CLUSTAL format seed alignment for MF_00478

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNFE_VIBVY        ------------------------MSEH--------KKLLKNGMWDNNPALVQLLGLCPL
RNFE_VIBCH        ------------------------MNEN--------RTLMLNGMWNNNPALVQLLGLCPL
RNFE_ALIF1        ------------------------MASH--------KELVKNGLWDNNPALVQLLGLCPL
RNFE_SHESR        ------------------------MTNY--------REIAWQGLWKNNPGLVQLLGLCPL
RNFE_SHESW        ------------------------MTNY--------REIAWQGLWKNNPGLVQLLGLCPL
RNFE_SHEON        ------------------------MTNY--------REIAWQGLWKNNPGLVQRLGLCPL
RNFE_PSEA6        ------------------------MNEF--------KQLSWQGLWKNNPALVQLLGLCPL
RNFE_YERPB        ------------------------MSEA--------KKLLAQGLWKNNSALVQLLGLCPL
RNFE_YERPE        ------------------------MSEA--------KNLLAQGLWKNNSALVQLLGLCPL
RSXE_SALTY        ------------------------MSEI--------KDIVVQGLWKNNSALVQLLGLCPL
RSXE_SALDC        ------------------------MSEI--------KDIVVQGLWKNNSALVQLLGLCPL
RSXE_SALNS        ------------------------MSEI--------KDIVVQGLWKNNSALVQLLGLCPL
RSXE_ECOLI        ------------------------MSEI--------KDVIVQGLWKNNSALVQLLGLCPL
RSXE_SHIDS        ------------------------MSEI--------KDVIVQGLWKNNSALVQLLGLCPL
RSXE_ECO7I        ------------------------MSEI--------KDVIVQGLWKNNSALVQLLGLCPL
RSXE_SHIF8        ------------------------MSEI--------KDVIVQGLWKNNSALVQLLGLCPL
RSXE_ECO81        ------------------------MSEI--------KDVIVQGLWKNNSALVQLLGLCPL
RNFE_HAEIN        MTDLTEKNTALEEEKIESAVENQQKSIW--------KEIFAQGIWKNNPAVVQLLGLCPL
RNFE_HAEDU        MADNQIPITQIEDGTVK------QPSVW--------RNLLIDGLWKNNGALVQLLGLCPL
RNFE_PSEAB        ------------------------MSEQDF------REIARNGLWRNNPGLVQLLGLCPL
RNFE_PSEAE        ------------------------MSEQDF------REIARNGLWRNNPGLVQLLGLCPL
RNFE_THISH        ------------------------MSDISY------REINANGFWHNNPGLVQLLGLCPL
Q8AA44_BACTN      ------------------------MNNF-KV--------MMNGIIKENPIFVLLLGMCPT
F4KJG2_PORAD      ------------------------MNKYIKT--------ITNGIITENPTFVLLLGMCPT
F9CZP5_PREDD      ------------------------MNHL-QI--------ITNGLVKENPTFVLLLGMCPT
G2T306_ROSHA      ------------------------MNKNVER--------LYNGLIKENPTFVLMLGMCPT
Q8RIJ8_FUSNN      ------------------------MKKL-GV--------LTAGIFKENPVFVLMLGLCPT
D1B8H9_THEAS      ------------------------MASFIER--------IRGGLAKENPVFVQAIGLCPT
A5HYR5_CLOBH      ------------------------MSVLGER--------LKNGIIDENVTFVQVLAMCPT
Q9WY89_THEMA      ------------------------MSRLRE---------LTKGIIKENPTYVQVLGMCPT
D7AR47_THEM3      -------------------------MKLSKI--------FSNGLVKENPIYVQALGMCSV
C1D7I9_LARHH      -----------------MSEADNKAGLAPGT--------FSEGLWRNNPVFVMLLGMCSV
B3QTB4_CHLT3      ------------------------MNEAFNV--------FWRGILKENPVLKMLLGLCPV
B3EJT9_CHLPB      ------------------------MNEALNI--------FTRGFVKENPVTKMLLGLCPV
Q727R0_DESVH      ------------------------MQQIIKE--------FTKGLWQELPPFRLVLGLCPT
C8WYR2_DESRD      ------------------------MASVVQE--------FKKGLWAELPPFRVVLGLCPV
I0GMV4_SELRL      ------------------------MKEHWQI--------FSKGLIAENPIFILALSLCPA
B8E296_DICTD      ------------------------MRNFFKY--------VVNGIFKENPVLILMIGLCSV
B0S410_FINM2      ----------------------MEKGKAAKV--------FKSSILKNNPVLIQLVGLCSV
G8QW80_SPHPG      -----------------------MKGSHLKE--------FTKGFFAENPVFVVVLGLCPV
RNFE_METAC        -----------------MYPHRRADMNPISE--------FIRGITKDNPTFGLVLGLCPT
D5U6T3_BRAM5      -------------------------MKNSQV--------FMEGVWKNNPTFVQVLGMCPS
Q67R09_SYMTH      -------------------MKPSAQSPTFGS--------VLADGLRQAPPFRLLLGLCPS
F5YEE9_TREAZ      -------------------------MKFWKI--------FTNGLVNENPLLVLMIGLCSS
F2NXT6_TRES6      ------------------------MNKQLQI--------FTNGFLKENPLLVLNIGLCSS
RNFE_RHOCA        -------------------MSES-YAKIAR-----------DGLWDKNIVTGQMLALCPT
Q3IXC1_RHOS4      -------------------MSTD-FGKIAR-----------DGLWDKNIVVGQMLALCPT
RNFE_MAGSA        -------------------MSAS-YGRIIK-----------DGLWENNGVLCMLLGMCPT
Q5NLH7_ZYMMO      -------------------MSNNEYFRIAK-----------DGLWDNNGILSMLLGLCPT
RNFE_AZOVD        -------------------MSHCGAPSVPEPEKKVPWQYFTSALWQYNVALVQMLALCPT
RNFE_PSEST        ------------------MSSQCGSADVTAPKPKGLFNYFSSALWDYNVALVQMLALCPA
RNFE_BUCAI        -------------------------MNIKSF--------LNNRLWKNNSSLVQLLGLCPV
RNFE_BUCAP        -------------------------MEFKKF--------FKKRLWNNNSSLVQLLGLCPI
RNFE_BUCBP        ------------------------MSNILKI--------FVDGLWKKNSSLVQLLGLCPV
                                                                        :.:*. 

RNFE_VIBVY        LAVSSTVTNALGLGIATLLVLVGSNVTVSLIRNYVPKEIRIPVFVMIIASLVTCVQLLMN
RNFE_VIBCH        LAVSSTVTNALGLGIATLLVLVGSNVTVSLVRDYVPKEVRIPVFVMIIASLVTCVQLLMN
RNFE_ALIF1        LAVSATVTNALGLGIATILVLVGSNLIVSLVRQWIPQEVRIPVFVMIIASLVTCVQLLMN
RNFE_SHESR        LAVTATLTNALGLGVATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALVTAVQLLIN
RNFE_SHESW        LAVTATITNALGLGVATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALVTTVQLLIN
RNFE_SHEON        LAVTTTLTNALGLGIATMLVLIGSNVLISLVRDYVPKEIRIPVFVMIIAALVTAVQLLVN
RNFE_PSEA6        LAVTATVTNGLGLGLATTLVLIGSNATVSIIRNLVPNEIRIPIFVMIIAAFVTVVQLLMN
RNFE_YERPB        LAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVVSTVQMLIN
RNFE_YERPE        LAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVVSTVQMLIN
RSXE_SALTY        LAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_SALDC        LAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_SALNS        LAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_ECOLI        LAVTSTATNALGLGLATTLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_SHIDS        LAVTSTATNALGLGLATTLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_ECO7I        LAVTSTATNALGLGLATTLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_SHIF8        LAVTSTATNALGLGLATTLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVVSAVQMLIN
RSXE_ECO81        LAVTSTATNALGLGLATTLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVVSAVQMLIN
RNFE_HAEIN        LAVSSTATNALGLGLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTVTAVQLLMN
RNFE_HAEDU        LAVSNSVTNALGLGLATLFVLLCTNVTISLFRQMIPHDIRIPIYVMVIATVVTAVQLLMN
RNFE_PSEAB        LGTSNSTVNALGLGLATMLVLACSNAAVSLVRGAVSEAIRLPAFVMIIAALTTCIELLMQ
RNFE_PSEAE        LGTSNSTVNALGLGLATMLVLACSNAAVSLVRGAVSEAIRLPAFVMIIAVLTTCIELLMQ
RNFE_THISH        LAISGTVVNALGLGLATTLTLVASNVTVSLIRHWVRPEIRIPVFVLIIASVVTAIELAMN
Q8AA44_BACTN      LGTTSSAINGMGMGLATMFVLICSNVVISSIKNLIPDMVRIPSFIVVIASFVTLLQMIMQ
F4KJG2_PORAD      LATTTSAINGLSMGLATTFVLICSNVMISLLKRLIPDAVRIPAFIVVIAGFVTVLQMIIK
F9CZP5_PREDD      LATTTSTVNGLSMGLATMLVLVCTNTVISCIKSVTPDKVRIPVFIVVIAAFVTILQMFMS
G2T306_ROSHA      LAVTSSAINGLGMGLSTTVVLVLSNMLISAFRKVIPDGVRMPAYIVIVASLVTVVQFIMQ
Q8RIJ8_FUSNN      LGVTSSAINGFSMGLAVIAVLACSNGLISLFKKFIPDEVRIPAFIMIIATLVTVVDMVMN
D1B8H9_THEAS      LAVTTSAVNGLGMGVAATAVLMGSNVVISMLRRFIPNQIRIPAFIVVIAGFVTIIQFLVS
A5HYR5_CLOBH      LAVTSSAENGIGMGIASTVVLMGSNLVISLLRKVIPDKIRIPAFIVVIAGFVTLLQFLMQ
Q9WY89_THEMA      LAVTTSAINGLGMGLATTAVLTMSNVVISLIRKIVPDKIRIPIFIVVIASFVTMIDLLMH
D7AR47_THEM3      LAVTTSAINGLAMGLAVTAVLVGSNSVVSLLRKVIPDKIRIPAFIVVIATFVTVVEMFMK
C1D7I9_LARHH      LAVTNSAVNALAMGLSTTFALVASAAMVSGLRRLIPRPVRIATYVVIIATFVTLIDYAIQ
B3QTB4_CHLT3      LAVTTTAINGLGMGLATLFVLLGSNIAVSLFSKIIPSTVRIPAYIVIIATFVTIVDLLIK
B3EJT9_CHLPB      LAVTTTAINGLGMGLATTFVLLGSNVVIALASKAIPSTVRIPSFILVIATFVTIVDLLIQ
Q727R0_DESVH      LAVTKTASNGLGMGLAVIFVLALSNMIISMVRNIIPKKVRIACFIAISASLVVAVELLMQ
C8WYR2_DESRD      LAVTSGVASALGFGCGLLFVITMSSVLVSLLRNVIPDKVRVPVFISIIASGVIIVERVMH
I0GMV4_SELRL      LAVTTTVINGLTMGLTVTFVITTNNVVVSIVRKWVNPKVRVPVYITSIATIVTVAQLVLQ
B8E296_DICTD      LAVSTSVENAIGMGLAFSFVMIFSNLFVSLLRPITPNEIRIPIFIIVIGTFTTIVDLVIS
B0S410_FINM2      LGVSTSVENAIGMTAAFAFVLICSNIVISLLRNFIPDKVRIPAYIVVIATFVTLVSMMLQ
G8QW80_SPHPG      LGVSTQVSNALGMTAGVMFVLLFSNIIISALRNVIPNSIHIPAYIVVIAALVSVTEMVMH
RNFE_METAC        LAVTTSVENGIGMAMGTLFVLVGSNMMVSAIRKGIPGTVRLPVEIIVIATFVTIVDMVME
D5U6T3_BRAM5      LAVTSSVMNAIGMSAATIFVLVCSSALISLIKKIYANEVRIMGYIVVIAAFVTLTDIVMK
Q67R09_SYMTH      LAVTTAMENGFWMGLAVIFVLSCSELIISLLRRVIPDRVRIPVYIVIVATFVTVVDMVMK
F5YEE9_TREAZ      LAVTTNVANGIGMGLSMTFVLMMSELFISLFRKLIPSSVRIPIFIIIIAAFTTIIDYVLQ
F2NXT6_TRES6      LGVTTSIFNGLGMGMSMTFVLLMSELVISVFRKYIPNAIRLPIFIIIIAAFTTIVQFVLQ
RNFE_RHOCA        LAITGTATNGLGMGLATTVVLILSNVVISALRKTIAPEIRIPAFILIIAAIVTVVDLALN
Q3IXC1_RHOS4      LAITGTATNGLGMGLATTAVLILSNAAISALRRAITPEIRIPAFVLVIAAIVTVVDLALN
RNFE_MAGSA        MAMTGTATNGLGMGLATAAVMAASNLMVAMFRNYVTHEVRIPVYILIVAANVTFVDLGMN
Q5NLH7_ZYMMO      MAVTTSATNALGMGLATAAVMAASNLLVSVFRHHITYEVRVPVYILIVAAMVTLVDLVMN
RNFE_AZOVD        LAVTTTATNGLGMGLATTLVLVMTNALISSMRHTISPEVRNPVMIGVIAGVVTLTDMAMN
RNFE_PSEST        LAVTTTATNGLGMGLATTLVLMITNAIISALRHSISPAVRNPLMIGIIAGVVTLIDMAIN
RNFE_BUCAI        LAMTTNAINAIGLGMTTTLVLTITNTIISSFRKIIPKDLRIPIYMMIISSVVTSIEMLLH
RNFE_BUCAP        LAMTTNTINAIGLGITTTFVLTITNSIISILKNFIPKDIRIPIYMIIVSSTVTCIEMLLH
RNFE_BUCBP        LAITVNAINAIGLGLATTLVLICSNATISLIKNNIQKDFRIPIYIIIISSVVSSIDLVIK
                  :. :    ..: :      .:  .   ::         .:    :   .  .   .  : 

RNFE_VIBVY        AYAYG-LYLSLGIFIPLIVTNCIIIGRAEAYASKNDPLPAALDGF-WMGMGMTTVLVVLG
RNFE_VIBCH        AYAYG-LYLSLGIFIPLIVTNCIIIGRAEAFASKNDVLPAALDGF-WMGLGMTSVLVVLG
RNFE_ALIF1        AYAYG-LYLSLGIFIPLIVTNCIIIGRAESFASKNDPLPAVLDGL-WMGMGMTAVLVLLG
RNFE_SHESR        AYAYG-LYLSLGIFLPLIVTNCIIIGRAEAFASRNNAFSAAFDGL-MMGLGFTLVLAVLG
RNFE_SHESW        AYAYG-LYLSLGIFLPLIVTNCIIIGRAEAFASRNNAFSAAFDGL-MMGLGFTLVLAVLG
RNFE_SHEON        AYAYG-LYMSLGIFLPLIVTNCIIIGRAEAFASRNNAFSSAFDGL-MMGLGFTLVLVLLG
RNFE_PSEA6        AYTYE-LYQALGIFIPLIVTNCAIIGRAEAYASKNPIGYAAFDGL-MMGLGFTVVLVLLG
RNFE_YERPB        AYAFG-LYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGLSALDGF-AMGMGATCALFVLG
RNFE_YERPE        AYAFG-LYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGLSALDGF-AMGMGATCALFVLG
RSXE_SALTY        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWLSALDGF-SIGMGATGAMFVLG
RSXE_SALDC        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWLSALDGF-SIGMGATGAMFVLG
RSXE_SALNS        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWLSALDGF-SIGMGATGAMFVLG
RSXE_ECOLI        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPALSALDGF-SIGMGATCAMFVLG
RSXE_SHIDS        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPALSALDGF-SIGMGATCAMFVLG
RSXE_ECO7I        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPALSALDGF-SIGMGATCAMFVLG
RSXE_SHIF8        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPALSALDGF-SIGTGATCAMFVLG
RSXE_ECO81        AYAFG-LYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPALSALDGF-SIGMGATCAMFVLG
RNFE_HAEIN        AYTYT-LYQSLGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGF-SMGLGMALSLTILG
RNFE_HAEDU        AFAYP-VYQSLGIFIPLIVTNCIVIGRAEAYASKHQVHHSAFDGL-ATGLGMTLSLVLLG
RNFE_PSEAB        AWTYE-LYQVLGIFIPLITTNCVILGRAEAFAAKNGVLRASFDGL-LMGLGFALVLLVLG
RNFE_PSEAE        AWTYE-LYQVLGIFIPLITTNCVILGRAEAFAAKNGVLRASFDGL-LMGLGFALVLLVLG
RNFE_THISH        AFFHE-LYLILGIFIPLIVTNCAIIGRAEAFASKQPIPKALADGL-AMGLGFTCVLVALG
Q8AA44_BACTN      AYVPD-LYATLGLFIPLIVVNCIVLGRAEAFAAKNNPLASMFDGI-GMGFGFTIALTLLG
F4KJG2_PORAD      AYLPA-LDQSLGIFIPLIVVNCIVLGRAESTASKSSVGISFFDGV-GIGLGFTIGLTLLG
F9CZP5_PREDD      AYAPDSINKALGIYIPLIVVNCIILGRAESFACKHTPLESFCDGL-GIGLGFTLALTLLG
G2T306_ROSHA      AYTPS-LSESLGVYIPLIVVNCIILGRAESYASKNPVVPSLFDGL-GMGLGFTMGLTLIG
Q8RIJ8_FUSNN      AYTPD-LYKVLGLFIPLIVVNCIVLGRAESFASKNGVIDSILDGI-GSGIGFTLSLTFLG
D1B8H9_THEAS      AYAPV-LDKSLGIFIPLIVVNCIILARAEAFAFKNGVIPSLFDGI-GMGLGFTVALMILG
A5HYR5_CLOBH      GFVPD-LYTKLGIFIPLIVVNCVILGRAEAYASKYGPVSSIFDGL-GQGLGFTLSLGVIG
Q9WY89_THEMA      GFAYD-LWKTLGLFIPLIVVNCIIMGRAESFASKHGVLDSMLDGL-GVGLGFTGSLVLLG
D7AR47_THEM3      AYTPA-LYNALGIFIPLIVVNCIILGRAEAFASKNNLLTSVMDGL-GMGAGYTLAVLILG
C1D7I9_LARHH      VISLA-LYNALGAFIQLIVVNCLILGRAEAHASKNRVWPAVVNAL-GMGLGFTLALLAMG
B3QTB4_CHLT3      AYSPE-LNQSLGLFIPLIVVNCIILGRAEAFASRNGVVHSILDAF-GMGLGFTFALLLLA
B3EJT9_CHLPB      AFSPE-LNQSLGIFIPLIVVNCMILGRAEAFASRNGLWYSIIDAI-GMGLGFTFALLLLS
Q727R0_DESVH      AYAYP-LYQQLGIFVPLIVVNCIILGRAEAFAAKNPVSLSLADGL-GIGLGFTLSLVFLG
C8WYR2_DESRD      AYFYG-IYEILGIWIPLIVVNCLILGRSEAFARKNPVHLAAADAL-GMGTGFTLSLVVLS
I0GMV4_SELRL      AYFPV-LYKAMGIYLALVVVFAIILARAEVFASKNGVFKSFLDGF-GMGCGFTLAMLTIA
B8E296_DICTD      AYFPE-LYKALGIFIPLIVVNCIIIGRAEAFAYRHSVLESVADGI-GISLGYIWAIVALG
B0S410_FINM2      AFVPA-LYSSLGAFVPLIVVNCIILARAESFASKNGVFLSLLDGI-SNALGYGIVIVLVA
G8QW80_SPHPG      AYVPA-VYQALGVYLPLIVVNCIILGRAEAFASKNTMLDSALDAL-GMGLGFGLGITLIA
RNFE_METAC        AFTPD-LYTSLGVFIPLIVVNCIVIGRAEAYALKNGVFYSIIDAL-GEGTGFLLVLILIG
D5U6T3_BRAM5      AKFYT-LSLALGPYIPLIVVNCIILGRAEAFANKNGIIPSIFDAL-GNGVGFFIALTLLA
Q67R09_SYMTH      AYLPE-MHAILGIFIPLIVVNCIILGRAEAFASKNGPLLSVADAV-GVGLGFTASLMAIG
F5YEE9_TREAZ      AYFPD-LSASMGLFIPLIVVNCIIMGRVEAFASQQPIIDVIPDGL-GMGLGYTWVLVAIS
F2NXT6_TRES6      AYVES-LYDALGVFLPLIVVNCIIMGRVESFASKNNVGNSILDAL-GMGIGYTCVLVVIS
RNFE_RHOCA        AWLHD-LHKVLGLFIALIVTNCAILGRAEAFASRFGVLASALDGL-MMGIGFTLALVVVG
Q3IXC1_RHOS4      AWVHD-LHKVLGLFIALIVTNCAILGRAEAFASRHGILASAFDGL-TMGVGFTLALVLVG
RNFE_MAGSA        AWMHE-LYKVLGLFIPLIVSNCLPLARLEAFAAKEPVLPSFLDGL-FMGLGFTLALTAIG
Q5NLH7_ZYMMO      AYMHP-LYKVLGLFIPLIVSNCLPLAHLEAFAGKKPPLASLTDGV-FAGLGFTFALTIIG
RNFE_AZOVD        AWMHE-LYKVLGLFIALIVTNCAVLGRAESFCLRNPVIPSILDGA-GMGAGFTAVLVVIG
RNFE_PSEST        AWMHE-LYKVLGLFIALIVTNCAVLGRAESFCSRNPVLPSILDGRRAWASGFTWVLVVIG
RNFE_BUCAI        AYTFN-LYQSLGIFIPLIVTNCIIVGRADLIAYKSSIVESFFDGI-FIGLGSMFAMFAVG
RNFE_BUCAP        AYQFN-LYQSLGVFIPLIVTNCIVVGRADCIAYKSSFVISFLDGM-SIGLGSTFAMFVIG
RNFE_BUCBP        AYAFN-LYQSLGIFIPLIITNCIVCNRADLIAVHNSVLVSILDGL-SIGLGSTLTMFLLG
                        :   :* :: *:   .    : :  . :        :.    . *    :  :.

RNFE_VIBVY        AMREIIGNGTLFDG-------ADLLLGEWASALRIQVFQFDSSFLLALLPPGAFIGVGLL
RNFE_VIBCH        SLREIIGNGTLFDG-------ADLLLGEWAKVLRIEVFHFDSAFLLALLPPGAFIGVGFL
RNFE_ALIF1        AMREILGNGTLFDG-------ADLLLGDWATMLRIELFHVDSHFLLAMLPPGAFLGVGFL
RNFE_SHESR        ATREILGQGTLFDG-------ADQLLGPWAKALTIQVWQVDTPFLLAMLPPGAFIVMGLL
RNFE_SHESW        ATRELLGQGTLFDG-------ADQLLGPWAKSLTIHVWQVDTPFLLAMLPPGAFIVMGLL
RNFE_SHEON        ATREILGQGTLFDG-------ADQLLGPWAKALTFQVWQVDTSFLLAMLPPGAFIVMGLL
RNFE_PSEA6        AMRELLGYGTLFAG-------ANLLLGDWATSLKVTIFTTDSPFLLAILPPGAFLGMGLL
RNFE_YERPB        ALREILGNGTLFDG-------ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLL
RNFE_YERPE        ALREILGNGTLFDG-------ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLL
RSXE_SALTY        SLREILGNGTLFDG-------ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLM
RSXE_SALDC        SLREILGNGTLFDG-------ADSLLGGWAKVLRVEIFHTDSPFLLARLPPGAFIGLGLM
RSXE_SALNS        SLREILGNGTLFDG-------ADSLLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLM
RSXE_ECOLI        SLREIIGNGTLFDG-------ADALLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLM
RSXE_SHIDS        SLREIIGNGTLFDG-------ADALLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLM
RSXE_ECO7I        SLREIIGNGTLFDG-------ADALLGSWAKVLRLEIFHTDSPFLLAMLPPSAFIGLGLM
RSXE_SHIF8        SLREIIGNGTLFDG-------ADALLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLM
RSXE_ECO81        SLREIIGNGTLFDG-------ADALLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLM
RNFE_HAEIN        ALREIIGQGTIFEG-------IENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGLL
RNFE_HAEDU        AIRELIGNGTLFDG-------LDLLFGDWAKVLRLDLLQLDSGLLLAILPPGAFIGLGLI
RNFE_PSEAB        GLRELLGQGTLLAD-------MHLLFGPAAADWKIQPFPQYQGFLLAILPPGAFIMLGLL
RNFE_PSEAE        GLRELLGQGTLLAD-------MHLLFGPAAADWKIQPFPQYQGFLLAILPPGAFIMLGLL
RNFE_THISH        ALREAVGHGTLLAD-------AHLMFGEAARGFSLTLFEEYRGFLLALLPPGAFIALGLL
Q8AA44_BACTN      AVREFLGTGKI------------------FNLTILPEE---YGMLIFVLAPGAFIALGYL
F4KJG2_PORAD      IVREMLGGGSF------------------FGLSAYPND---FSALLFVLPPGAFIALGLL
F9CZP5_PREDD      AMREILGAGSL------------------FGFQLLPET---TNILLFVLPPGAFLSLGFL
G2T306_ROSHA      LFRELLGAGQI------------------FGFQILSLSW-FTPITIFVMAPGAFLVLACL
Q8RIJ8_FUSNN      SVREILGNGSV------------------FGISLVPAN--FTPALIFILAPGGFITIGII
D1B8H9_THEAS      SIREIIGAGTL------------------FGFHVLPGYVQ--PALVMILAPGGFLTMGLI
A5HYR5_CLOBH      MIRELLGAGQL------------------FGHQIMPSSFQ--PALIMILAPGAFFTLGIL
Q9WY89_THEMA      SVRELFGNGTI------------------FGYKVWELKI-----FLEILPPGAYITLGLL
D7AR47_THEM3      SIREILGSGSL------------------FGIQLFGASF--EPALIFIMPPGAFIVLGIL
C1D7I9_LARHH      TVREILGSGSL------------------FGVRLFGESF--APWVIMVLPPGGFFVLGGW
B3QTB4_CHLT3      TVREVLGAGTL------------------FNIPLAGDEP--TPLLVFALPPGAFAGLGLI
B3EJT9_CHLPB      IFREVLGAGTI------------------FNIPLVGEDA--STILVFALPPGAFAGLGLI
Q727R0_DESVH      GIRELFGTGML------------------FGTQVMWQGY--QPFGIMVEAPGAFICLGLT
C8WYR2_DESRD      SFREIVGAGTW------------------FGAQVMPGWY--LGFEFLVRPPGAFVCLGIM
I0GMV4_SELRL      VIRELIGAGTI------------------LGVPVFGEGY--NPMLMMILPPGAFILIGYL
B8E296_DICTD      LIREFLGNGTI------------------LGKVIFSGF---DPAKVFTMPPGAFWGIGLL
B0S410_FINM2      FIRELLGSGKI------------------LGKLVIGDI---PPIGIMSAAPGAFIVLGIL
G8QW80_SPHPG      LIRELMGSGTIT----------LFPVGDFLGVINVPWFHE-NPIRVMTLAPGALLLMGYL
RNFE_METAC        GIRELLGTG--------------IIDPFGMTLINLSGVI--NPAMFMTMSPGAFLTIAVL
D5U6T3_BRAM5      SIREILGNGTWLGFDIVGSIRGFVESAMPFALNAYNEIT--TPWVVMIMAPGAFFTLGTL
Q67R09_SYMTH      GVRELLGTGNLK----------------LFGVALLGPGLP-LEVVVMLLPAGAFFVIGFL
F5YEE9_TREAZ      LVREILGNGSIL-------------GYNVLGSGYTP-------ILFFALPPGGFLVFGLF
F2NXT6_TRES6      LVREFFGGGTLM-------------AGTSVKLELIPEAY---RIGILNSAPGGFIVFGLL
RNFE_RHOCA        AIREILGSGTLFA-------QASLLLGPHFAFMELQIFPDYPGFLIMILPPGGFLVVGGL
Q3IXC1_RHOS4      AVRELVGSGTLFA-------QASVLLGPHFAFMELTILPDYPGFLIAILPPGGFILLGVI
RNFE_MAGSA        AVREMIGQGTLFA-------DAALLLGPWAKLLELRVMPADWGILVLILPPGGFLIAGLM
Q5NLH7_ZYMMO      GLREIIGSGTLFA-------NAALLLGSSFRFLECHLLPTDCHILMMVLPPGGFLVTGFV
RNFE_AZOVD        GIREILGSGTLFS-------QASSLLGSHFKWMEITVIPDFQGILLAILPPGAFIVLGFL
RNFE_PSEST        GIREILGQRARCSP------RPRLLLGEHFRWLEITVLPGFQGILLAILPPGAFIVLGFV
RNFE_BUCAI        SIREILGNGTLFFG-------ANKIISNIHSSVFFTLLDKKFTIILAVFPPGGFLILGFL
RNFE_BUCAP        SIREILGNGTFLFG-------ANKIFNVLDHSFFFTFIDKNSTIILAMLPSGGFLVLGFV
RNFE_BUCBP        SIREIIGHGTLFFG-------IEHVLGESFRFLYIEVLDKNSVFLLFAFPSGAFMILGIV
                    ** .*                                      .   ....    .  

RNFE_VIBVY        IALKNVIDTQLKARQPKQ-EKPAIERARVTNA---------------------
RNFE_VIBCH        IAAKSVIDKQTAARQPKQ-QKQAIERARVTNV---------------------
RNFE_ALIF1        IALKNVIDKKMADRQPK--EKAEIERARIS-----------------------
RNFE_SHESR        IALKNVIDKKLKERQPEAAVQPSVTRARITKVS--------------------
RNFE_SHESW        IALKNVIDKKLKEHQPQVATEPSVTRARITKVS--------------------
RNFE_SHEON        IALKNVIDKKLRERQPETAVQPSVARARITKVS--------------------
RNFE_PSEA6        IAAKNILDKRFERMFAAKQEAKVVQRARVTAET--------------------
RNFE_YERPB        LAGKYVIDEKMKARKANTRVNVPQLQDGDAEKAL-------------------
RNFE_YERPE        LAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL-------------------
RSXE_SALTY        LAVKYLIDEKMKKRRAETAPS--AVPAGETGKV--------------------
RSXE_SALDC        LAVKYLIDEKMKKRRAETAPS--AVPAGETGKV--------------------
RSXE_SALNS        LAVKYLIDEKMKKRRAETAPS--AVPAGETGKV--------------------
RSXE_ECOLI        LAGKYLIDERMKKRRAEAAAER-ALPNGETGNV--------------------
RSXE_SHIDS        LAGKYLIDERMKKRRAEAAAER-ALPNGETGNV--------------------
RSXE_ECO7I        LAGKYLIDERMKKRRAEAAAER-ALPNGETGNV--------------------
RSXE_SHIF8        LAGKYLIDERMKKRRAEAAAER-ALPNGETGNV--------------------
RSXE_ECO81        LAGKYLIDEKMKKRRTEAAAER-ALPNGETGNV--------------------
RNFE_HAEIN        LAIKNRIDNIKK-----------------------------------------
RNFE_HAEDU        LAVKNLFDHK-------------------------------------------
RNFE_PSEAB        IALKNRIDESLAERAKVQAGDVPATQRQR--VRVTGVIE--------------
RNFE_PSEAE        IALKNRIDESLAERAKVQAGDVPATQRQRQRVRVTGVIE--------------
RNFE_THISH        IALKNIIDARLQKRQPAQAA-VPVEAAG-------------------------
Q8AA44_BACTN      IAIINSLKKA-------------------------------------------
F4KJG2_PORAD      IGIYHAITKKQ------------------------------------------
F9CZP5_PREDD      VAIFNKVRAN-------------------------------------------
G2T306_ROSHA      VAVMKIVREKMAAKGKPLAEPSGCITGDCAGCSMSAACTGKKPAAETPAEKAE
Q8RIJ8_FUSNN      MACINMKKERDAKKKKVTKK---------------------------------
D1B8H9_THEAS      MGFLNYRRDLARRRRPGGTDLIDADSDADRLEKQTACAGCQICSVLRTEDDGR
A5HYR5_CLOBH      MAIINNMKLKKAK----------------------------------------
Q9WY89_THEMA      SALFTYIGIRRKKRGEAK-----------------------------------
D7AR47_THEM3      IGLFNHARRRKEVSETGTKEEVLDEYIYNID----------------------
C1D7I9_LARHH      LLLFSIIKHRRQARQQQLEVQHVH-----------------------------
B3QTB4_CHLT3      IAGMNALEKRKAA----------------------------------------
B3EJT9_CHLPB      IAGLNSLEKKMGDKK--------------------------------------
Q727R0_DESVH      LAAMNVINTWQARRKGLEAPENPQSGCAACRACAGIK----------------
C8WYR2_DESRD      LGLINVISARLDARKTA------------------------------------
I0GMV4_SELRL      VAACKTWNAKQEEKARIAELKAGKEA---------------------------
B8E296_DICTD      IGLLKWFEKRVSRR---------------------------------------
B0S410_FINM2      LATYNSFLSRQERKKNNMRGED-------------------------------
G8QW80_SPHPG      KAFFDWNTSRKKGK---------------------------------------
RNFE_METAC        MTIVNYRRQQKAAKGG-------------------------------------
D5U6T3_BRAM5      IAIKRAIDARGGKANG-------------------------------------
Q67R09_SYMTH      MAGLAWLQQRQEARGRRDRPASGSGSTAGAGTVSGGEEAAV------------
F5YEE9_TREAZ      MSFGLFLRSRISSNTVDQNKAGCH-----------------------------
F2NXT6_TRES6      GAAVQALKNKKEAAK--------------------------------------
RNFE_RHOCA        FALKRIIDARKPTIEQEIKQMRTERVFTAAGVLKPKL-ETGEEA---------
Q3IXC1_RHOS4      LALKSIVDSRKKSLEQEIRDLRVERVFTAAGVLTPRLQEAGDDA---------
RNFE_MAGSA        VVAKRLVDLAG---GKEIKMAGAHSV---------------------------
Q5NLH7_ZYMMO      LVGKRMIDVAQ---GKEISMSGAHGA---------------------------
RNFE_AZOVD        LAAKRVIDRKR--AERRQQTHGELVVLQ-------------------------
RNFE_PSEST        LAFKRVVDRRR--AERRIRTHGELVVLQ-------------------------
RNFE_BUCAI        IAIKNFIDLYYKKNTIKNIEQCSCSNKIK------------------------
RNFE_BUCAP        IAFKNYLDLG-KKNCLKCFHSCKLKK---------------------------
RNFE_BUCBP        LAGKNFLDEVLGIIEHKNVCVCSNKVLVYKDGNKKIESQKSL-----------