CLUSTAL format seed alignment for MF_00476

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NIKR_HALSA       -------------------MSVVSVSMPEELLERLDDFADDHGYTGRSEVVREASRNLLG
NIKR_HALWD       -------------------MSVVSVSMPEELLERIDQFADDHGYTGRSEVFREASRNLLE
NIKR_HALMA       -------------------MGVVSISMPDELEERIDTFADEHGYTGRSEVVREAVRNLMG
NIKR_NATPD       -------------------MTVVSVSMPESLLDRLDEFAEEHGYTGRSEVVREASRNLLG
NIKR1_METTH      -------------------MVVVSVSLGEKLLEEIDALRDELGFSGRSDVIRVAARMLID
NIKR_METMP       ----------------MVDMDRISISLPTNLLAEFDEIIEERGYASRSEAIRDSIRDYLI
NIKR_METM5       ----------------MVDMDRISISLPTNLLAEFDEIIEERGYASRSEAIRDSIRDYLI
NIKR_METM7       ----------------MVDMDRISISLPTNLLAEFDEIIEERGYASRSEAIRDSIRDYLI
NIKR_METVS       ----------------MVDMDRISISLPTNLLAEFDDIIAERGYASRSEAIRDSIRDYLI
NIKR_META3       ----------------MVDMDRISISLPTKLLGEFDEIIGDRGYASRSEAIRDSIRDYII
NIKR_METJA       ----------------MTEMDRISISLPSKLLREFDEIIAERGYASRSEAIRDAIRDYII
NIKR2_METTH      -------------------MMRISMSLPKKLLNEFDEVLRDRGYQSRSKGIRDALKDYIV
NIKR_METAR       ---------------MDQELMRIGVSLPDNLLDRFDNIIEKRGYSSRSEGIRDAIRNYIM
NIKR_METTP       ---------------MEQELMRIGVSLPEKLLSRFDEIISQRGYSSRSEGIRDAIRNYII
NIKR3_METAC      ---------------METELMRIGVSLPDTLLSKFDEIIEKRGYSSRSEGIRDAIRSYIS
NIKR2_METMA      ---------------METELMRIGVSLPDTLLSKFDEIIEKRGYSSRSEGIRDAIRSYIS
NIKR1_METAC      ---------------METELMRIGISLPDILLGEFDEIIGKRGYSSRSEGIRDAIRSYIS
NIKR1_METMA      ---------------METELMRIGVSLPDTLLGKFDEIIEKRGYSSRSEAIRDSIRSYIS
NIKR_METBU       ---------------MEQELMRIGVSLPDNLLNKFDSIIEGRGYSSRSEGIRDSIRTYIN
NIKR2_METAC      ---------------MEKKLMRIGVSLPGELLDKFDKTLMKRGYSSRSEGIRDAIRTYNQ
NIKR3_METMA      ---------------MGKKLMRIGISLPGELLDKFDKTLMKRGYSSRSEGIRDAIRTYNQ
NIKR_ARCFU       ---------------MEEGITRIGVSLPKNLLDEFDRIISTRGYSSRSEAIRDAIRTYIT
NIKR_HELPY       ----------MDTPNKDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLV
NIKR_HELPJ       ----------MDTPNKDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLV
NIKR_HELPH       ----------MDTHNKGDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLV
NIKR_HELAH       ----------MDTNNKDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDLIREKLV
NIKR_HELHP       ---------------MKSSIIRFSVSLPQNLLETLDERLTHKGYSSRSEIVRDMIREKLN
NIKR_CAMC5       ----------------MDNIIRFSVSLPSQLLDELDKKVSEQGYASRSEFTRDLIREKIV
NIKR_CAMC1       ----------------MDSVIRFSVSLPSQLLDELDRKVSEQGYASRSEFTRDLIREKIV
NIKR_ECO57       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOL6       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOUT       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOHS       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_SHIFL       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOLI       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOLC       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_SHIDS       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_SHIF8       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOK1       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_SHIBS       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECO24       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_SHISS       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_ECOL5       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALA
NIKR_SALTY       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALA
NIKR_SALCH       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALA
NIKR_SALTI       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALA
NIKR_SALPA       -------------------MQRVTITLDDDLLETLDNLSQRRGYNNRSEAIRDILRGALA
NIKR_SALAR       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALA
NIKR_CITK8       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALA
NIKR_ENT38       -------------------MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALA
NIKR_KLEP7       -------------------MQRVTLTLDDDLLAALDALSARRGYHNRSEAVRDILRDALN
NIKR_BRUO2       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRUME       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRUC2       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRUSU       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRUAB       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRUSI       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRUA2       -------------------MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQ
NIKR_BRADU       -------------------MQRITITIEDDLLAEIDAAAAARGYQNRSEIIRDLARAGLQ
NIKR_RHOPA       -------------------MHRVTITLDDDLMEKLDAIIAARGYQNRSEAIRDLARIGIQ
NIKR_PSEPK       -------------------MQRITITLDEELLDVIDRRVATQGYQGRSEAIRDLLRAGMR
NIKR_DESVV       ----------------MGRTIRFGVSLDSELLDKFDVLCDERCYQTRSEAIRDLIRNTLV
NIKR_DESVH       ----------------MGRTIRFGVSLDSELLDKFDVLCDERCYQTRSEAIRDLIRNTLV
NIKR_DESAG       ----------------MGQTIRFGVSLDSDLLEKFDALCDERCYQTRSEAIRDLIRNTLV
NIKR_PYRHO       -----------------MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFII
NIKR_PYRAB       -----------------MDLVRFSISIPAELLEKFDRIIEEIGYENRSEAIRDLIRDFII
NIKR_PYRFU       -----------------MGIVRFGVSIPKELLEKFDGIIEEMGYTNRSEAIRDLIRDMVV
NIKR_THEKO       -----------------MKIIRFGVSVPEELLEKFDQIIAEKGYVNRSEAIRDLMRDFIV
NIKR_GEOUR       ----------------MGETIRFGISIDETLLESFDKLIDQKGYMNRSEAIRDLIRASLV
NIKR_GEOMG       ----------------MGETVRFGISIDDKLLESFDRLIEQKGYMNRSEAVRDLIRAALV
NIKR_GEOSL       ----------------MGETIRFGVSIDEKLLESFDGLIEEKGYMNRSEAIRDLIRAALV
NIKR_PELPD       ----------------MGETIRFGISIDDKLLESFDQLIEHKGYANRSEALRDLIRASLI
NIKR_CALS4       MLLFSKKIAQHKGGICLEGIVRFGVSMESKLLKQFDELIKKKNYNNRSEAIRDLIRDFIV
NIKR_SOLUE       ----------------MSGLSRIGVAIDSDLLDKFDSLIGQRGYTNRSEAFRDLIRDELV
NIKR_SYNAS       ----------------MSDIVRFGVSLDNTLLKQFDRFIKDRNYTNRSEAIRDLIRQELL
NIKR_CHLTE       ----------------MSDLYRFGISLERKLIESFDRHIKAQGYQSRSEALRDLIREELL
NIKR_DESPS       ------------------MLKRFSISLDDNLLEIFDQHIAEKAYNNRSEAIRDLIRKNFV
NIKR_ANADE       ------------------MLERIGISLEDGLLEQFDKLIAEKGYVNRSEAVRDLIRDALV
NIKR_METKA       ------------MNKGEDNLVRTSITVPEQLLQKVNELIASGYFASRSEIFRQALREYLQ
NIKR_SACS2       -----------------MSAEKISISLPKELYRELEDFIIRKGIPDRSKIFQIALRNYLD
                                         :::   *   .:          **.  :   :    

NIKR_HALSA       EFEDKKLE--GRELMGVVTVVFDYETTTVEEKMMHLRHEH----EGLVASNFHSHVGGHH
NIKR_HALWD       EFEDKRLE--NRELMGIVTVVFDYETTNVEEKMMHLRHEH----EDIVASNFHSHVGGHH
NIKR_HALMA       EFEDKRLE--DRELMAVVTVLFDYETTTVEEKMMHLRHDH----ESIVASNFHSHVGDRY
NIKR_NATPD       EFEDKKLE--GRELMGVVTVVFDHETSSAEERMMQIRHDH----EHTVVSNVHNHVGDHY
NIKR1_METTH      E---KRNL--HELNGEINAVLFLIHPRRVEDLVTKIKHDY----EDIIGTQLHSHLKDGN
NIKR_METMP       KHKWIHSL--EGERAGTISIIYDHHSTDVMEKLTNIQHDY----EKLIVATIHMHLDHDH
NIKR_METM5       KHKWIHSL--EGDRAGTISIIYDHHSTDVMEKLTNIQHDY----EKLIVATIHMHLDHDH
NIKR_METM7       KHKWIHSL--EGHRAGTISIIYDHHSTDVMEKLTTIQHDY----EKLIVATIHMHLDHDH
NIKR_METVS       KHKWIHSL--EGSRAGTISIIYDHHSTDVMEKLTTIQHDY----EKIIVATIHMHLDHDH
NIKR_META3       KHKWIHSL--EGERSGTITIIYDHHASDLMERITTIQHDY----SNLIVATLHMHMDHDN
NIKR_METJA       KHKWIHSL--EGERAGSISVIYNHHASDVMEKITEIQHNY----TDIIVATLHLHLDHDH
NIKR2_METTH      RYQWMNEM--EGERIGIIAVIYDHHYTGVMEDLADIQHDY----REYINAVMHVHMTERH
NIKR_METAR       HYEWMNEV--EGERIGVITLIYDHDQRGLVNNLTDIQHEY----MGMIKSSVHVHLDHDN
NIKR_METTP       HYEWMSDV--EGERVGVITIVYSHHQRGLVDSLTDIQHEF----GSIINSSLHVHLDKDN
NIKR3_METAC      YYEWMGDI--KGHRVGTVAVIYDHTKRGLSNALADIQHHY----SHLIKSSVHIHLDHDN
NIKR2_METMA      YYEWMGDI--KGHRVGTVAVIYDHTKRGLSNALADIQHHY----SHLIKSSVHIHLDHDN
NIKR1_METAC      YYEWMNDI--KGHRVGTIAFVYDHTKRGLSNSLTDIQHHY----SHLIKSSIHVHLDHKE
NIKR1_METMA      YNEWMGNI--KGHHVGTIVIIYDHTQRGLSNVLTDIQHHY----SHLIRSSIHIYPDRED
NIKR_METBU       QYEWMSDI--RGRRVGTITIIYDHTKRGLSNAVADIQHDY----SDLIKSSVHIHLDHDN
NIKR2_METAC      HYEWMQQI--KGARAATISLVYDCSKKGITSTLAKIQHEY----IDLITSSVHFHIEEDF
NIKR3_METMA      HYEWMKQI--RGSRSATISIVYDCSKKGVTSTLAEIQHEY----VDMISSSVHFHMEEDL
NIKR_ARCFU       EYRWLESE--KGEIVGVLVVLYDHHVKGVSDLLIDLQHDF----HEIITSSTHIHLNEDQ
NIKR_HELPY       EDNWAEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHAS----GTHVLCTTHIHMDEHN
NIKR_HELPJ       EDNWVEDNPNDGSKIAVLVVIYDHHQRELNQRMIDIQHAS----GTHVLCTTHIHMDEHN
NIKR_HELPH       EDNWAEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHAS----GTHVLCTTHIHMDEHN
NIKR_HELAH       EDNWIEDSPDDKSKVAVLVVIYDHHQRELNQRMIDIQHAS----ETHVLCTTHIHMDSHN
NIKR_HELHP       EEIWSSGAENTQG-VAVLTIIYDHHQRELNQRMIDIQHTSTHKGNVEILCNTHVHLDQHN
NIKR_CAMC5       NDSWKDA---KEELIGVLTLIYVHHQNDLINKMMDIEHDA----DVTIICTNHVHVDHHN
NIKR_CAMC1       NDSWKDA---DEELIGVLTLIYVHHHNDLVNKKMDIEHDS----DVKIICTNHVHVDHHN
NIKR_ECO57       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOL6       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOUT       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOHS       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SHIFL       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOLI       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOLC       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SHIDS       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SHIF8       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOK1       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SHIBS       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECO24       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SHISS       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ECOL5       QEATQQ---HGTQGFAVLSYVYEHEKRDLASRIVATQHHH----HDLSVATLHVHINHDD
NIKR_SALTY       QEATQE---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SALCH       QEATQE---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SALTI       QEATQE---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SALPA       QEATQE---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_SALAR       QEATQE---HGTYGFAVLSYVYEHEKRDLASRIVSTQHHH----HELSVATLHVHINHDD
NIKR_CITK8       QEATQE---HGTQGFAVLSYVYEHEKRDLASRIVSTQHHH----HDLSVATLHVHINHDD
NIKR_ENT38       QETAQQ---HGTQGFAVLSYVYEHEKRDLARRLVSTQHHH----HDLSVATLHVHVSHED
NIKR_KLEP7       QDPPSP---ESRRGYAVLSYVYEHEKRELASRLVATQHHH----HDLSVATLHVHISHDD
NIKR_BRUO2       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRUME       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRUC2       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRUSU       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRUAB       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRUSI       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRUA2       QASLEEG--QMEACVGVLSYTYDHSARDLSKKLTNTHHDH----HNISVASMHVHLDHDR
NIKR_BRADU       QTSEDTA--QTGPCVAGLVYVYDHAARDLSKRLVQEFHGH----HDLALATLHVHLDDNN
NIKR_RHOPA       QTAAET---TSGHCVGAMVYTYDHSKRDLPRKLTQSFHHH----HDLSRATMHVHLDHDQ
NIKR_PSEPK       ESEALP---DDAACVAVVSYLYDHSTRELPRRLNQTLHAH----HDLTRSTLHVHLDAGH
NIKR_DESVV       QQEWEDT---DREIAGTLTLVYDHHKSDLAQRLTEIQHDV----HDIIITSLHVHLDHYN
NIKR_DESVH       QQEWEDT---DREIAGTLTLVYDHHKSDLAQRLTEIQHDV----HDIIITSLHVHLDHYN
NIKR_DESAG       QQEWEDT---GRDIAGTLTLVFDHHKSDLQQRLTEIQHDE----HDLIITTLHVHLDHDN
NIKR_PYRHO       RHEWEVG---NEEVAGTITIVYNHDEGDVVKALLDLQHEY----LDEIISSLHVHMDEHN
NIKR_PYRAB       RREWEVG---NEEVAGTITIVYNHDEGDVVKELLDLQHEY----LDEIISTLHVHMDEHN
NIKR_PYRFU       RHEWQLG---DEEVAGTITIVYNHDEADVVRELLDLQHEY----LNEIVSSLHVHMDEHN
NIKR_THEKO       RHEWEAG---DKEVAGTITMLYNHDEADVVKELLDLQHDY----LNEIISSIHVHMDEHN
NIKR_GEOUR       ELKWEAG---EEETVGTVTLVYNHHVRDLSDKLTEHQHTH----HDQIISALHVHLDAHN
NIKR_GEOMG       ELKWEGG---EEETVGTVTLVYNHHVRDLSDKLTEQQHSH----HNEIVSALHVHLDAHN
NIKR_GEOSL       ELKWEVG---DEETVGTVTLVYDHHVRDLSDKLTEQQHAH----HDKVISALHVHLDAHN
NIKR_PELPD       DVKWENG---EEEMVGTVTLVFNHHVRDLSDKLTEHQHAY----HHQIISALHVHLDAHN
NIKR_CALS4       ENQWEAE---DVETIGTITYVFNHEVREINDKLTDMQHKH----YKNIISTMHVHLDEHN
NIKR_SOLUE       EKTWESP---ESQVVGTVTLVYDHHVRLLNEKLTGIQHDF----HHSILSTLHVHLDHDN
NIKR_SYNAS       KKEWTE----DQEVAGAITYIYDHHQRDLLNKIIDIQHDF----HDVIKSTQHIHLDHDN
NIKR_CHLTE       RKTTAE----GGLVAGAIVMTYDHHKRDLVNRLIDIQHDF----HDLIISTQHVHLDHEN
NIKR_DESPS       LKEWEE----DRDVMGVISLIYDHHQSQLQKKVTDLQHDF----HHHIVSTTHVHMDHDN
NIKR_ANADE       QRAFTESS-GREERVAVVTLVYDHDSSSLAQKLAHIQHEN----HRAVVSALHVHMDAHN
NIKR_METKA       RIEWTERVG-DEEYFGALTYVFQHERA--EPELVKVQHEF----TDVIISTTHIHVSPEK
NIKR_SACS2       ENRDGN-----EIIYGIINLVYDHEEA--SEALTEIQHEY----NDSIISTLHLHVSEKI
                                      :               *              * :     

NIKR_HALSA       CMELFVLEGSLESISTFVGKIRATKDTLTIDYSVLPVDEFGGLADVS-------
NIKR_HALWD       CMELFVLEGSLETISTFVGKIRATKNTLTIDYSVLPVDDFGPLAEMT-------
NIKR_HALMA       CMELFVLEGQLEDISAFVGKVRATKDTLSVDYSVLPVDDINMFT----------
NIKR_NATPD       CMELFILEGELDEISTFVGKVRATSDILSVDYSVVPLDDFEADLAH--------
NIKR1_METTH      CLELFIIEGESMRVRELAERFLACGKMKHIKLVTF-------------------
NIKR_METMP       CMEVVLVKGDAGEIKELTDKLTSQKGVKQVKLTVMVPGGNIPQ-----------
NIKR_METM5       CMEVVLVKGDASEIKELTDKLTSQKGVKQVKLTVMVPGGNIPQ-----------
NIKR_METM7       CMEVVLVKGDASDIKDLTDKLTSQKGVKQVKLTVMVPGGNIPQ-----------
NIKR_METVS       CMEVVLVRGDASNIKELTDKLTSQKGVKQVKLTVMVPGGNIPQ-----------
NIKR_META3       CMEVVIVRGDAKIIRELTDRLTSQKGVKQVKLNVMVPGGNIPE-----------
NIKR_METJA       CLETILVRGDAKRIRELTDRLTALKGVKQVKLSVMVPGGQIPE-----------
NIKR2_METTH      CLEVIVVKGDVAKIRELTEKMMRLKGVEHVRLTSTSTEQKIEHEH---------
NIKR_METAR       CLELIMLQGEGKQVKEVAEKMMALKGVKHVKLTTVSPNTEL-------------
NIKR_METTP       CLEVVILRGEGKDVRRAAERMMALKGVKHVKLTTTSVGAEL-------------
NIKR3_METAC      CFEVIVLDGDGEEIKELAEAIMALKGVKFSKLTTVASNEK----I---------
NIKR2_METMA      CFEVVVLDGDGEEIKELAEAIMSLKGVKFSKLTTVASNEK----I---------
NIKR1_METAC      CFEVVVLNGDGKEIAELSETMMVLKGVKFSKLTTVASNEN----I---------
NIKR1_METMA      CFEIVVLEGEGKEITELAEAIMALKGVKLSKLITTESNETDEPSIVI-------
NIKR_METBU       CLEVIIFDGEGELIKEMDERLMALKGVKYVKLNTAPPAEK----I---------
NIKR2_METAC      CFETIILEGEGEKIVELAEKILSLKGVKHSRLTTMPEVKTE-------------
NIKR3_METMA      CFEVIILRGEGEQIVDLAQRILSIKGVKHLRLTTVPEEKNE-------------
NIKR_ARCFU       CLEMILVKGKMERIKVLVDKISAARGVMNVKLISAVKKV---------------
NIKR_HELPY       CLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEYNE------------
NIKR_HELPJ       CLETIILQGNSLEIQRLQLEIGGLRGVKFAKLTKASSFEYNE------------
NIKR_HELPH       CLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAFSFEYDE------------
NIKR_HELAH       CLETIILKGSSAEVQRLQLEIGGLRGVKFAKLTKASSFESNE------------
NIKR_HELHP       CLETIILRGNGVHIEDLSIEIGGLKGVKFSKLTRASRFE---------------
NIKR_CAMC5       CLETITLRGEAAKIEHFSDRIAGLKGVKFAKLTKAAVPKF--------------
NIKR_CAMC1       CLETISIRGEASKIERFADRIAGLKGVKFSKLTKAAVPKF--------------
NIKR_ECO57       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOL6       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOUT       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOHS       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SHIFL       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOLI       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOLC       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SHIDS       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SHIF8       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOK1       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SHIBS       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECO24       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SHISS       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_ECOL5       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SALTY       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SALCH       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SALTI       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SALPA       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_SALAR       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED---------------
NIKR_CITK8       CLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKEE---------------
NIKR_ENT38       CLEIAVLKGDMGDIQHFADDVIAQRGVRHGHLQCLPDDE---------------
NIKR_KLEP7       CLEIAVLKGDMAEVQHFADDVIAQRGVRHGHLQCLADD----------------
NIKR_BRUO2       CLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRUME       CLEVSILKSKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRUC2       CLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRUSU       CLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRUAB       CLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRUSI       CLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRUA2       CLEVSILKGKTDDVRHFADHVKAERHVTHGTLAVLPL-----------------
NIKR_BRADU       CMEMTALRGAADEVRHFADHIIAERGVRYGRVVMIPTGEGKPAKARKHGHRHE-
NIKR_RHOPA       CLEVTILDGNATELQHFADHIFAERGVRYGRLVTIPAEPPAEGHEHHHEHDASS
NIKR_PSEPK       CLEVSVLQGESGRIGELSRQLMVERGVEHGQVQVIPAPGQPKVR----------
NIKR_DESVV       CLEVLVLKGPGQQVRNLAQRLISTKGVKHGKLSLTTTGQDLT------------
NIKR_DESVH       CLEVLVLKGPGQQVRNLAQRLISTKGVKHGKLSLTTTGQDLT------------
NIKR_DESAG       CLEVLVLKGPAERVRNLAQRLTSTRGVKHGKLSLTTTGQDLA------------
NIKR_PYRHO       CLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKELV------------
NIKR_PYRAB       CLEVIVVKGKAKRIKMIASRLMSLKGVKHGKLVMTSTGKELL------------
NIKR_PYRFU       CLEVIVVKGRAKKIKKIADRLLSLKGVKHGKLVMTTTGRDIV------------
NIKR_THEKO       CLEVVIVKGKAKRIKEIADRLLSLKGVKHGKLVMTGTGKELV------------
NIKR_GEOUR       CLEVLVVRGKAREVKQIADELIGVKGVKHGKLVMTTTGEELH------------
NIKR_GEOMG       CLEVLVVRGKAREVKKIADELIGVKGVKHGKLVMTTTGEELH------------
NIKR_GEOSL       CLEVLVVRGKAREVKKIADELIGVKGVKHGKLVMTTTGEELH------------
NIKR_PELPD       CLEVLVVRGKAREIKKIADELIGVKGVKHGKLVMTATGHDLH------------
NIKR_CALS4       CIEVMIVRGKAKEIVKIADEIISTRGVKHGKLVMTTTGENL-------------
NIKR_SOLUE       CLEVLVVRGRSADVRKVADVLISTKGVKHGRLTITTTGAEMK------------
NIKR_SYNAS       CLEIVAVKGNPTTISKLSNALKAIKGVRHGSLSISGVGQIA-------------
NIKR_CHLTE       CLEVIAVKGNAPEIEKLSSALKVLVGVKHLDLSLSSAD----------------
NIKR_DESPS       CLEVIIVKGRAGDVIELADGLAALKGVRDSNLAMNSTGKSLH------------
NIKR_ANADE       CLEVLVLRGRGKDVVAMGESLVATKGVKYGKLVPATAGHDLR------------
NIKR_METKA       CLEVLLLQGPGKRIAELAKRIRGVRGVEQAKLTVVSSEGE--------------
NIKR_SACS2       CIEAIAVKGEKRKLVELNNKLGQIRGILKARLLISFPYEKT-------------
                 *:*   . .    :      .