYLHRFAAYFQQGNMESNGKYVDRDGNVIKNYQTGPIIWG
G6PI_PASMU       IGLWNTNFLGAQTEAILPYDQYLHRFAAYFQQGNMESNGKYVDRNGEVIDNYQTGPIIWG
G6PI_ECOLI       IGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKYVDRNGNVVD-YQTGPIIWG
G6PI_VIBCH       IGIWYNNFHGAESEAILPYDQYLHRFAAYFQQGNMESNGKYVDRNGNPVT-YQTGPIIWG
G6PI_BUCAI       ISIWYTNFFGSETEAIFPYDQYMHRFSAYFQQSNMESNGKSINRNGQRIN-YQTGPIIWG
G6PI_HELPY       IGVWYINFFQSKSHLIAPYDQYLRHFPKFIQQLDMESNGKRISKKGEIIP-YDTCPVVWG
G6PI_HELPJ       IGVWYINFFQSKSHLIAPYDQYLRHFPKFIQQLDMESNGKRISKKGEIIP-YDTCPVVWG
G6PI1_NEIMA      IGIWYINYYGGGSHVIAPYDQHLHRLPKFIQQLDMESNGKQVTLDGKAVG-HETSPIIWG
G6PI1_NEIMB      IGIWYINYYGGGSHVIAPYDQHLHRLPKFIQQLDMESNGKQVTLDGKAVG-HETSPIIWG
G6PI_CAUVC       AQIFNRNGLDRRARSVVPYSHRLRRLAAFLQQLEMESNGKSVGPDGQPAK-RGTATVVFG
G6PI_RHILO       VGWWHRVICGYPARAVIPYDQRLSRLPAYLQQLDMESNGKGVTLDGTPVA-TPTGPLVWG
G6PI1_STRCO      LGVWYGDFLGAQSHAVLPYSHYLSKFTAYLQQLDMESNGKSVDREGNPVQ-WQTGPVVWG
G6PI2_STRCO      LGVWYGSFLGAQSHAVLPYSHYLSKFTAYLQQLDMESNGKSVDREGKPVQ-WQTGPVVWG
G6PI_DEIRA       LGVWYGDFFGAESLAVLPYDQYLASFPAYLQQLDMESNGKHVTLGGEPVD-YQTGPIVWG
G6PI_MYCLE       IGLWYSDFLGAQSRAVLPYSNDLARFAAYLQQLTMESNGKSTRADGTPVT-TNTGEIYWG
G6PI_MYCTU       IGLWYSNFFGAQSRTVLPYSNDLSRFPAYLQQLTMESNGKSTRADGSPVS-ADTGEIFWG
G6PI_LEGPN       IGIWNNNFLNI--HYDLIGYNFKEYFVPYVQQLDMESNGKSIDVNGRMVD-YATGPIVWG
G6PIA_GEOSE      IRNILYNKG-KTIELLINYEPALQYFAEWWKQLFGESEGKDQKGIFPASANFSTDLHSLG
G6PI_BACSU       VRNVLYNKG-KTIEMLINYEPALQYFAEWWKQLFGESEGKDEKGIYPSSANYSTDLHSLG
G6PI_BACHD       VRNALYNKG-KTIELMVNYEPALQYFSEWWKQLYGESEGKDGKGIFPASVNFSTDLHSMG
G6PIB_GEOSE      VRNILYRKG-KAIELLVNYEPSLHYVSEWWKQLFGESEGKDQKGLFPASVDFTTDLHSMG
G6PI_CLOAB       ARNALYSKG-KSIEMVVNFEPSLHYFGEWWKQLFGESEGKDGKGLFPAAGDFSTDLHSMG
G6PI_STRPN       VRNILYRKG-YATEILVNYEPSLQYFSEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLG
G6PI_STRP1       VRNVLYRKG-YITEILANYEPSLQYFGEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLG
G6PI_STRMU       IRNILYRKG-YVTEVLANYEPSLQYFSEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLG
G6PI_LACLA       LRNILYRKG-KFSEILINYEPSLQYFSEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLG
G6PI_MYCPU       ARFLLQKK--FPVEMLVSYEPNHMFLLEWWKQLFGESEGKQGKGILPHSAIFTRDLHSLG
G6PI_MYCGE       VRHWLYTTKKFKIEVCIAYHSLYEYLLLQHRQLFGESEGKNDKSLFPTFSIFTVDLHSMG
G6PI_MYCPN       LRHWLYTTKKLKIEVTVAYHSAYEYLLLQHRQLFGESEGKGGKSLFPTFSLFTTDLHSMG
G6PI_MYCGA       LRHYLYTEMKKDVEIAITYEEQHEYLMLQHRQLFGESEGKSLNSLFPTYSVFTTDLHSMG
G6PI_THEMA       THYLYLNKG-KSISVMMAYSNRMIYLVDWYRQLWAESLGKRYNLKGEEVFTGQTPVKALG
G6PI_HALSA       TAYALDQRG-AGVNAMLPYAERLETFAEWFAQLWAESLGKDGVGQTPARALGATDQHSQL
G6PI_CAMJE       KAYHYCTHKNANINVLFSYSDAFKGFNEWYIQLIAESLGKKQ-------GYKRIGLTPIA
G6PI_METJA       IHYLYDKRG-KDISVIMSYVESLKYFGDWYKQLIGESLGKNKHGITPLLSIGAKDQHSLL
G6PI_SYNY3       AWYYAGDGQGKKDMVILPYKDRLLLFSRYLQQLVMESLGKERDLDGNVVH---QGIAVYG
                                          .     *   ** **                    

G6PI_BORBU       GIGTDVQHSFFQMLHQGTDIVPMDFIGFNETQLKEDVIS-----DNSSSNDKLKANLIAQ
G6PI_TREPA       EPGTNGQHSFYQHLHQGTSVVPLQFIAFQHSQLGQDPII-----RGSTGQQKLLANVVAQ
G6PI_CHLMU       DVGTNCQHSFFQSLHQGTDIVPVEFIGFLQNQRGIDCVL-----SGSSSSQKLFANLVAQ
G6PI_CHLTR       DVGTNCQHSFFQSLHQGTDIVPVEFIGFLHNQRGLDCVL-----SGSSSSQKLFANLVAQ
G6PI_CHLPN       EPGTNGQHSFFQCLHQGTDIIPVEFIGFEKSQKGEDISF-----QGTTSSQKLFANMIAQ
G6PI_XANAC       GAGTDVQHSFFQALHQGTSVVPADFIGTVHNDDP-----------YAENHTALMANVLAQ
G6PI_XYLFA       GVGTDVQHSFFQALHQGTNIVPADFIGTIRNDDP-----------YTENHFALNANLLAQ
G6PI_ZYMMO       GVGTDAQHAVFQLLHQGTRLVPIEFIAAIKADDTL----------NPVHHKTLLTNAFAQ
G6PI_ACIAD       EVGPNAQHAFYQLLHQGTQKVSCDFIAPMHRYNANHFTYVENADALIDQHLLALSNCLAQ
G6PI_ACILW       EVGPNAQHAFYQLLHQGTHKVSCDFIAPVKRYNANHFTYAENAEALIEQHHLALSNCLAQ
G6PI2_NEIMA      GEGVNCQHAYFQLLHQGTRLIPCDFIVPMTAQGVED-----------GRSRFTVANAFAQ
G6PI2_NEIMB      GEGVNCQHAYFQLLHQGTRLIPCDFIVPMTAQGRED-----------GRSRFTVANAFAQ
G6PI_PSEAE       GVGCNGQHAYHQLLHQGTQLIPADFIVPVSSYNPVA-----------DHHQWLYANCLSQ
G6PI_HAEIN       EPGTNGQHAFYQLIHQGTTLIPCDFIAPAQRHNPLA-----------DHHNKLLSNFFAQ
G6PI_PASMU       EPGTNGQHAFYQLIHQGTTLIPCDFIAPAQTHNPLA-----------DHHEKLLSNFFAQ
G6PI_ECOLI       EPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLS-----------DHHQKLLSNFFAQ
G6PI_VIBCH       EPGTNGQHAFYQLIHQGTKLIPCDFIAPAVSHNLVG-----------DHHQKLMSNFFAQ
G6PI_BUCAI       EPGTNGQHAFYQLIHQGTRLIPCDFIAPVFSHNDLN-----------NHHMKLISNFFAQ
G6PI_HELPY       DMGINAQHAFFQLLHQGTHLIPIDFIASLDKKPNAK-----------GHHEILFSNVLAQ
G6PI_HELPJ       DMGINAQHAFFQLLHQGTHLIPIDFIASLDKKPNAK-----------GHHEILFSNVLAQ
G6PI1_NEIMA      ETGINGQHAFFQLLHQGTHITPIDLIASLEKRSNLP-----------GHHEILLANVFAQ
G6PI1_NEIMB      ETGINGQHAFFQLLHQGTHITPIDLIASLEKRSNLP-----------GHHEILLANVFAQ
G6PI_CAUVC       DEGTNVQHAYFQCMHQGTDITPMELIGVAKSDEGP-----------AGMHEKLLSNLLAQ
G6PI_RHILO       EPGTNGQHAFFQLLHQGTDFIPVEFLAAAVGHEPEL----------KHQHDLLLANCLAQ
G6PI1_STRCO      TPGTNGQHAYYQLIHQGTKLIPADFIGFARPVDELSEE-------LKAQHDLLMANFFAQ
G6PI2_STRCO      TPGTNGQHAYYQLIHQGTKLIPADFIGFARPVDELSEE-------LKSQHDLLMANFFAQ
G6PI_DEIRA       QAGTNGQHAFYQLIHQGTKLIPCDFIGFCQTLNPLP-----------PHHDLLMANVFAQ
G6PI_MYCLE       ETGTNGQHAFYQLLHQGTRLVPADFIGFSQPIDDLPTVD-----GIGSMHDLLMSNFFAQ
G6PI_MYCTU       EPGTNGQHAFYQLLHQGTRLVPADFIGFAQPLDDLPTAE-----GTGSMHDLLMSNFFAQ
G6PI_LEGPN       GLGNQAQHSYFQLLCQGTHRCVGDFITLKT-----------------NDEHEINSMCHYK
G6PIA_GEOSE      QYIQEGRRDLFETVLKVEKPRHD--LVIEAEENDLD------------GLNYLAGKTVDF
G6PI_BACSU       QYVQEGRRDLFETVLNVEKPKHE--LTIEEADNDLD------------GLNYLAGKTVDF
G6PI_BACHD       QYVQDGRRDLFETIIQVEKPKKN--MTIEKADQDLD------------GLNYLAGETMDF
G6PIB_GEOSE      QYVQEGRRNLIETVLHVKKPQIE--LTIQEDPENID------------GLNFLAGKTLDE
G6PI_CLOAB       QYIQEGRRQLIETFINVVNPKKE--VTIQKDAENLD------------GLNFVAGKTMDF
G6PI_STRPN       QFIQEGTRIMFETVVRVDKPRKN--VLIPTLEEDLD------------GLGYLQGKDVDF
G6PI_STRP1       QFIQEGYRNLFETVIRVDNPRKN--VIIPELAEDLD------------GLGYLQGKDVDF
G6PI_STRMU       QFIQEGNRNLFETVIRVEKARKN--ILVPEAAEDLD------------GLAYLQGKDVDF
G6PI_LACLA       QWIQEGTRTVFETAIRIEKPRKN--INIPELDADLD------------GLGYLQGKDVDF
G6PI_MYCPU       QFIQDGSKIMFETVIWVDKPIFD--LKIEKEIEDLD------------KLNYLTNKSLHQ
G6PI_MYCGE       QLYQEGEKVFFETVIDVKNPLVN-INLPPSDFDNDD------------ELDFLLDKSLNE
G6PI_MYCPN       QLYQEGEKNFFETVIQVQTQFHD-LELPPSDFNNDD------------QLDYLLAKSMNE
G6PI_MYCGA       QLYQDGKKIFFETVFSFEKANKNKLKLKNSEFNNDD------------QLDYLTKKSVNQ
G6PI_THEMA       ATDQHSQIQLYNEGPNDKVITFLRVENFDREIVIPETGR--------AELSYLARKKLSE
G6PI_HALSA       QLYRAGPRDKLVTMLRPASRPDCAIPEAELADID-----------------YLTGGDLGA
G6PI_CAMJE       LIGARDQHSFLQLIMDGPKNKTVTFLKIKDAQKAPIIP---------DIHFKFLDSLSNK
G6PI_METJA       QLYMDGKKDKIITFMVAKKYRLDEEIEFEDINDEK------------------ISCRYSD
G6PI_SYNY3       NKGSTDQHAYVQQLRDGVPNFFATFIEVLHDRQGPS-------------LELEPGVTSGD
                                                                             

G6PI_BORBU       IIAFSKGKENSN-------------------KNKNFQGERPSALIYSKELTPYAIGAILS
G6PI_TREPA       IVAFARGKEHAD-------------------ANKTFSGERPSSLLYAKALTPQTLGALLA
G6PI_CHLMU       SLALAQGRDNDN-------------------PNKRFKGNRPSSILVAQQLSPRIAGGLLA
G6PI_CHLTR       SLALAQGRDNAN-------------------SNKRFKGNRPSSILVAQQLSPRIAGSLLA
G6PI_CHLPN       AIALACGSENTN-------------------PNKNFDGNRPSSVLVSSQLNPYSLGELLS
G6PI_XANAC       TEALANGQDSS-------------------DPHRSYPGGRPSTVILLDALTPQALGALIS
G6PI_XYLFA       IEVLANGQLSD-------------------DPHRVYPGGNPSTLILLDALTPQALGGLIA
G6PI_ZYMMO       GAALMSGRDNK-------------------DPARSYPGDRPSTTILMEELRPAQLGALIA
G6PI_ACIAD       SRLLAFGNDALKVDQRE-----------QLPAYKQYEGNQPSTTMLLKELSPRTMGKLIA
G6PI_ACILW       SRLLAFGNQALTADEIE-----------DLPTYKQYEGNQPSSTILLKELNPYSLGMLIA
G6PI2_NEIMA      AEALMKGKTLDEARAEL--ADLPEAERERLAPHKEFPGNRPSNSILLERLTPYNLGMLMA
G6PI2_NEIMB      AEALMKGKTLDEARAEL--ADLPEAERERLAPHKEFPGNRPSNSILIDRLTPYNLGMLMA
G6PI_PSEAE       SQALMLGKSREEAEAELRAKGLPEAEVQRLAPHKVIPGNRPSNTLVVERISARRLGALIA
G6PI_HAEIN       TEALAFGKTKEEVEAEFVKAGKSLDDVKNIVPFKVFTGNKPTNSILVQKITPFTLGALIA
G6PI_PASMU       TEALAFGKTKEEVEAEFVKAGKSLDEVKEVVPFKVFTGNKPTNSILVQKITPFTLGALIA
G6PI_ECOLI       TEALAFGKSREVVEQEYRDQGKDPATLDYVVPFKVFEGNRPTNSILLREITPFSLGALIA
G6PI_VIBCH       TEALAFGKSAQAVQAELEKAGKSAAEIAALVPFKVFEGNRPTNSILVKQITPRTLGNLIA
G6PI_BUCAI       TQALAFGQSRDSILHRLILSKKNQDDIKRILPFKICKGNQPTNSILIRKITPYNLGALIA
G6PI_HELPY       AQAFMKGKSYEEALGELLFKGLDKDEAKDLAHHRVFFGNRPSNILLLEKISPSNIGALVA
G6PI_HELPJ       AQAFMKGKSYEEALGELLSKGLDKDEAKDLAHHRVFFGNRPSNILLLEKISPSNIGALVA
G6PI1_NEIMA      AEAFMRGKTPDEVRAELKAQGMDEARIEELVPHKTFSGNRPTNLILMDKVNPRNMGSLIA
G6PI1_NEIMB      AEAFMRGKTPDEVRAELKAQGMDEVRIEELVPHKTFSGNRPTNLILMDKVNPRNMGSLIA
G6PI_CAUVC       AEAFMVGRTTDDVVAELTAKGVSDAEIATLAPQRTFAGNRPSTLVLLDRLTPQTFGALIA
G6PI_RHILO       SEALMKGRTLDEARAQMLAKGMKPADVDKIAPHRVFSGNRPSLTILYRKLDPRTFGRLIA
G6PI1_STRCO      TQALAFGKTPDEVRAEGVP--------EELVPHKTFRGNHPTTTVLAAELTPSVLGQLIA
G6PI2_STRCO      TQALAFGKTPDEVRAEGVP--------EELVPHKTFPGDHPTTTILARELTPSVLGQLVA
G6PI_DEIRA       TEALAFGKTLEQVLADGVA--------PEVAPHRVFEGNRPTSTILADRLTPRTLGALIA
G6PI_MYCLE       TQVLAFGKTAEEIAAEGTP--------AEVVPHKVMPGNRPTTSILANRLTPSVLGQLIA
G6PI_MYCTU       TQVLAFGKTAEEIAADGTP--------AHVVAHKVMPGNRPSTSILASRLTPSVLGQLIA
G6PI_LEGPN       MKVLSEGIQTIE------------------NPYGYIPGNMPMNHLILSDCSPYTLGALVA
G6PIA_GEOSE      VNTKAFEGTLLAHTD----------------------GGVPNLVITLPELNEYTFGYLVY
G6PI_BACSU       VNKKAFQGTMLAHTD----------------------GNVPNLIVNIPELNAYTFGYLVY
G6PI_BACHD       VNKKAFEGTLLAHVD----------------------GGVPNLVVSVPELDEYYMGYLMY
G6PIB_GEOSE      VNKKAFQGTLLAHVD----------------------GGVPNLIVELDEMNEYTFGEMVY
G6PI_CLOAB       VNKQAFMGTVLAHHD----------------------GGVPVMVVNVPELTAYYFGYMVY
G6PI_STRPN       VNKKATDGVLLAHTD----------------------GDVPNMYVTLPEQDAFTLGYTIY
G6PI_STRP1       VNKKATDGVLLAHTD----------------------GGVPNMFVTLPAQDEFTLGYTIY
G6PI_STRMU       VNKKATDGVLLAHTD----------------------GGVPNTFLTIPEQDEFTLGYVIY
G6PI_LACLA       VNKKAADGVLLAHTD----------------------GNVPNMIVTLPEQDEFTLGYAIY
G6PI_MYCPU       INKAAFEATVEAHTKV---------------------GLVPNIILELEDSSEKTLGALFM
G6PI_MYCGE       ISDVAIDSVIKAHYQ----------------------ANVSIIKLTLKEQSAFMFGYFYF
G6PI_MYCPN       ISNTALEAVVEAHFQ----------------------SNVNIIKLTLKERTTFMFGYFYF
G6PI_MYCGA       LNYVACEATKQAHAS----------------------AGVPIIEIDVKENSAYGFGYLYF
G6PI_THEMA       LLLAEQTGTEEALRE----------------------NNRPNMRVTFDGLTPYNVGQFFA
G6PI_HALSA       LLDAEFEATAASLAA----------------------SGVPTVRVEVPAVDARSVGRLLF
G6PI_CAMJE       VNLHELLNAQCDATM-----------------HALIAENLSVDVIELEKLDAWHAGYLMY
G6PI_METJA       IIRSQQKATEIALTN----------------------NGVPNVRITLDEINEMAMGALLY
G6PI_SYNY3       YLSGFLQGTRQALFE----------------------NQRDSITVTIPEVDATSVGALIA
                                                             :          *    

G6PI_BORBU       HYENKVMFEGFLLNINSFDQEGVQLGKIIANQILKNDNFKDEVIESYSKKILKKF-----
G6PI_TREPA       HFENKIMFQGFAWNLNSFDQEGVQLGKTLAQHILAGE--VEGVLRAYADLFDLAHAPTC-
G6PI_CHLMU       FYEHKFAFQGFCWGINSFDQEGVSLGKELATQIIGLMSGAAPIEFPEARELLRLFNVLQ-
G6PI_CHLTR       FYEHKFAFQGFCWGINSFDQEGVSLGKELATQIIGIMSGNAPVEFSEARGMLRLFNVLT-
G6PI_CHLPN       YYENKIVFQGFCWGINSFDQEGVSLGKALANRVLELLEGADASNFPEAASLLTLFNIKFR
G6PI_XANAC       MYEHSVYVQSVMWGINAFDQFGVELGKQLASQLLPALKGES--VDVADPVTRELLNKLRG
G6PI_XYLFA       MYEHSVYVQSVIWGINAFDQFGVELGKHLAVQLLPALKGES--VEVVDPVTRAVLVRLRG
G6PI_ZYMMO       FYEHRTFTNGVLLGINSFDQFGVELGKEMAHAIADHPEN-----SDFDPSTKALIAAALK
G6PI_ACIAD       LYEHKVFVQSVIWDINPFDQWGVEKGKEIANDLLPILNGESSDLSHLDDSTQGLIQFLLG
G6PI_ACILW       TYEHKVFVQSVLWNINPFDQWGVEKGKEIANQLLPILNREQDDLSTFDASTQGLLKILLG
G6PI2_NEIMA      AYEHKTFVQGVIWDINPFDQWGVEYGKQLAKTIIGELEG-G--TSVHDASTEGLMAFYRE
G6PI2_NEIMB      AYEHKTFVQGAIWNVNPFDQWGVEYGKQLAKTIIGELEG-G--TSVHDASTEGLMAFYRE
G6PI_PSEAE       MYEHKVYVQSILWGINAFDQWGVELGKELGKGVYSRLVG-SEETPAEDASTQGLIDFFRG
G6PI_HAEIN       MYEHKIFVQGVIFNIFSFDQWGVELGKQLANRILPELTD-SEKVASHDSSTNGLINQFKA
G6PI_PASMU       MYEHKIFVQGVMFNIYSFDQWGVELGKQLANRILPELAN-RETITTHDSSTNGLINQYKQ
G6PI_ECOLI       LYEHKIFTQGVILNIFTFDQWGVELGKQLANRILPELKD-DKEISSHDSSTNGLINRYKA
G6PI_VIBCH       MYEHKIFVQGVIWNIFSFDQWGVELGKQLANQILPELAD-SAAVTSHDSSTNGLINAFKA
G6PI_BUCAI       LYEHKIFVQGYILNIFSFDQWGVELGKELSQNIYNYLNI-NVKNKSYDASTEGLINFYKS
G6PI_HELPY       LYEHKVFVQGVIWDINSFDQWGVELGKELAVPILQELEG-HKSNAYFDSSTKHLIELYKN
G6PI_HELPJ       LYEHKVFVQGVIWDINSFDQWGVELGKELAVPILQELEG-HKSNAYFDSSTRHLIELYKN
G6PI1_NEIMA      MYEHKTFVQGIIWGINSFDQWGVELGKQLAKTILGELTG-ETGSQKHDSSTERLINLYLQ
G6PI1_NEIMB      MYEHKTFVQGIIWGINSFDQWGVELGKQLAKTILGELTG-ETGPQKHDSSTERLINLYLQ
G6PI_CAUVC       LYEHKTFVEGVIWGINSFDQWGVELGKVMANRILPELES-GASGQH-DPSTAGLIQRLKR
G6PI_RHILO       LYEHRVFVEGTLFNINSFDQWGVELGKELATGLLPVVEGKESAANR-DASTRGLVERIHQ
G6PI1_STRCO      LYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRVEPAL-TEGADVPGLDPSTAALVAAYRE
G6PI2_STRCO      LYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRVEPAL-TEGADVPGLDPSTGALVAAYRE
G6PI_DEIRA       LYEHKVFVQGAVWDINSFDQWGVELGKVLAKKIDGELQSEGEPELQHDSSTNALIRRYRA
G6PI_MYCLE       LYEHQVFTEGVIWGIDSFDQWGVELGKKQAEALLPVITGNASPAQQLDSSTDTLVRRYRT
G6PI_MYCTU       LYEHQVFTEGVVWGIDSFDQWGVELGKTQAKALLPVITGAGSPPPQSDSSTDGLVRRYRT
G6PI_LEGPN       LYEHKIFEQSVIWNINPFDQPGIESAKSAHREITLSSES---------------------
G6PIA_GEOSE      FFEKACAMSGYLLGVNPFDQPGVEAYKVNMFALLGKPGYEEKKAELEKRLK---------
G6PI_BACSU       FFEKACAMSGYLLGVNPFDQPGVEAYKVNMFALLGKPGFEEKKAELEKRLED--------
G6PI_BACHD       FFEKACGLSGYLLGVNPFDQPGVEAYKKNMFALLGKPGFEEQKAALEKRLK---------
G6PIB_GEOSE      FFEKACGISGHLLGVNPFDQPGVEAYKKNMFALLGKPGFEDEKAALMKRLSK--------
G6PI_CLOAB       FFEKACGISGYLLGVNPFNQPGVEAYKKNMFALLGKPGYEDLAKELNNKLK---------
G6PI_STRPN       FFELAIALSGYLNAINPFDQPGVEAYKRNMFALLGKPGFEELSKELNARL----------
G6PI_STRP1       FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL----------
G6PI_STRMU       FFELAIGLSGYLNGVNPFDQPGVEAYKKNMFALLGKPGFEELGAELNARL----------
G6PI_LACLA       FFELAIGVSGYLNGINPFNQPGVEAYKKNMFALLGKPGFEELSKELNDRL----------
G6PI_MYCPU       FFERAVAMSGYLLKVNPFNQPGVEVYKSNLFKILEKK-----------------------
G6PI_MYCGE       WLSVATVMSGSLLGHNVFNQPGVEVYKKLMFEKLRSGH----------------------
G6PI_MYCPN       WLSMATMMSGSLLGHNVFDQPGVEVYKQLMFAKLGRE-----------------------
G6PI_MYCGA       WLCVATSVSALLLGHDPYNQPGVENYKQRMFKLL--------------------------
G6PI_THEMA       YYEAATAFMGYLLEINPFDQPGVELGKKITFALMGREGYTYEIKERSKKVIIE-------
G6PI_HALSA       DFEAACVLAGELYGVETFTQPAVEWGKNAARELLRGEDPLPETETHIVE-----------
G6PI_CAMJE       YYELFTSTCGVMLGINTYDQPGVEVGKLILKNILNS------------------------
G6PI_METJA       MYEMQVGFMGELYNINAYNQPAVEEEKKICWRLIKQ------------------------
G6PI_SYNY3       LYERAVSFYGSLVNVNAYHQPGVEAGKKAAASILELQKAILSTLQNESGPIALEALATKV
                          .       : * .:.  *                                 

G6PI_BORBU       -----------------------------------------
G6PI_TREPA       -----------------------------------------
G6PI_CHLMU       -----------------------------------------
G6PI_CHLTR       -----------------------------------------
G6PI_CHLPN       -----------------------------------------
G6PI_XANAC       -----------------------------------------
G6PI_XYLFA       -----------------------------------------
G6PI_ZYMMO       -----------------------------------------
G6PI_ACIAD       KSNG-------------------------------------
G6PI_ACILW       KNNG-------------------------------------
G6PI2_NEIMA      CRLKGGGAA--------------------------------
G6PI2_NEIMB      CRLKGGGAA--------------------------------
G6PI_PSEAE       RHRG-------------------------------------
G6PI_HAEIN       WR---------------------------------------
G6PI_PASMU       WR---------------------------------------
G6PI_ECOLI       WRG--------------------------------------
G6PI_VIBCH       FRA--------------------------------------
G6PI_BUCAI       FMI--------------------------------------
G6PI_HELPY       YNQ--------------------------------------
G6PI_HELPJ       YNQ--------------------------------------
G6PI1_NEIMA      TNRK-------------------------------------
G6PI1_NEIMB      TNRK-------------------------------------
G6PI_CAUVC       -----------------------------------------
G6PI_RHILO       LRGSE------------------------------------
G6PI1_STRCO      LKEVH------------------------------------
G6PI2_STRCO      LRGRR------------------------------------
G6PI_DEIRA       RRQG-------------------------------------
G6PI_MYCLE       ERGRTS-----------------------------------
G6PI_MYCTU       ERGRAG-----------------------------------
G6PI_LEGPN       -----------------------------------------
G6PIA_GEOSE      -----------------------------------------
G6PI_BACSU       -----------------------------------------
G6PI_BACHD       -----------------------------------------
G6PIB_GEOSE      -----------------------------------------
G6PI_CLOAB       -----------------------------------------
G6PI_STRPN       -----------------------------------------
G6PI_STRP1       -----------------------------------------
G6PI_STRMU       -----------------------------------------
G6PI_LACLA       -----------------------------------------
G6PI_MYCPU       -----------------------------------------
G6PI_MYCGE       -----------------------------------------
G6PI_MYCPN       -----------------------------------------
G6PI_MYCGA       -----------------------------------------
G6PI_THEMA       -----------------------------------------
G6PI_HALSA       -----------------------------------------
G6PI_CAMJE       -----------------------------------------
G6PI_METJA       -----------------------------------------
G6PI_SYNY3       QAPEQVETVYKIVRHLAANDRGVTLQGDRQFPQRLQIQWRS