CLUSTAL format seed alignment for MF_00480_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RR7_CHLRE       MPRRPINKK--RTLLPDPVYNSV---------SVHMLVNRVLKSGKKSVAYRIVYNALKE
RR7_TETOB       MPRRPIQKK--RSVLPDPIYNSI---------SVHMLVNRVMKNGKKSLAYKIVYNTLKN
RR7_STIHE       MARKGAPKK--RLLLPDPIYNKV---------SVHMLVNRILKNGKKSIAYRIVYSVFRK
RR7_JASNU       MSRRGTAEE--KTAKSDPFYRNR---------LVNMLINRILKHGKKSLAYQLLYRTLKE
RR7_PELHO       MSRRGPAEK--KTVKRDPFYRNR---------VVNMLINRILKHGKKSLAYKILYRAMKK
RR7_ORYSJ       MSRRGTAEK--RTAKSDPIFRNR---------LVNMVVNRIMKDGKKSLAYQILYRAVKK
RR7_PHYPA       MSRRSIIEK--KTIKSDPIYRNR---------LVNMMVNRILKNGKKSLAYRIFYKAMKN
RR7_ANTAG       MSRRGTTEK--QIEKPDPIYRNR---------LVNLLVNRILRNGKKSLAYRILYGAMRN
RR7_HUPLU       MSRR-------DDTKADPIYRNR---------LVNMLVNRILKHGKKSLAYRILYNAMMN
RR7_ANGEV       MSRRSTAAG--ETAKSDPIYRNR---------LVNMLVNRLLKDGKKSLAYRILYQAMKQ
RR7_CHAGL       MSRRKNAEK--RIVNPDPVYRNR---------LVNMLVNRILKNGKKSLAYRILYKAMKN
RR7_ZYGCR       MSRRGTAEK--RPAMPDPIYQNR---------LVNMLVNRIVKNGKKSLAYSILYKAMKD
RR7_STAPU       MSRRSTNEG--RLTRPNPVYRNR---------LVNMLVNIILKNGKKSVAYRILHEAMKT
RR7_CRYJA       MSRQSTVEK--KIEKFDPIYHNR---------LVNMVVNRILKHGKKSLAYRIFYQSLKK
RR7_GNEPA       MSRRNTAKKTKRADKFDPIYQNR---------LVNMVLNRIIKHGKKSLAYRILYRAMKQ
RR7_ADICA       -----MNEI--RNIESDPIYRNR---------LANMLVDRILKNGKKSLAYQIFYQAMKR
RR7_ANEMR       MSRENATEE--KTTKPDPIYRNR---------LISMLVNRILRNGKKSLAHRILYGAMSS
RR7_PSINU       MSRQSETKK--RTAKSDPIYRNR---------SVSMFINHILKDGEKSLAHKILYRAMKQ
RR7_CHAVU       MSRRKIPIK--RSPKPDSIYRSR---------LVNMMVNRILKNGKKSLASHILYNAMKE
RR7_CHLAT       MSRRNAPKK--RPISSDPIYRSR---------LVSMVISHILKNGKKSLAHRILYQAMKN
RR7_NEPOL       MSRRNTAVK--RSISSDPVYNSQ---------LIHMMISHILKEGKKALAYRLMYDAMKR
RR7_OSTTA       MSRRTVAKK--RPVAPDPVYQSR---------LVSLLVSHLLKKGKKSIAYNIFYAAMKN
RR7_OLTVI       MSRRRQNKP--RVITPDPTYDSR---------LVHMFVNRIMKDGKKSVAYRLFYEAINE
RR7_TUPAK       MSRRRRAKK--RIICPDSIYDSR---------LINMLVNRVMKDGKKSLAYKIVYQTMDQ
RR7_CHLVU       MSRRRTQKK--RIVMPDPVYDSR---------LVELLVRQLMREGKKSLAYRICYESMNR
RR7_PLETE       MSRRRTPKK--RVIAPDALYNSV---------LVHTIVNHLMKKGKKSLAYMMFYETLSE
RS7_TREDE       MGRGK-ITA-RRPVAPDSKYNSV---------VVTRFIGRMMLSGKKSITTKIMYDSFDK
RS7_TREPA       MGRKR-RVS-RRVPPPDARYNSV---------VLAKFICRMMLAGKKATAVGIMYDCLER
RS7_BORBU       MSRKN-KKI-KKKVFVDTRYNSR---------IVAKFANRMMYDGKKSISESILYSSIDL
RS7_CHLPN       MSRRH-SAE-KRDIPGDPIYGSV---------ILEKFINKVMMHGKKSVARKIVYSALER
RS7_PARUW       MSRRH-SAE-KRPTEPDPLYGST---------VLSKFINKVMESGKKSTARRIVYNAIEK
RS7_RHOBA       MGRIT-SS--RSQLIGDPRHHSL---------LASKFINCLMLDGKKTTAQRVFYDALEE
RS7_DEHM1       MPRRA-RKF-KRAVAPDSRYNSL---------MLSNFINKLMMHGQKATAQRIVYDAIDI
RS7_PORGI       MRKAK-PK--KRQILPDPVYGDV---------RVTKFVNHLMYDGKKNTAFSIFYGALDI
RS7_CYTH3       MRKAK-PK--KRYLLPDPKFSDT---------MVTKFVNSLMYDGKKSTAYSIFYDAVAL
RS7_GRAFK       MRKRQ-AK--KRPLLPDPKFNDQ---------LVTRFVNMMMWDGKKSVAFKIFYDAIAI
RS7_SULMW       MRKLK-SK--RKNYQPDPIYQDT---------LVTRFVNHLMKDGKKTIAYRIFYNCISE
RS7_CHLCH       MSKLR-S---YKKIGGDYRYGDE---------SVARFINAVMLDGKKAVATKIVYDAFSI
RS7_CHLTE       MAKKG-SG--YGPRGGDFRYNDE---------AVARLINAIMLDGKKVVATKIVYDAFDI
RS7_SALRD       MSRNE-APE-QRTTQPDPVYRDD---------MVSRFVNAIMRDGKKSLARRIVYDTFDV
RS7_ECOLI       MPRRR-VIG-QRKILPDPKFGSE---------LLAKFVNILMVDGKKSTAESIVYSALET
RS7_BUCAP       MPRRR-IIS-TRKILPDPKFSSE---------LLAKFINILMVDGKKSIAEVIVYTALKN
RS7_BUCBP       MPRRR-GIG-HRKILSDPKFSSE---------MVAKLINIIMVDGKKSIAEEIVYQALTM
RS7_BUCCC       MPRRR-IIG-QRKILPDPKFSSE---------LLAKFINILMINGKKSIAENIVYSALHQ
RS7_BAUCH       MPRRR-LIG-QRKILPDPKLGSE---------RLAKFINILMKNGKKSLAETIVYSALEI
RS7_WIGBR       MPRRK-MVN-QRAILPDPKWNSE---------ILSKFINILMVNGKKSISEKIIYTALNN
RS7_BLOFL       MSRRR-VTV-KRVILADPRFKSD---------LLSKFINILMFNGKKSVAESIIYSALDM
RS7_BLOPB       MPRRR-IVT-KRNILPDPRFGSD---------LLAKFINILMLNGKKSTAESIVYSALDS
RS7_PHOPR       MPRRR-VIG-QRKILSDPKFGSD---------LLAKFVNILMVDGKKSTAEKIVYTALDT
RS7_SHESH       MPRRR-VVG-QRKILPDPKFNSE---------LLAKFINVIMQDGKKSTAEKIIYKALDT
RS7_PSYIN       MPRRR-VVG-TRKILPDPKFGSE---------VLAKFVNVVMVDGKKSIAEKIVYGALEA
RS7_PSEPF       MPRRR-VAA-KREILDDPKYGSQ---------ILAKFMNHVMESGKKAVAERIVYGALET
RS7_MARMS       MPRRR-VVA-KREILPDPKHGSQ---------ILAKFINHVMVSGKKSVAESIVYNALNT
RS7_ALCBS       MPRRR-VVA-KREILPDPKFGSQ---------ILAKFMNHVMVSGKKSVSERIVYGALDI
RS7_MARHV       MPRRR-VAA-KREIIPDPKFGSA---------RLAKFINHVMESGKKSVAERIVYGALDI
RS7_CHRSD       MPRRK-VVA-KREILPDPKFGSE---------RLAKFMNHLMVSGKKSVAERIVYGALDK
RS7_SACD2       MPRRR-VVA-KREVLPDPKFGSS---------TLAKFMNHVMISGKKSTAEKIVYGALDI
RS7_PSYWF       MPRRR-VVA-TREILPDPKFGSQ---------TIAKFINHVMVDGKKSTAERIVYGALEQ
RS7_NITOC       MPRKR-VIA-RREVLPDPKYGSV---------QLAKFITILMLSGKKSLAERIIYGALGR
RS7_LEGPH       MPRRR-EVP-KREILPDPKHHSE---------LLAKFINVLMVSGKKSIAEKITYGALSV
RS7_HYDCU       MARRR-EIP-KRQVLPDPKFGDT---------TLTKFVNMIMVSGKKAVAEKIVYDALDV
RS7_COXBR       MARRK-AAP-KRETLPDPLFHSE---------LLAKFINAVMRNGKKSVAEKIVYGALDV
RS7_DICNV       MSRRV-RAP-IRHILPDPKFGNV---------MVAKFVNMLMVDGKKSVAEKVVYQALET
RS7_FRAP2       MSRRN-RAP-KRDILPDPKFKSQ---------VVAKFVNHIMLDGKKSIAEKIVYGAFDK
RS7_XYLFT       MSRKG-STP-QRNVLPDPKYGSE---------TIARFINMVMKSGKKSVAEKIVYGAMNV
RS7_METCA       MSRRR-RSE-RREVIADPRFGSE---------TLARFVNMLMVSGKKSIAEKIVYGALDH
RS7_METPP       MPRRR-EVP-KREILPDPKFGNV---------DLSKFMNVIMESGKKAVAERIIYGALET
RS7_JANMA       MPRRR-EVP-KREILPDPKFGNV---------DVAKFVNVLMLSGKKSVAENIIYGAFEH
RS7_POLAQ       MPRRR-EVP-KREILPDPKFGNV---------EVAKFMNVLMLDGKKSVAERIVYGAFDH
RS7_AROAE       MPRRR-EVP-KREILPDPKFGSQ---------DVSKFINVIMQAGKKSVAERIVYGAFAQ
RS7_DECAR       MPRRR-EVP-KRDILPDPKFGNV---------EVSKFVNAIMQSGKKSVAERIVYGAFDI
RS7_NITMU       MPRRR-EVP-KREILPDPKYHNA---------EVAKFVNVLMTRGKKSVAERIIYGAMDQ
RS7_METFK       MPRRR-EVP-KRNILPDPKFGSQ---------EVSKFVNVLMTGGKKSVAERILYGAFDQ
RS7_CHRVO       MPRRR-EVP-KREILPDPKFGSQ---------DLSKFMNVVMIDGKKSVAERIIYGALEQ
RS7_BORA1       MPRRR-EVP-KREILPDPKFGSV---------ELAKFMNVVMLDGKKAVAERIVYGALAQ
RS7_HALHL       MPRRR-EVP-KRKVLPDPKYGSE---------VLTKFVNMVMSDGKRSVAERILYGALER
RS7_CHESB       MSRRH-RAE-KREINPDPKFGDT---------VVTKFMNAIMFEGKKSVAERIVYGALDQ
RS7_MARMM       MSRRH-RAE-KREIFPDPKFGDR---------DLTKFMNYIMLDGKKSVAERIVYGALEI
RS7_RHOP5       MSRRH-AAE-KREVLPDPKFGNI---------VITKFMNSVMYAGKKSVAETIVYGALGL
RS7_HYPNA       MSRRH-SAE-KREVLPDPKFKDI---------IVTKFMNQIMRDGKKSVAERIVYGAFDL
RS7_AZOC5       MSRRH-KAE-RREVIPDAKFGNI---------IVSRFMNSIMRDGKKSVAESIVYGALDV
RS7_CAUSK       MSRRR-RAE-KRQVLPDPKFGDL---------IVTKFMNYVMYEGKKAVAENIIYGAFDI
RS7_PARL1       MSRRH-RAE-KRDVIPDAKYGDV---------ILAKFMNSLMYHGKKSAAETIIYGAFDQ
RS7_MAGSA       MSRRH-AAE-KREITPDAKFHDY---------VVAKFMNCLMLDGKKSAAEAIVYGALDK
RS7_RHORT       MSRRR-AAE-KREVLPDAKFGDL---------VLAKFINSVMLQGKKAVAEKIVYGAFER
RS7_PARDP       MSRRH-AAE-KREVLPDAKYGDR---------VLTKFMNNLMIDGKKSVAERIVYNALDR
RS7_ZYMMO       MARRR-RPE-KREILPDPKYGDV---------VLSKFMNSVMLDGKKSVAERILYSALDS
RS7_ACICJ       MSRRH-SAV-KREVLPDPKFGDV---------VISRFMNVLMYDGKKSVAESIVYGALDS
RS7_MYXXD       MPRRR-VVA-KRKILPDPKFQDR---------LVTKFVNDLMRKGKKSIAEGVCYGAFAL
RS7_SORC5       MPRRR-EVP-KRKIIPDPKYKDK---------LVAKFTNSLMQSGKKATAEGILYGAFDI
RS7_PELCD       MPRRR-EVA-KRVILPDPKYNDR---------TVAKFINAIMLMGKKSTAEGIVYGAFDL
RS7_GEOUR       MPRRR-EVA-KRVILPDPKYGDR---------VVAKLVNIIMLDGKKSTAEKALYGALEL
RS7_PELPD       MPRRR-EVP-KRNILPDPKFHDK---------TVAKLINVLMLAGKKSIAESILYGALDI
RS7_SYNAS       MPRRR-EIA-KRVILPDPKYKNI---------LVAKFVNNLLKEGKKSIAESILYGAFDL
RS7_SYNFM       MPRRR-EVP-KRYVLPDPKYNSK---------LAAKFINNLMRRGKKSLAEHVLYGALDL
RS7_MAGMM       MSRRR-EVP-KREVIPDARYNDK---------LVAKFMNCLMVDGKKSLAERVFYGAFDL
RS7_DESPS       MSRRK-TIE-KRPVTPDPRFNSV---------LVAKFTNGLMERGKKSLAQRIFYDAMDL
RS7_LEPIC       MSRRRGKVE-PRKITPDPVYNDV---------QVAKFINCLMLSGKKSVAEQLFYDALEI
RS7_BDEBA       MSRRK-KTF-KREIIPDPVFKDL---------VIAKFINKMMIQGRKATSQKLFYGALKE
RS7_LAWIP       MPRKG-PVP-RREVLPDPIYNSR---------LASRFVNRLMYDGKKGVAEKIFYGALEN
RS7_DESAG       MPRKG-PIP-RREVLPDPVYNSR---------LAARFVNRMMVDGKKGAAEKIFYKSLEV
RS7_KORVE       MPRKG-HIA-KREPLADPVYGST---------LANKFVNSMMWDGKKSTAQGIFYEAMKK
RS7_SOLUE       MPRRR-RAV-IREVAPDAIYNST---------LVEKFVNSMMWQGKKNTAQGIFYDAMDK
RS7_THEP1       -MRRR-RAE-IRQVPPDPVYGDV---------LVAKLINKVMWDGKKTTAQKIVYGAFDI
RS7_THEM4       -MRRR-RAE-IRKVPPDPIYNDV---------LVSKLINRVMWDGKKSIAQKIVYKAMEI
RS7_PSELT       -MRRR-RAE-VRKIAPDPVYSDI---------LVAKLVNRIMWDGKKAVAQKIVYRSFEY
RS7_FERNB       -MRRR-RAE-PRVVSPDPVYGEV---------LVTRMVNKIMWDGKKSIAQKIVYGAIDI
RS7_PETMO       -MRRR-TAE-KRNIVPDPIYGDI---------LLSKFINRLMYDGKKSLAQQIVYSALER
RS7_DEIRA       MARRR-RAE-VRPVQPDLVYQDV---------LVSAMINRIMRDGKKNLASRIFYGACRL
RS7_THET8       MARRR-RAE-VRQLQPDLVYGDV---------LVTAFINKIMRDGKKNLAARIFYDACKI
RS7_HELHP       -MRRR-KAP-VREVLGDPIYNNK---------VVTKFINKMMLDGKKSVSEKIIYAAFDK
RS7_ARCB4       -MRRR-KAP-VREIMADPIYNSK---------VITKFVNAIMLDGKKSVAEKILYGAIAN
RS7_SULNB       -MRRR-KAP-VRPVLPDPVYGSK---------VLTKFINAVMLDGKKSTAQKVMYSALER
RS7_SULDN       -MRRR-KAP-VREIMPDPVYGSK---------VLTKFINKIMFDGKKSTAEKIIYSAMDI
RS7_NITSB       -MRRR-RAP-IREVMPDPIYGSK---------VVTKFINKLMWDGKKSTAQKIFYNALKL
RS7_CAMHC       -MRRR-KAL-VREVLPDPIYGNK---------VITKFINSLMYDGKKSIATKIMYGAINL
RS7_FUSNN       MSRRR-AAV-KRDVLPDSRYSDK---------VVTKVINSIMLDGKKSIAEGIFYSAMDL
RS7_KINRD       MPRKG-PAP-KRPLVVDPVYQSP---------LVTQLVNKILLDGKKSVAESIVYGALEG
RS7_NOCSJ       MPRKG-PAP-KRPIDIDPVYGSQ---------LVSQLVSKVLQDGKKQVAQRIVYTALEG
RS7_CUTAK       MPRKG-PAP-KRPVMVDPVYGSP---------LVSQLVSKILLDGKKTVAQNIVYTALEG
RS7_CORJK       MPRKG-PAP-SRQLVKDPVYGDV---------LVSQLVNKVLLDGKKSTAERIVYGALEQ
RS7_THEFY       MPRKG-PAP-KRQLMTDPVYGSP---------LVTALINKVLRDGKRSLAQSIVYNALEG
RS7_ACIC1       MPRKG-PAP-KRPIVSDPVYGSP---------LVTALINKVLQRGKRSLAERIVYNALEG
RS7_RENSM       MPRKG-PAP-KRPLVLDPVYGSP---------LVTQLINKILVDGKKSTAERIVYGALEG
RS7_STRCO       MPRKG-PAP-KRPVIIDPVYGSP---------LVTSLINKVLLNGKRSTAERIVYGAMEG
RS7_LEIXX       MPRKG-PAP-KRPVVADPVYGSP---------VVSQLVNKILLDGKKGLAERIVYDALEG
RS7_BIFLO       MSRKG-PSK-KHVVLPDPIYGST---------VVAQLINKILLDGKKSIAEDIVYSALDM
RS7_TROWT       MPRKG-PVV-RREIPEDPVYSSR---------VVSQLIGRVLLSGKKSLAQRIVYSALDK
RS7_RUBXD       MPRRG-APP-KREIPPDPVYGSV---------LVQQLINKVMKDGKKSKAEKIVYNALSM
RS7B_AQUAE      MPRKG-PVP-PREIPPDPKYGDV---------LVQKLINKVMKDGKKSVAEWIVYTALEE
RS7_CHLAA       MPRRG-NIE-RRPIPPDARYNSV---------LVQKFINKVMERGKKSLAERIVYQALDL
RS7_HERA2       MPRRR-KIA-KRIVPGDPIHNSI---------HVQMLINKVMMHGKKSVAENIVYRALDV
RS7_LISW6       MPRKG-PVA-KRDVLPDPIYNSK---------LVTRLINKMMVDGKRGKSQAILYSAFDI
RS7_ENTFA       MPRKG-PVA-KRDVLPDPIYNSK---------LVTRLINRVMVDGKRGIAANIIYNSFDI
RS7_PEDPA       MPRKG-PAP-KREVLPDPIYNSK---------LVTRLINRLMLDGKRGKASKILYNAFDI
RS7_LACPL       MPRKG-APA-KREVLADPMYNSK---------LVTRLINHLMLDGKRGTASTILYDAFDQ
RS7_OENOB       MPRKA-YTK-QQEVLPDPIYNSK---------LVSRLINKLMLDGKRGTASSILYKAFDR
RS7_STRMU       MSRKN-RAP-KREVLPDPLYNSK---------LVTRLINRIMLDGKRGTAASIVYGAFEQ
RS7_STAS1       MPRKG-SVP-KRDVLPDPIHNSK---------LVTKLINKIMLDGKRGTAQRILYSAFDL
RS7_OCEIH       MPRKG-PVP-KRDVLPDPLYKSK---------LVTRLINQIMVDGKRGKAQKILYNAFEL
RS7_GEOTN       MPRRG-PVA-KRDVLPDPIYNSK---------LVTRLINKIMIDGKKSKAQKILYTAFDI
RS7_LACDB       MPRKG-HVS-KRDVLADPVYNSK---------LVTKLINHLMKDGKRAQASSILYDAFDI
RS7_ONYPE       MSRKG-HIK-KRDVQPDPVYNSK---------LVTKIINIIMEDGKKGKAQTIFYQALKQ
RS7_ACHLI       MPRKG-HIV-KRDVLPDPIYNSK---------LITRIVNTIMEDGKKGTAQGILYGALNR
RS7_ALKMQ       MPRKG-NVP-KREVLADPIHGSM---------VVAKLINSVMLDGKKGTAQNIVYGAFDI
RS7_CLOD6       MPRKG-NIP-KREVLPDPMYGSK---------VVTKLINNLMVDGKKGKSQRIVYDAFAI
RS7_ALKOO       MPRKG-SVP-KREVLPDPIYGSK---------VISKLINGIMLDGKKGVAQKIVYDALAL
RS7_DESRM       MPRRG-GIP-KRDVLPDPIYGSK---------IATKLVNQMMLDGKRGVAEKIIYDAFEI
RS7_MOOTA       MPRRG-RVP-RRAVLADPLYGNT---------KVTKLINQVMLDGKKSLAQRICYDAFEI
RS7_PELTS       MPRRG-AVP-KREVLPDPVYQSK---------VLTKLINQVMLKGKKSLAESIVYGAMDI
RS7_CLOTE       MPRKG-YIG-KRDVLPDPMYNSK---------VLTKLINSLMYDGKKGLAQKICYDAFDV
RS7_CLONN       MPRKG-NTP-KRDVLPDPLYNNK---------VVAKLINSIMLDGKKGVAQKICYDAFAI
RS7_LACP7       MPRKG-HIQ-KRDVLADPIYNNK---------TVTKLINNIMLDGKKGTAQKIVYGAFEK
RS7_DESHY       MPRKG-YIA-KREILPDPIYKNR---------VLTKFINQIMLDGKKGTAESICYNAFEL
RS7_SYNWW       MPRKG-PVP-KRDVLPDPIYNSK---------IFTKLVNQLMWDGKKSLAEKICYGAFAI
RS7_CARHZ       MPRRG-PVP-KRDVLPDPIYGSK---------LVTKLINKTMVDGKKSLAEKICYRAFDI
RS7_CALS4       MPRKG-PVP-KREVLPDPVYNSV---------KVAKLINKVMWDGKKSLAQKICYGAFDI
RS7_HUNT2       MPRKG-NVP-KRDVLPDPIYNDK---------VVAKLINNIMIDGKKSIAQKICYGAFDI
RS7_MYCGA       -MRKN-RAE-KRKVLPDPVYNSV---------LVTRAINAIMLDGKKGIAQKILYGSFDL
RS7_MYCPN       -MRKN-RAP-KRTVLPDPVFNNT---------LVTRIINVIMEDGKKGLAQRILYGAFDL
RS7_MYCPE       -MRKN-RAT-KREILPDPVYNSR---------LVTKAINAIMLEGKKGLAQQIVYQSFDL
RS7_UREPA       -MRKL-KPQ-KRQVLADPVYNSR---------LVTKLINAIMYDGKKGLAQSIIYSAFEI
RS7_MESFL       -MRKN-RAE-KRDVLADPIYNSK---------LVTRAINKIMLDGKRGTAQTIIYDAFDI
RS7_MYCPU       MSRKH-KAP-IRTVLADPVFNMV---------VVTKLVNTIMLDGKKSIAQNIVYSAFDI
RS7_MYCS5       MSRKK-SAK-VREVLADPIFNSV---------VVTKLINTIMLDGKKSIAQDILYSAFDL
RS7_MYCMO       MSRRK-KAP-IRQVLSDPIFNSK---------TITKLINTIMLDGKKSIAERILYQAFEI
RS7_MYCHJ       MSRKK-QAP-VRNVLADPVFNSK---------LITKAINCTMLEGKKTTAQNILYSAFKL
RS7_SYMTH       MPRRG-HVP-KREVQPDPVYNSE---------LVTRVINKIMLDGKKALAQRIFYEAIDK
RS7_RICBR       MSRRH-AAE-KRVILPDMKYNSV---------LLSRFINNIMKEGKKALAEKIVYSAFDK
RS7_ORITB       MSRRC-TEV-KRKSLPSNKYQSISAATPNQIMLASKLINKLTHHGNKELVEKMLDKIIQH
RS7_ANAMM       MSRRR-RVS-RRPVVSDGGPGGV---------LLARFINVVMSRGKKALAERIVSGALKM
RS7_ANAPZ       MSRRR-RVV-RRAVATEGCSGNV---------LLARFVNVVMHQGKKALAEKIVFGALKM
RS7_EHRRW       MSRRR-RAN-KRVITPDSKYNSV---------LLARFINVIMRSGERSIAEKIVYGALSK
RS7_WOLPM       MARRN-KAK-KREISPDSRYGSV---------LLMRFINTIMKCGKKSTAEKIIYDALSL
RS7_WOLTR       MARRN-KAR-KRKISPDSRYDSV---------LLMRFINVIMKYGKKSVAEKIVYNALSS
RS7_NEOSM       MSRRN-VAK-KREVSADRKYNSK---------IVAKFINHVMKKGKRALAEKIVYGAMEK
RS7_PELUB       MSRKK-TQP-KKVVTPDPIFNST---------IIPKLINSIMYDGKKVVAEKIVYEAIEK
RS7_GLOVI       MSRRT-RAI-LRPVTADPLYASR---------LVTMMTNKLMKEGKKATAERILYSALER
RS7_SYNJA       MSRRN-RAP-RRDVPPDPKYGSR---------LVTMLIHKLMMRGKASLAARILYDALEI
RS7_TRIV2       MSRRG-VIQ-RRPVPPDSVYNSR---------LVSMIIRRIMRHGKKSLAARIVYDALKT
RS7_TRIEI       MSRRR-VIQ-RRPIPPDPKYNSR---------LVTMIVRRIMRHGKKSVAYNIVYDAFKA
RS7_ACAM1       MSRRI-RAQ-KRPVPPDPVYNSR---------LISMTIRRLMASGKKSLASRILYDALKI
RS7_THEEB       MSRRT-RAQ-KRPTAPDPVYNNV---------LVNMLIQRVMRNGKKSLASRIVYEAMKT
RS7_MICAN       MSRRK-NVK-KRPIPPDPVYNSC---------LVSMTIRRIMRSGKKSLAANIVYDALKT
RS7_SYNY3       MSRRG-NVK-KRPVPPDPVYNST---------LLSMTIRRVMRSGKKSLASSIVYNALAS
RS7_PROMP       MSRRN-AAV-KRPVLPDPQFNSR---------LASMMISRLMKHGKKSTAQKILSDAFSL
RR7_PYRYE       MSRRN-TAK-KRFASPDPLYKSR---------LVSMLTVRILKSGKKTLSQRIIYQALDI
RR7_RHDSA       MSRRT-TAK-KRLAVPDPIYNSR---------LVSMLTVRILQQGKKHLAQRIIYQALDI
RR7_GRATL       MSRRN-KSK-KRLIQKDPVHESK---------LVSMLTARILKSGKKGLAYKIVYEALDI
RR7_THAPS       MSRRN-ISK-KRFPKADPTYNSY---------LVSLLVTRILKSGKKNLAQNIVNSAFDI
RR7_PHATC       MSRRN-ISK-KRFPETDAIYNSY---------LVSLLISRILKSGKKTIAKKIVYQAFDI
RR7_EMIHU       MSRRS-KSK-RVLAQPDPIYNSR---------LVNLLVIRVLKSGKKSVAQKIVYTALEI
RR7_CYAPA       MSRRS-TAK-KRLILPDPIYNSR---------LVTLLINHMLKDGKKSIARSFIYEALKI
RR7_CYAM1       MTDQG-MT--------DQSMKSR---------LVELLIVHVLRKGKKSLARRIVYEALKR
RR7_CYACA       MSQKD-PYK-TYRLVSDPFYESP---------LVTLLIMHVLRNGKKSISQRIVYSAIEN
RR7_BIGNA       MSRRK-LSK-KRIFKKDPFYNNE---------LIQIIINRIMKKGNKALARKIIYRSLKD
RR7_EUGLO       MSTRKLQKR--KILPNDSIYNSL---------LVSQTINKILSKGKKNIARYIFYKSMQN
RR7_EUGGR       MSRRRRAKK--RIISQDPIYNST---------LASKVINKILLNGKKTLAQYIFYETMKN
RS7_CARRP       MSRKKRYFK--TVILNDPKFGSY---------IIAKFINYIMNNGKKNLAQKIFYYSISI
                                .                           *.              

RR7_CHLRE       IGDVTQK-----------------------------------NPVEVFEKALDNVTPRVE
RR7_TETOB       IGETTQQ-----------------------------------NPVEVFEAALENVMPKVE
RR7_STIHE       ISETMNQ-----------------------------------NPVEVWEKALNNVKPRVE
RR7_JASNU       VQKKTER-----------------------------------NPLSILREAIRRVTPDIA
RR7_PELHO       IQQKKKR-----------------------------------NPLSILRQAIRRVTPKIA
RR7_ORYSJ       IQQKTET-----------------------------------NPLLVLRQAIRRVTPNIG
RR7_PHYPA       IKQKTKK-----------------------------------NPLSILRQAIHRVTPNVT
RR7_ANTAG       IRRATKK-----------------------------------NPLSVLRQAVRRVTPNVT
RR7_HUPLU       IRRETKY-----------------------------------NPLFILRQAIRQVTPNVT
RR7_ANGEV       IKQKTQK-----------------------------------NPLSVLRQAVRRVTPNVA
RR7_CHAGL       IKTKTQK-----------------------------------NPLFILRQAIRKATPKVA
RR7_ZYGCR       IKQSTQK-----------------------------------NPLSVIRQAVRRTTPNVA
RR7_STAPU       IQQKTKK-----------------------------------NPLAVVRQAIRRVTPNVA
RR7_CRYJA       IQQKTEK-----------------------------------NPLIVLRQAIQKLTPKLI
RR7_GNEPA       IQQKTEK-----------------------------------NPLLVLRKAIKEVTPRLI
RR7_ADICA       IRQKTNR-----------------------------------NPLSVLRQAVRGVTPDVV
RR7_ANEMR       TRRDTGK-----------------------------------NPLLILRQAMIKVTPDVV
RR7_PSINU       IKRKTKK-----------------------------------NPLSVLRQAVYRVTPNVA
RR7_CHAVU       IKHKTKK-----------------------------------NPSLILRQAVVRATPKIT
RR7_CHLAT       IEEKTEK-----------------------------------DPLKILQQAVLNATPLVE
RR7_NEPOL       IEKTTQQ-----------------------------------DPILVVERAVRNATPTIE
RR7_OSTTA       IAETTSQ-----------------------------------DPLEVLRQAVLNITPKVE
RR7_OLTVI       IREKTQQ-----------------------------------DPIKVIEQAVRNATPLVE
RR7_TUPAK       IAEKTEQ-----------------------------------DPIQILEEAVRNTKPLVE
RR7_CHLVU       VADATQQ-----------------------------------DPLVIVEQAIRNATPLVE
RR7_PLETE       IKQKTEQ-----------------------------------DPLEVIQKAVNNVRPLVI
RS7_TREDE       IKEKTG----------------------------------E-EPLAVFSKALDNVKPVVE
RS7_TREPA       IQQRTG----------------------------------E-EPLPVFTKALENVKPAVE
RS7_BORBU       LADKLE----------------------------------ESDKMAVFYKALDNIKPLVE
RS7_CHLPN       FGKKLN----------------------------------LENVLEGFGEALENAKPILE
RS7_PARUW       FSKRIK----------------------------------AENPLEAFEQALENAKPSLE
RS7_RHOBA       IGKRHEG---------------------------------EETPIEVFEAALENIKPYIE
RS7_DEHM1       MGKQEN-----------------------------------KEGLAVFEQGLKNATPFIE
RS7_PORGI       VKTKHSNE--------------------------------EKSALEIWKAALDNITPQVE
RS7_CYTH3       VEKKTS-----------------------------------ESGLEVWKKALNNVSPQVE
RS7_GRAFK       VDEKKQDE--------------------------------EKTGLEIWKDALSNVMPHVE
RS7_SULMW       IEKTK------------------------------------KNGLKIWKEALDNVMPHVE
RS7_CHLCH       ISERNN----------------------------------GEDALEIYRKAISNIAPVVE
RS7_CHLTE       IANKVE----------------------------------GGDALEVFRKAMGNVAPLVE
RS7_SALRD       IEERTG----------------------------------EEEGLEVFKKAVNNAAPLVE
RS7_ECOLI       LAQRSG----------------------------------KS-ELEAFEVALENVRPTVE
RS7_BUCAP       LSERTE----------------------------------KK-ELEAFEIALENVRPTVE
RS7_BUCBP       LAKKIG----------------------------------KP-ELEVLELALENVRPTVE
RS7_BUCCC       LSIKVK----------------------------------KK-ELDIFIAALDNVKPVVE
RS7_BAUCH       IAKRSG----------------------------------KN-YLEAFEAALDNVRPAIE
RS7_WIGBR       LKKKLN----------------------------------KD-HLTIFDLALEKVRPIVE
RS7_BLOFL       VLDRSS----------------------------------KDSCMELFEEALDNVRPVVE
RS7_BLOPB       LFRRSN----------------------------------KN-CLEAFEIALNNVRPVVE
RS7_PHOPR       MTER-S----------------------------------GEECLSVFEKALENVRPAVE
RS7_SHESH       ASEK-K----------------------------------SEDHLVILEAALENVRPSVE
RS7_PSYIN       AASK-S----------------------------------GKVALDLFEVALENIRPSVE
RS7_PSEPF       VAARKT----------------------------------GTDPLELFEKALDAIAPLVE
RS7_MARMS       VAARAK----------------------------------TEEPMAIFEKALESIQPMVE
RS7_ALCBS       ITER-K----------------------------------GLDSLETFEKALDNIRPAVE
RS7_MARHV       VAEK-S----------------------------------KEEPIEMFEKALENIQPMVE
RS7_CHRSD       VAER-S----------------------------------KDEPLEIFDKALETIQPMVE
RS7_SACD2       VSEK-L----------------------------------NKDPLETFSEALENISPLVE
RS7_PSYWF       VAEKRN----------------------------------IEDPVAFFEEVLENVRPMVE
RS7_NITOC       VSEK-A----------------------------------NQDPMDVLEKALENVRPLVE
RS7_LEGPH       MEERVKKIKKNEEDGSETGSS-----------------GSAGAVLRYFEEALDNVRPSVE
RS7_HYDCU       VVDRKK--------------------------------GGEHAVL--LREALENVGPMVE
RS7_COXBR       VAKRVQNKSGEQGDGDGESGGKAGGIKKRSLGDIRTDENARALALETFKGALDKVMPNVE
RS7_DICNV       AGKKK-----------------------------------NMEAISLLEEALDKVRPAVE
RS7_FRAP2       IKAKDA----------------------------------SANEVEVFEKALDSVSPMVE
RS7_XYLFT       IGEKN-----------------------------------S-NAIELLQKALDNVSPAVE
RS7_METCA       IEAKT-----------------------------------SQNSLEVLNKALENVQPVVE
RS7_METPP       VEKKA-----------------------------------NRDPLEVFITALNNVKPMVE
RS7_JANMA       IQTKS-----------------------------------GKDPLEVFTAAIANCKPLVE
RS7_POLAQ       IEKKA-----------------------------------NKEPLEIFSTAMGNVKPMVE
RS7_AROAE       ISGKA-----------------------------------GKDPLEVFSSAVANVKPVVE
RS7_DECAR       ITTKG-----------------------------------GKDPLEVFSAAMSNVKPMVE
RS7_NITMU       IHKKT-----------------------------------GKDPVEVFTQALSNVRPMVE
RS7_METFK       ITQKS-----------------------------------GKEALEVFTLAISNLRPVVE
RS7_CHRVO       IEKKT-----------------------------------GKNAIEVFNTALSNAKPVVE
RS7_BORA1       VQTKT-----------------------------------GKEPIEVFTLAINNIKPIVE
RS7_HALHL       IGSKH-----------------------------------D-DPIEVMETALENVKPRVE
RS7_CHESB       VQEK-TKQ----------------------------------EPVAVFHQALDNVAPHVE
RS7_MARMM       VEEK-LKR----------------------------------EPIRVFHDALDNVAPEVE
RS7_RHOP5       IEGK-TKQ----------------------------------DPLSVFVQALDNVMPTIE
RS7_HYPNA       VETR-AKK----------------------------------NPVEVFHNALEAVAPAVE
RS7_AZOC5       VEAK-AKS----------------------------------NPLDLFVTALENVAPAVE
RS7_CAUSK       LENKRKDQ----------------------------------GPLETFHSALDNVAPAIE
RS7_PARL1       MQQK-ASV----------------------------------DPLRTFHEALENVMPALE
RS7_MAGSA       IQAK-TGQ----------------------------------DPLKVFHEALDNVKPALE
RS7_RHORT       IQSK-TGQ----------------------------------DPVKVFHDALDNVKPSVE
RS7_PARDP       VQGK-LKR----------------------------------EPIEVFHEALDNVKPSVE
RS7_ZYMMO       IEAR-VKR----------------------------------VPLEVFHEALDNVKPGIE
RS7_ACICJ       LKKR-GGQNA--------------------------------DPVRLFHEALDNVKPAIE
RS7_MYXXD       IEERAK-----------------------------------EDPLKTFKKALDNVKPVLE
RS7_SORC5       VRDRFK-----------------------------------EEPIDVFRKALDNVKPKLE
RS7_PELCD       IAERSG-----------------------------------EEALDVFKKAVENIRPMLE
RS7_GEOUR       ASEKVN-----------------------------------EDPVKILKKSLDNIKPMLE
RS7_PELPD       VAQKTN-----------------------------------DEAVKVLKKSLDNIKPALE
RS7_SYNAS       IEKKAK-----------------------------------ESPVELFERAVNNVKPVIE
RS7_SYNFM       IEQRSK-----------------------------------QDPLDLFHKAMENVRPVVE
RS7_MAGMM       IEQRTK-----------------------------------EDPIKVFKEAVDNVRPTLE
RS7_DESPS       VADRMKD----------------------------------EEPLTVFEEAMEKVRPRVE
RS7_LEPIC       IQKKT-----------------------------------GNDPYTTFREALENAKPQVE
RS7_BDEBA       LEGKVQ----------------------------------GEEPLAVFKKALENVKPSIE
RS7_LAWIP       LSEKTG-----------------------------------EEPLRAFERALDNVKPQFE
RS7_DESAG       LQEKTG-----------------------------------EDAIKAFEKAVDNVKPFVE
RS7_KORVE       LEAKGGG----------------------------------EEAIKLFKKAVENAKPLLE
RS7_SOLUE       IRERTS-----------------------------------DDPLKAFKKAVENAKPLLE
RS7_THEP1       IREKTKK-----------------------------------DPLEVFRQAVENVKPVLE
RS7_THEM4       LAEKTKK-----------------------------------APLEALHQAIENVRPIVE
RS7_PSELT       IQEKSGK-----------------------------------DPLEVFQKAIENVRPVLE
RS7_FERNB       LSQKTGK-----------------------------------DGIEVFKQAIENVKPIVE
RS7_PETMO       LAEATKE-----------------------------------NPIEAFHKAIDNVKPVVE
RS7_DEIRA       VQERTGQ-----------------------------------EPLKVFKQAYDNVKPRVE
RS7_THET8       IQEKTGQ-----------------------------------EPLKVFKQAVENVKPRME
RS7_HELHP       IEEKSGE-----------------------------------KGIEVFEKALERVKPLVE
RS7_ARCB4       LDARGEE-----------------------------------KGFDLFERAIENVKPLLE
RS7_SULNB       IESKTGE-----------------------------------KGIEVFNKAMDNIKPVME
RS7_SULDN       ISSRGEK-----------------------------------TGIDTFNEAIENIKPIIE
RS7_NITSB       IEEKDKEA----------------------------------KGIDIFNEAIENVKPLLE
RS7_CAMHC       IDQKGGEK----------------------------------KGIEVFNDAIENVKPVLE
RS7_FUSNN       IKEKTGQ-----------------------------------EGYDIFKQALENIKPQIE
RS7_KINRD       ARDKTGG-----------------------------------DPVVVLKRALDNVKPAIE
RS7_NOCSJ       CREKTGT-----------------------------------DPVVTLKRALDNVKPAIE
RS7_CUTAK       CRAKNNT-----------------------------------DPVQTLKRALDNIKPSLE
RS7_CORJK       CREKTGT-----------------------------------DPILTLKKALDNVKPALE
RS7_THEFY       AREKTGQ-----------------------------------DPLVILKRAIDNVKPTLE
RS7_ACIC1       CRARTGT-----------------------------------DPLITLKRALDNVRPTLE
RS7_RENSM       AREKSGG-----------------------------------DPVAALKKAMENIKPSLE
RS7_STRCO       LREKTGN-----------------------------------DPVITLKRALENIKPTLE
RS7_LEIXX       VSSKSGN-----------------------------------DAVATLKKALDNIRPTLE
RS7_BIFLO       VKEKSDQ-----------------------------------EPVAVLKRALDNIRPSLE
RS7_TROWT       VSMKASE-----------------------------------DPVSVLRKALDNVRPSLE
RS7_RUBXD       VEERTGD-----------------------------------NPVTVLSQALDNIKPRLE
RS7B_AQUAE      AAKEVNM-----------------------------------HPVELLHKVIEKLKPEWE
RS7_CHLAA       AAERLKK-----------------------------------PQMEIFEQALRNASPSIE
RS7_HERA2       AAQRLNR-----------------------------------EPVDLFEQVLRNSSPTIE
RS7_LISW6       IAQETGK-----------------------------------DPMEVFEQAMKNIMPLLE
RS7_ENTFA       IKESTGN-----------------------------------DPLEVFEQAMKNVMPVLE
RS7_PEDPA       IEKETGS-----------------------------------EPTGVFEEAMNNIMPVLE
RS7_LACPL       IKEQTGN-----------------------------------DPLEVFEEAMKNVMPVLE
RS7_OENOB       IQSETGN-----------------------------------DPVEVFQQAMENVMPVLE
RS7_STRMU       IKEATGN-----------------------------------DALEVFEQAMENIMPVLE
RS7_STAS1       VKERSGR-----------------------------------EAVEVFEEAIDNIMPVLE
RS7_OCEIH       VAERSGQ-----------------------------------NAMEVFEQAMKNVMPVLE
RS7_GEOTN       IRERTGK-----------------------------------DPMEVFEQALKNVMPVLE
RS7_LACDB       IKDKTGR-----------------------------------EPMDVFEEAMNNVKPVLE
RS7_ONYPE       VKTITNR-----------------------------------EPIKVFHEALNNIMPVLE
RS7_ACHLI       IKDQTGR-----------------------------------EAIDVFNEALNNISPILE
RS7_ALKMQ       IKERAEE-----------------------------------NPVEVFEKAMNNIMPVLE
RS7_CLOD6       VAEKTGE-----------------------------------EALEVFNKAMDNIMPVLE
RS7_ALKOO       INERTGE-----------------------------------DALEVFEKAMNNIMPVLE
RS7_DESRM       IKEKTGK-----------------------------------SPLEVFDAAMKNVMPVLE
RS7_MOOTA       IKNKTGK-----------------------------------DPVEVFEQALKNVMPVLE
RS7_PELTS       IKEKTGK-----------------------------------NPLEVFETAMKNVMPVLE
RS7_CLOTE       IQNKTGK-----------------------------------EPMEVFEEAMNNVMPLLE
RS7_CLONN       MGEKTGK-----------------------------------EPLEVFEEAMNNVMPLLE
RS7_LACP7       VAEKSGK-----------------------------------DATEVFEEAMNNVMPVLE
RS7_DESHY       IQEKTGK-----------------------------------DPIEVFETALKNVMPVLE
RS7_SYNWW       VQSKTRR-----------------------------------EPLEVFEEAMKNITPIVE
RS7_CARHZ       IREKTGR-----------------------------------DPLEVFEEAMKNVMPVLE
RS7_CALS4       IREKTGR-----------------------------------DPLEVFEEALNNVMPVLE
RS7_HUNT2       IREKTGK-----------------------------------DPLEVFEQALNNVMPVLE
RS7_MYCGA       IAQKTQK-----------------------------------DPLEIFNKAVENIMPRLE
RS7_MYCPN       IEQRTKE-----------------------------------KPLTVFERAVGNVMPRLE
RS7_MYCPE       IKKKTNE-----------------------------------DGIEVFKKALENIMPSLE
RS7_UREPA       VEQKTGK-----------------------------------PALEVFNKAIDNVMPIIE
RS7_MESFL       IKEKTGE-----------------------------------EPIEIFNKAIENIKPHLE
RS7_MYCPU       IKEKTGR-----------------------------------EPYEVFQEALNNITPLLE
RS7_MYCS5       VKEKTKK-----------------------------------DPMQVFTQAVENITPQLE
RS7_MYCMO       IKTKTNK-----------------------------------DPMEVFQLALDNITPQLE
RS7_MYCHJ       VEEKLQK-----------------------------------DALEVFRQAVKNVTPLTE
RS7_SYMTH       ASAKLGK-----------------------------------EPMEVLEGALKNIMPVVE
RS7_RICBR       IEKKH-----------------------------------KADPYQTFSNAMNNVKPYLE
RS7_ORITB       IKHKY-----------------------------------KADGFEVLESACNNVKPSLQ
RS7_ANAMM       AESKST----------------------------------GETGVSIFNTAVSNVMPRME
RS7_ANAPZ       AESRLQ----------------------------------GESGIAIFNTAVANVMPKME
RS7_EHRRW       AENRI-----------------------------------GESAMSVFSSALNNVMPQME
RS7_WOLPM       AEKKI-----------------------------------GEGGLSIFETAVGNVTPSIE
RS7_WOLTR       AEKEV-----------------------------------NERGVSIFETAVENVTPSVE
RS7_NEOSM       AEKQL-----------------------------------GVPAMDVLTGVLANISPAVE
RS7_PELUB       IKSKT-----------------------------------KEEPINVFNEAINNIKPTVE
RS7_GLOVI       VQERTGR-----------------------------------EPLDVFNQAVLNCTPRIE
RS7_SYNJA       VRERTGQ-----------------------------------DPLPVLENAVRNATPLVE
RS7_TRIV2       IEERTGN-----------------------------------NALEVFERAVRNATPLVE
RS7_TRIEI       IEERTDS-----------------------------------DPLELFEKAVRNLTPLVE
RS7_ACAM1       IEERTNQ-----------------------------------DPLEVFETAVRNVTPLVE
RS7_THEEB       VQERTGE-----------------------------------DALQIFERAVKNATPLVE
RS7_MICAN       VGERTGQ-----------------------------------EPLEVFEKAVKNATPLVE
RS7_SYNY3       VGEKTGE-----------------------------------DPLEVFEKAIKNLTPLVE
RS7_PROMP       ISERTGG-----------------------------------NAVELFETAVKNATPLVE
RR7_PYRYE       VKERTES-----------------------------------DPLNILEKAIRNITPLVE
RR7_RHDSA       IKERTGE-----------------------------------DALNILETAVRKVTPLVE
RR7_GRATL       INKKTSH-----------------------------------DSLEILEKAIRNATPLVE
RR7_THAPS       IKSKTNE-----------------------------------DPLVIFEKAIRNASPVVE
RR7_PHATC       IKKKTNE-----------------------------------DPLTVFEKAIRNASPIVE
RR7_EMIHU       IAEKTNE-----------------------------------NPILLLEKAVTNVTPQVE
RR7_CYAPA       IEEKKGS-----------------------------------DPLEVLEQAVRNSTPLIE
RR7_CYAM1       IEERNQQ-----------------------------------SGVLMLEQAVSQVMPLVC
RR7_CYACA       IAMKVKE-----------------------------------DPLEIIERAIKNVIPAVE
RR7_BIGNA       IELVTKQ-----------------------------------DPIKIVEQAVSNVTPFVE
RR7_EUGLO       IEKIKNE-----------------------------------NPLDIFKKAVDNATPSIE
RR7_EUGGR       IQEIYKK-----------------------------------DPLDILRKAIKNASPQME
RS7_CARRP       ISIRLNK-----------------------------------NPFILIKKILYNVQPNFE
                                                                        *   

RR7_CHLRE       VKPRR-RAGAIQMVPRVLRLGDRARANSLRWIMEACDKR-SGQ---PMVTKLKSEILDAY
RR7_TETOB       VQPRR-RAGSVQMVPSILRSTERGQATALRWILESCEKK-SAK---SMVSKLQTEILDAY
RR7_STIHE       VKPRR-RAGSIQQVPRVMPSAERARAIAIRWIVSACQKK-AGK---DMISKLFSEISEAS
RR7_JASNU       VKARR-KGGSTRQVPIEIGST-QGKALAIRWLLAASRKR-PGG---NMAFKFSSELVDAS
RR7_PELHO       VKRRR-VSGSAYQVPIEIKAP-QGKVLAIRWLLEAARKR-PGR---NMAFKLSSELMDAT
RR7_ORYSJ       VKTRRNKKGSTRKVPIEIGSK-QGRALAIRWLLEASQKR-PGR---NMAFKLSSELVDAA
RR7_PHYPA       IKARR-VGGSTYQVPVEIKSA-QGKALAICWLLRASKKR-LGR---NMAFKLSYELIDAA
RR7_ANTAG       VKARR-VGGSTYQVPIEIESS-QGKALAIRWLLVASKKR-PGR---NMAFKLSYELIDAA
RR7_HUPLU       IETRR-VGGSTYRVPTEIEST-QGKALAIRWLLEASRKR-PGR---NIASKSSSELMDAA
RR7_ANGEV       VKARR-VGGSTYQVPVEIIPA-QGKALAIRWLLGASRKR-PGR---SMALKSSYELMDAA
RR7_CHAGL       VKARR-VGGSTYQVPVEIQSS-QGKALAIRWLLTSAKKR-AGR---NFISKLSNEIIDTA
RR7_ZYGCR       VKARR-RGGSTYQVPVEIKSA-QGRALAIRWILNAAKKR-NGR---SMAFKLSSEIIDAA
RR7_STAPU       VKARR-RGGSTYQVPVEIKPD-QGKALAVRWILAAARKR-PGR---SMAFKLSYELMDAA
RR7_CRYJA       VKSRR-VSGSTYQVPIEIKKK-EGKILAIRWLLESSRKR-SGR---NMHFKLSYEIMDAA
RR7_GNEPA       VKSRR-KSGSTYQVPFEIKPN-RGKILAIRWLLKASRKR-LGP---NMESKLSYELIDAT
RR7_ADICA       TETKR-VGGSTYRVPIEVVPA-KGKALAIRWLLIACRKR-SGR---SMALRLSDELIDAA
RR7_ANEMR       VKAKR-IGGSTYQVPLEVGSM-QGKALAIRWLLTASRKR-SGR---NMASKLGYELIDAA
RR7_PSINU       VKSRR-VGGSNYQVPVEVKPA-RGKALAIRWIVGASRNR-SGR---SMASKSSYELIDAA
RR7_CHAVU       IKARR-IGGSNYQVPVEIKPE-KGHSLAIRWLLTASRKR-TGK---NMVFKLANELLDAA
RR7_CHLAT       VKARR-IGGSTYQVPREVKPE-RGTALALRWLLSSARKR-PGR---DMASKLTNELLDAA
RR7_NEPOL       VKARR-MGGSIYQVPLEVKPE-RGTALALRWILLAARNR-TGR---DMVAKLSNELMDAS
RR7_OSTTA       VKSRR-VGGATLQVPLEVKAD-RGTALALRWLLIAARNR-SGR---NMVSKLSAEIIDAS
RR7_OLTVI       VKARR-VGGSTYQVPLEVSPE-RGTALAMRWILIACRNR-PGR---TMVAKLTNEFIDAS
RR7_TUPAK       VKARR-VGGSAYQVPLEVNPE-RGTVLALQWVLAAARNR-SGR---SAIAKLTNELIDAS
RR7_CHLVU       VKARR-IGGSTYQVPLEVASE-RGTALAIRWILSVCRKK-TGR---PMAAKLTAELLDAA
RR7_PLETE       VKSRR-VSGSTRQVPLSVDYE-IGVALAIRWILAACRKR-VGK---SMISKMTNEFLDAS
RS7_TREDE       VKSRR-VGGATYQVPMDIPEG-RREALAMRWIIGAARKR-SGH---EMSERLASELIDAY
RS7_TREPA       VKSRR-VGGSTYQVPMEIRET-RREALGMRWIIGAARRR-SGR---GMSERLAAEILDAY
RS7_BORBU       VRSRR-VGGATYQVPVEVREE-RREALAMKWIIFAARKS-SGR---SMKEKLSNELLNAY
RS7_CHLPN       VRSRR-VGGATYQVPVEVASE-RRNCLAMQWIIKHARSK-PGK---SMEVGLATELIDCF
RS7_PARUW       VKSRR-IGGATYQVPIEIPAN-RRSSMAMRWIIGHSRGK-AGR---SMEDALASELSDCY
RS7_RHOBA       VRSKR-VGGASYQVPMQVNKA-RQQSLAIRWILAAVRDK-KGR---PMALKLADELLAGF
RS7_DEHM1       VKPRR-VGGATYQVPIEVRPD-RAQTMAMRWIIKAARKR-TGK---SMAERLAAEMLEAS
RS7_PORGI       VKSRR-IGGATFQVPTEIRPE-RKESISMKNLILYARKR-GGK---TMADKLAAEIVDAF
RS7_CYTH3       VRSRR-VGGSTFQVPTEVRPD-RKMALGMKWLINYARSR-GEK---TMTDKLAGEIISAS
RS7_GRAFK       VRSRR-VGGATFQIPMQIRPD-RKVSTAMKWLISFSRKR-NEK---SMAGKLAAEVLAAA
RS7_SULMW       VRSRR-IGGSNIQVPTQIPPY-VKVTKAMKLLISCARER-NEK---KMYKKLAEEILSAY
RS7_CHLCH       VRSKR-VGGATYQIPMEVKPS-RRSALAFRWLKIYAGKR-GGK---SMAEKLAAELMDAA
RS7_CHLTE       VRSKR-VGGATYQIPMEVPAS-RRTALAFRWIKQFAARR-GGR---SMAEKLAAELLDAS
RS7_SALRD       VRSRR-VGGATYQVPTEVRPE-RRITLAFRWIIQYARAR-NEK---SMVNRLASELVDAA
RS7_ECOLI       VKSRR-VGGSTYQVPVEVRPV-RRNALAMRWIVEAARKR-GDK---SMALRLANELSDAA
RS7_BUCAP       VKSRR-VGGSTYQVPVEVRPV-RRNALAMRWIVDSARKR-GDK---SMALRLSNELYDAV
RS7_BUCBP       VKSRR-VGGSTYQVPIEVRPV-RRHALAMRWIVHSARKR-IDK---SMIIRLSNELSDAI
RS7_BUCCC       VKSRR-VGGSTYQVPVEVRPV-RRNALAMRWIIDAARKR-IDR---SMSIRLTNELLDAL
RS7_BAUCH       VKSRR-VGGSTYQVPVEVRSI-RRDTLAMRWIVEAARKR-SDK---SMAIRLANELVDAT
RS7_WIGBR       VKSRR-VGGSTYQVPIEVRSS-RRNALAMRWIIEAARKR-KDK---SMSLRLAKEIEDAL
RS7_BLOFL       VKSRR-VGGSTYQVPVEVRLV-RRNTLAMRWIIESARKR-NDK---SMEMRLANELFDAS
RS7_BLOPB       VKSRR-VGGSTYQVPVEVRLV-RRNTLAMRWIIEAARKR-NDK---SMELRLASELLDAI
RS7_PHOPR       VKSRR-VGGSTYQVPVEVRPV-RRNALAMRWLVEAARKR-GEK---SMAQRLAGEMLDAA
RS7_SHESH       VKSRR-VGGSTYQVPCEVRPV-RRNALGMRWLVEAARKR-GEK---SMALRLAGELLDAS
RS7_PSYIN       VKSRR-VGGSTYQVPVEVRPS-RRNALAMRWLVEASRKR-GEK---SMALRLAGELVDAS
RS7_PSEPF       VKSRR-VGGATYQVPVEVRPS-RRNALAMRWLVDFARKR-GEK---SMALRLAGELLDAA
RS7_MARMS       VKSRR-VGGATYQVPVEVRPA-RRAALSMRWLVDASRKR-GEK---SMALRLAGEILDAA
RS7_ALCBS       VKSRR-VGGATYQVPVEVRPS-RRTALAMRWLVDAARKR-GEK---SMPARLAGEVMDAA
RS7_MARHV       VKSRR-VGGATYQVPVEVRPS-RQNALAMRWLVEYSRKR-GEK---SMAQRLAGEILDAA
RS7_CHRSD       VKSRR-VGGATYQVPVEVRPS-RRQALAMRWLVDAARSR-GEK---TMVQRLAGEMLDAA
RS7_SACD2       VKSRR-VGGATYQVPVEVRPA-RRTALAMRWLVEYSRNR-GEK---SMAQRLAGELIDAA
RS7_PSYWF       VKARR-VGGATYQVPMEVRPS-RRTALAMRWLADAASKR-SEK---SMAHRLAGELGDAS
RS7_NITOC       VKSRR-VGGATYQVPVEVRPE-RRSTLAMRWLVEAARKR-SEK---SMDLRLAGELLDAH
RS7_LEGPH       VRSRR-VGGATYQVPVEVRHD-RSIALGMRWIVQAARTR-GEK---GMMLRLAGELMDAY
RS7_HYDCU       VKSRR-VGGATYQVPVEVRSE-RKTALAMRWIVEAARKR-SEK---GMMLRLAGELSDAL
RS7_COXBR       VKSRR-VGGSTYQVPVEIRMA-RRQALARRWLVEYANKR-NEK---TMVLRLAHEILDAV
RS7_DICNV       VKSRR-VGGATYQVPVEVRPV-RQNALAMRWLIEAARNR-NEK---SMAERLANEFLEAV
RS7_FRAP2       VKSRR-VGGATYQVPVEVRPE-RRQTLGMRWIIDAARKR-KES---TMGDRVAAEILEAI
RS7_XYLFT       VKSRR-VGGATYQVPVEVRAS-RRMALAMRWLIDSSRKR-GEN---SMPRKLAAELLDAS
RS7_METCA       VKSRR-VGGATYQVPIEVRPA-RRMALGMRWLIDAARKR-GEK---GMVMKLAAEVLDAK
RS7_METPP       VKSRR-VGGANYQVPVEVRPV-RRMALAMRWLKESARKR-SEK---SMAQRLANELLEAS
RS7_JANMA       VKSRR-VGGANYQVPVEVRPV-RRMALSMRWLREAANKR-SEK---SMPQRLAGELLEAA
RS7_POLAQ       VKSRR-VGGANYQVPVEVRPS-RRSALAMRWVREAAKKR-GEK---SMAQRLANELLEAA
RS7_AROAE       VKSRR-VGGANYQVPVEVRPS-RRMALSMRWLREAARKR-AEK---SMAQRLAGELLEAA
RS7_DECAR       VKSRR-VGGANYQVPVEVRPA-RRAALAMRWLRESARKR-SEK---SMGQRLAAEMLEAA
RS7_NITMU       VKSRR-VGGANYQVPVEVRSI-RRNALAMRWLRDAARKR-AEK---SMGARLAGELAEAA
RS7_METFK       VKSRR-VGGANYQVPVEVRPA-RRSALAMRWLRDAARKR-GEK---SMGLRLAAELIEAS
RS7_CHRVO       VKSRR-VGGANYQVPVEVRPS-RRMALAMRWLRDAARKR-GEK---SMDLRLAGELIDAA
RS7_BORA1       VKSRR-VGGANYQVPVEVRPV-RRLALAMRWLREAAKKR-GEK---SMDLRLAGELIDAS
RS7_HALHL       VKSRR-VGGATYQVPVEVRPE-RRQTLAMRWLLEAARKR-GEK---TMAARMANEMLEAA
RS7_CHESB       VRSRR-VGGATYQVPVDVRPE-RRQALAIRWLISAARGR-NEK---TMVERLSGELLDAS
RS7_MARMM       VRSRR-VGGATYQVPVEVRAE-RKKALAIRWLTGAARGR-NEN---TMRERLAAEMMDAS
RS7_RHOP5       VRSRR-VGGATYQVPVEVRSA-RRQALGIRWLITAARGR-NEK---TMTERLSAELLDAS
RS7_HYPNA       VRSRR-VGGATYQVPVEVRTE-RRQALAIRWLAAAAAGR-NEN---TMRERLAGELMDAS
RS7_AZOC5       VRSRR-VGGATYQVPVEVRTE-RRQTLAIRWLIASARAR-NEK---TMVERLSAELLDAA
RS7_CAUSK       VRSRR-VGGATYQVPVEVRPD-RRRALAIRWLVTAARKR-GEN---TMTEKLAGELLDAS
RS7_PARL1       VRSRR-VGGATYQVPVEVRPD-RRRALAIRWIIAAARAR-NET---TMVARLSGELLDAA
RS7_MAGSA       VRSRR-VGGATYQVPVEVRSD-RRQALAIRWLIDYSRKR-SET---TMIDRLSGELLDAA
RS7_RHORT       VRSRR-VGGATYQVPVEVRPD-RRQALGLRWLIDFARKR-SET---TMVDRLTGEFLDAA
RS7_PARDP       VRSRR-VGGATYQVPVEVRPS-RREALAIRWLIDASKKR-NEH---TMEERLAGELADAV
RS7_ZYMMO       VRSRR-VGGATYQVPVEVRPD-RAQALAIRWLIAASRAR-SEH---SMSARLSGELLDAA
RS7_ACICJ       VRSRR-VGGATYQVPVEVRSE-RRQALAIRWIIESARKR-GEH---TMEDRLSNELLDAV
RS7_MYXXD       VKSRR-VGGATYQVPVEVRQD-RRVALGMRWIITYSKAR-GEK---TMQEKLAGEIMDAA
RS7_SORC5       VKSRR-VGGATYQVPVEVRPE-RRVALAMRWLVTYSRGR-GEK---TMRERLAAELVDAA
RS7_PELCD       VKSRR-VGGSTYQVPVEVRAD-RRNALAIRWLILYARGR-GEK---TMVERLAGELLDAA
RS7_GEOUR       VKSRR-VGGSTYQVPVEVRAE-RRVSLAMRWLVKYANDR-SEK---TVTDKLAGEILDAY
RS7_PELPD       VKSRR-VGGSTYQVPIEVRPD-RRVSLAMRWLIKYSTLR-SEK---TMKDKLAGEILDAY
RS7_SYNAS       VKSRR-VGGSTYQVPTEVAAS-RRVALAIRWIISNAKDR-AEK---TMREKLAGEFIDAA
RS7_SYNFM       VKSRR-VGGATYQVPVEVRHE-RRDALAMRWIINYAKQR-TEK---TMIQRLAGELQDAA
RS7_MAGMM       VRSRR-VGGANYQVPVEVRPV-RRQTLAIRWLIGYARSR-GEK---TMRERLAAELIEAS
RS7_DESPS       VKSRR-VGGATYQVPMEIRQA-RRNALAIRWIISYAKSR-SGK---CMSEKLASEVMDAF
RS7_LEPIC       VKSRR-VGGVTYQVPVEVRPE-RRLALGIRWLIRYSRDR-NEK---GMAAKLAAEFIEAQ
RS7_BDEBA       VRSRR-VGGATYQVPVDVRPS-RRLALAMRWLVEYSRER-GEK---DMAKRLAGEFLDAY
RS7_LAWIP       VKARR-VGGATYQVPMEVRSD-RQISLSIRWLITYARSR-GEK---GMVNKLAAEFLDAF
RS7_DESAG       VKSRR-VGGATYQVPVEVRSD-RQVSLAIRWLITYARAR-GEK---GMVGRLSGELLDAF
RS7_KORVE       VKTRR-VGGANYQVPVEVNAD-RRTSLAIRWLISYSRGR-GEK---GMIDKLANELLDAA
RS7_SOLUE       VKTRR-VGGANYQVPIEVPQN-RRTSLAMRWIITNARTR-PEK---GMAEKLANELNDAA
RS7_THEP1       VRPRR-VGGATYQVPIEVQEP-RRTSLALRWIVEAARAR-KGR---PMKEKLAEEIIAAY
RS7_THEM4       VRPRR-VGGATYQVPIEVQEP-RKTSLALRWIVEAARAK-KGR---PMAEKLGEELVNAF
RS7_PSELT       VRPRR-VGGATYQVPVEVQEP-RKTSLALRWIVAAARAK-KGK---PMYVRLAEEILASY
RS7_FERNB       VRPRR-IGGATYQVPVEVQEP-RKTTLAIRWIVDIARSK-KGK---PMQEKLAEELLNAY
RS7_PETMO       VRSRR-VGGSTYQVPFEVPEN-RATSLAIRWIVTSAQSK-KGR---DMVSKLSQELIDAY
RS7_DEIRA       VRSRR-VGGSTYQVPVEVGPR-RQQSLTLRWMISAVDGR-PER---TAIERLAGEIMDAA
RS7_THET8       VRSRR-VGGANYQVPMEVSPR-RQQSLALRWLVQAANQR-PER---RAAVRIAHELMDAA
RS7_HELHP       VRSRR-VGGATYQVPVEVRPA-RQQSLSIRWLLEATRKR-NER---TMIERLASELVDAA
RS7_ARCB4       VRSRR-VGGATYQVPVEVRAV-RRQTLALRWLIDASRKR-NER---TMVERLANELFEAA
RS7_SULNB       VKSRR-VGGATYQVPIEVRPA-RQQSLGIRWIVEAARKR-NER---TMMERLSNELMDAA
RS7_SULDN       VKSRR-VGGATYQVPVEVRPV-RQLSLAIRWLVDASRKR-NER---TMAERLANELMDAS
RS7_NITSB       VKSRR-VGGATYQVPVEVRPV-RQQSLAIRWIVDAARNR-NER---TMAERLANELLDAA
RS7_CAMHC       VKSRR-VGGATYQVPIEVRPA-RQQALAIRWIIAFARKR-SER---TMIEKLAYELLDAA
RS7_FUSNN       VRSRR-IGGATYQVPVEVKAD-RQQTLAIRWLTTYTRAR-KEY---GMIEKLAAELIAAA
RS7_KINRD       VKSRR-VGGSTYQVPIEVRPT-RSTTLALRWLVGYARQR-REK---TMTERLLNEILDAS
RS7_NOCSJ       VKSRR-VGGATYQVPIEVKGT-RGTTLALRWLVGYAQDR-REK---TMHERLMNEILDAS
RS7_CUTAK       VKSRR-VGGATYQVPVEVKPA-RQTTLAMRWLVNFSRER-REK---TMAERLMNEILDAS
RS7_CORJK       VRSRR-VGGATYQVPVEVRPG-RSTTLALRWLVTFTRQR-REN---TMTERLANEILDAS
RS7_THEFY       VRSRR-VGGATYQVPVEVRAS-RSTTLALRWLVQYARLR-REK---TMTERLMNELVDAS
RS7_ACIC1       VRSRR-VGGATYQVPVEVRPQ-RSTSLALRWIVHYAKLR-REK---TMIERLTNELLDAS
RS7_RENSM       VKSRR-VGGATYQVPVEVKPG-RATALALRWLVGYSKAR-REK---TMTERLRNEILDAC
RS7_STRCO       VKSRR-VGGATYQVPIEVKPG-RANTLALRWLVGYSRAR-REK---TMTERLLNELLDAS
RS7_LEIXX       VRSRR-VGGSTYQVPVEVKPH-RANTLALRWLTSYAKGR-REK---TMTERLANEILDAS
RS7_BIFLO       VRSRR-VGGATYQVPVEVKPN-RANTLSLRWLTDFSRAR-REK---TMAERLANEILDAS
RS7_TROWT       VRSRR-VGGSTYQVPVPVRSH-RADALAIRWLTVYSRAR-REK---SMVDRLASEILDAS
RS7_RUBXD       VRSRR-VGGATYQVPVEVPPR-RANTLALRWLVNFARAR-REK---TMGHRLAGEILDAK
RS7B_AQUAE      VRPRR-VGGATYQVPIEVPER-RQISLAIKWLVQAARERPRGRGQYTMIERLKAELLDAL
RS7_CHLAA       VRPKR-VGGATYQVPVEVKSD-RRYSLAMRWLLMSARAR-TGK---PMVERLAAELIDAY
RS7_HERA2       VRPKR-VGGSTYQVPVEVKSD-RRIALAIRWLLTAARGR-SGK---PMHERLALELVDAF
RS7_LISW6       VKARR-VGGANYQVPIEVRAD-RRSTLGLRWLVNYARLR-GEK---TMEVRVAREIMDAA
RS7_ENTFA       VKARR-VGGSNYQVPVEVRPE-RRTTLGLRWVVNYARLR-GEH---TMEERLAKEIMDAA
RS7_PEDPA       VKARR-VGGSNYQVPIEVRPD-RRTTLGLRWLVNYARLR-GEH---TMPERLAREIMDAA
RS7_LACPL       VKARR-VGGSNYQVPIEVRPD-RKTTLGLRWIVQYARSR-GEH---TMSDRLAREIMDAA
RS7_OENOB       VKARR-VGGSNYQVPIEVRPE-RRTTLGLRWIVQYARLR-SER---TMEERLSKEIMDAA
RS7_STRMU       VRARR-VGGSNYQVPVEVRPE-RRTTLGLRWLVTASRTR-GEH---TMKDRLAKEILDAS
RS7_STAS1       VKARR-VGGSNYQVPVEVRPE-RRTTLGLRWLVNYSRLR-GEK---TMEERLANEILDAA
RS7_OCEIH       VRARR-VGGSNYQVPVEVRPE-RRQALGLRYIVNYSRLR-GEK---TMEERLANEILDAS
RS7_GEOTN       VRARR-VGGANYQVPVEVRPD-RRVSLGLRWLVQYSRLR-GEK---TMEERLANEIMDAA
RS7_LACDB       VKARR-IGGSNYQVPVEVRPE-RQTTLALRWLVSYSRLR-NEH---TMDERLANELIDAS
RS7_ONYPE       VRTRR-MGGQNYQVPSEVRPE-RRQSLGLRWIVKYTKES-NEK---TMEERLAKEIVDAS
RS7_ACHLI       VRARR-IGGQNYQVPVEVRPE-RRQALALRWLVQYAKKR-NEK---TMEERLAKEILDAS
RS7_ALKMQ       VKARR-VGGANYQVPIEVRPE-RRQTLGLRWLVKYTRAR-GEK---GMIEKLAKEIMDAA
RS7_CLOD6       VKARR-VGGANYQVPIEVRPE-RRQTLGLRWLVKYTRAR-GEK---GMVEKLAKEIMDAA
RS7_ALKOO       VKARR-VGGANYQVPVEVRSD-RRQTLGIRWLVNYTRAR-GEK---GMVEKLAKEIIDAS
RS7_DESRM       VKARR-VGGANYQVPVEVRAE-RRQTLGIRWMVLFTRKR-AGK---SMAEKLAAEIMDAA
RS7_MOOTA       VKARR-VGGANYQVPVEVRPE-RRQTLGIRWLVNYARAR-SGK---SMQEKLAAELIDAA
RS7_PELTS       VKARR-VGGANYQVPVEVRHD-RRQTLAIRWLTNYARER-AGK---SMKEKLANEIMDAA
RS7_CLOTE       VKARR-IGGATYQVPLEVRPE-RRQTLGIRWILIAARKR-GEK---YMSERLAGELMDAA
RS7_CLONN       VKARR-IGGATYQVPIEVRAD-RRQTLGIRWIVDASRKR-GEK---YMRERLAGELLDAA
RS7_LACP7       VKARR-IGGATYQVPIEVRPD-RRQALGLRWLTMFSRKR-GEK---TMVDRLAGEILDAA
RS7_DESHY       VKARR-VGGANYQVPIEVRAD-RRQTLGLRWLVGYARKR-SEK---TMEERIAGELMDAA
RS7_SYNWW       VRARR-VGGANYQVPVEVRSD-RRQTLAIRWLVGYARKR-GEK---TMAERLAGEIMDAA
RS7_CARHZ       VRPRR-VGGANYQVPVEVRPE-RRQSLAIRWIVNYARER-NGR---SMEEKLAAEIMDAA
RS7_CALS4       VRPRR-VGGATYQVPMEVRPE-RRLSLGIRWIVEYARQR-SGK---SMMEKLAAEIIDAA
RS7_HUNT2       VKPRR-VGGATYQVPVEVRPE-RRQALALRWLVVYARER-SER---TMKERLAAEIIDAT
RS7_MYCGA       LKVRR-IAGANYQVPTDVSPE-RKVTLALRWLVTLSRKR-HEK---TMLDKIANEIIDAS
RS7_MYCPN       LRVRR-IAGSNYQVPTEVPQD-RKIALALRWIAMFARKR-HEK---TMLEKIANEIIDAS
RS7_MYCPE       LRVRR-VAGSNFQVPTVVSKE-RKQTLGLRWLILSARKR-NEK---SMIEKLAAEIIDAS
RS7_UREPA       LKVRR-VGGSNFQVPTEVTPE-RRQTLGLRWITLYARLR-HEH---TMIEKLAHEIIDAS
RS7_MESFL       LKVRR-IGGANYQVPVEVSDE-RQVTLALRWLINYARLR-NEK---VMTVKLANEIIDAS
RS7_MYCPU       IRTRR-IGGSNYQVPTEVSKR-RQQTLSLRWLTNYARLR-NEK---TMDLRLANEIIDAS
RS7_MYCS5       IRTRR-IGGTNYQVPTEVSKR-RKQALSLRWLVQYARLR-NDK---SMDLRLANEIIDAA
RS7_MYCMO       VKTRR-VGGTNYQVPMEVTKR-RKETLSLRWLIHYSRLR-SEK---TMQECLANEIIDAS
RS7_MYCHJ       VRSRR-IGGTNYQVPMEVRQK-RQQTLALRWLILFARKR-NEK---TMIVKLANEIIDAY
RS7_SYMTH       TRSRR-VGGATYQVPMEVRPE-RRQALGIRWLVQFARAR-GER---TMVERLAAELVDAF
RS7_RICBR       VTSVR-VGGANYQVPTPVDER-RGYALASRWIITAAT---KRS-EKMMIDKLAEELFEAS
RS7_ORITB       VESLR-IGGATYQVPSPVNEL-RSYTLAIKWIINSAA---NRTFEKSMWQKIAEELYEAS
RS7_ANAMM       VRSRR-VGGVTYQIPVEVRED-RSTSLALRWIVKAARTN-RKRTNKTYMSCLCNELLEAY
RS7_ANAPZ       VRSRR-VGGVTYQIPVEVRED-RSTSLALRWIVKAARAS-RKRTNKTYMSCLCHELMEAY
RS7_EHRRW       VRSRR-IGGVTYQVPVEVKED-RSVSLALRWISKAAATA-RKRSNKMYMDCLCNELLEAY
RS7_WOLPM       VRSRR-IGGATYQVPVEVRQD-RAVSLALRWIAKATSAA-RKKSGKTTVDCLQSEILDAY
RS7_WOLTR       VRSRR-IGGATYQVPVEVKKD-RAVSLALRWIVKSASAM-RKKSGKGFFKCLCSEILDAY
RS7_NEOSM       LRSFR-AGGVNYRIPVPIKEE-RSRFIAFGWLLSEAR----KRKGMCSRDRIALELLEAH
RS7_PELUB       VRSRR-VGGATYQVPVEVKTK-RAQALAIRWLVDASR----KRKDKHMSDKIFNELYDAY
RS7_GLOVI       VKARR-VGGATYQVPMEVRQE-RGTSLALRWLVQFSRKR-SGK---SMVDKLSNELMDAA
RS7_SYNJA       VKARR-VGGATYQVPVEVRAE-RGTSLALRWLVTFSRTR-PGR---TMSAKLANEIIDAA
RS7_TRIV2       VKARR-VGGATYQVPMEVRTE-RGTTLALRWLVQFSRSR-PGR---TMASRLANELLDAA
RS7_TRIEI       VKARR-VGGATYQVPMEVRSD-RGTTLALRWLVQYSRSR-GGK---TMAMKLANELMDAA
RS7_ACAM1       VKARR-VGGATYQVPMEVRSD-RGIALALRWIIRFSRQR-PGR---SMVSKLANELIDAA
RS7_THEEB       VKARR-VGGATYQVPMEVRPD-RGISLALRWLVQFSRKR-AGR---SMSAKLANELMDAA
RS7_MICAN       VKARR-VGGATYQVPMEVRSN-RGSTLALRWLVHYARTR-GGK---TMAGKLANEIMDAA
RS7_SYNY3       VKARR-VGGATYQVPMEVRPA-RGTALALRWLVHFSRAR-GGR---TMESKLANEIMDAA
RS7_PROMP       VRARR-VGGATYQVPMEVRQE-RGTAMALRWLVTFSRGR-NGK---SMSQKLAGELMDAA
RR7_PYRYE       VKARR-VGGSTYQVPIEVRAY-RGTNLALRWITKFSRDR-SGK---SMSMKLANEIMDAA
RR7_RHDSA       VKARR-IGGSTYQVPMEVRAF-RGTNLALRWITKYSKER-SGK---SMAMKLANEIMDAV
RR7_GRATL       VKSRR-IGGSTYQVPMEVRAY-RGTNLALRWITMFAHTR-SGR---SMAFRLANEIIDAS
RR7_THAPS       VKARR-IGGSTYQVPIEVSSF-RATNLALRWIIQYSRQR-VGR---TMSIKLASEIIDTA
RR7_PHATC       VKARR-VGGSTYQVPVEVTGF-RATNLSLRWIIRYGDQR-VGR---SMAIKLANEIIDTA
RR7_EMIHU       VKARR-VGGSTYQVPIEIRAY-RGTNISLKWLIEFARER-SGR---GMASKLANEIIDAA
RR7_CYAPA       VKARR-IGGSTYQVPMEVRVD-RGITLALRVVNSFSLQR-LGK---TIAVKLANELIDAA
RR7_CYAM1       VKARR-VGGATYQVPQEVKPY-TGINNALRWIVKYAKDR-SGK---SMAIKLAAEIWDAA
RR7_CYACA       IRSRR-IGGSTYQVPTEVRVH-RGISLSIRWVIKFAKIR-PGK---SMSLKLANELLDAS
RR7_BIGNA       IRSRR-LGGSTTQIPVFINNE-RGVTLAIRWLFQASKNKAGNK--YSIIKRLSSEIVNAS
RR7_EUGLO       LRTQKRKKGQISKISIKTKLE-RRNKIALKFIINSAKKR-SEK---NIIQKLQGEILDAY
RR7_EUGGR       TRK-RRIGGTIYQVPVEVKED-RGTSLALKFIIEKARER-KGR---GISTKLKNEIIDAS
RS7_CARRP       IKK-KKIGGSFYKIPIKINLK-RSLMFSMKWIVKNSKLR-NEN---GYKNKLVGELIDSY
                    :   *    :.                :                      *.    

RR7_CHLRE       KKTGFAIRKKEELHKIAI----------ANAMYAKKPQVIINAINLLVD-----------
RR7_TETOB       EKKGNAIKKKEELHKIAA----------NNAMYSNRPQIILNAVSIVS------------
RR7_STIHE       NKNGAAFRKKEELHKMAL----------SNLMNSRRPDKIVKAITEQSEINDDVY-----
RR7_JASNU       KGKGGAIRKKEETHKMAE----------ANRTFAHFR-----------------------
RR7_PELHO       KGKGNAIRKKEETYRMAE----------ANRTFANFR-----------------------
RR7_ORYSJ       KGGGGAIRKKEATHRMAE----------ANRALAHFR-----------------------
RR7_PHYPA       RDSGEAIRKKEETHRMAE----------ANRAFAHFR-----------------------
RR7_ANTAG       RDNGNAVRKREETHRMAE----------ANRAFAHFR-----------------------
RR7_HUPLU       ENSGNAIRKREETHRMAE----------ANRAFAHLR-----------------------
RR7_ANGEV       KNNGSAVRKKEETHRMAE----------ANKAFAHFR-----------------------
RR7_CHAGL       RDTGNTIRKKEETHRMAE----------SNRAFAHFR-----------------------
RR7_ZYGCR       RQTGNAIRKREETHRMAE----------ANRAFAHFR-----------------------
RR7_STAPU       RQTGNAIRKREETHRMAE----------ANKAFAHYR-----------------------
RR7_CRYJA       REKGNAIRKKEEIHKMAE----------SNKAFAHYH-----------------------
RR7_GNEPA       KGKGKAIRKKEEIHKMAE----------ANRAFADYL-----------------------
RR7_ADICA       RNSGSAIRKKEETHKVAE----------ANKAFAHFR-----------------------
RR7_ANEMR       KDNGTAVRRKEETHKMAE----------ANRAFAHFR-----------------------
RR7_PSINU       RNTGSAIRKKEETHKMAE----------ANKAFAHLR-----------------------
RR7_CHAVU       KDTGGAIRKKEETHRMAE----------ANRAFAHFRY----------------------
RR7_CHLAT       NEVGNAIRKREETHRMAE----------ANKAFSHYRF----------------------
RR7_NEPOL       NRIGNAVRKRDEMHRMAE----------ANKAFAHIRV----------------------
RR7_OSTTA       NNTGAAIRRREETHRMAE----------ANKAFAHFRF----------------------
RR7_OLTVI       NNTGSAIKKRDEVHRMAE----------ANQAFAKFRF----------------------
RR7_TUPAK       KKTGGAIKKRDDVHRMAE----------ANKAFAKFRF----------------------
RR7_CHLVU       KNSGLAVRKRDEIHKMAD----------ANKAFAKYRF----------------------
RR7_PLETE       KNIGNAIRKKDEIAKMAQ----------ANRAYARF------------------------
RS7_TREDE       NNTGTAFKKKEEVHRMAE----------ANKAFAHFRW----------------------
RS7_TREPA       HSTGTAFKRKEDTHRMAE----------ANKAFSHYRW----------------------
RS7_BORBU       NSTGAAFKKKEDTHRMAE----------ANKAFTHYRW----------------------
RS7_CHLPN       NKQGATIKKREDTHRMAE----------ANKAFAHYKW----------------------
RS7_PARUW       NNQGTTIKKKDDTHRMAE----------ANKAYAHYKW----------------------
RS7_RHOBA       KKEGAAYTKRENTHRMAD----------ANKAFAHFAW----------------------
RS7_DEHM1       REQGAAVKKREETHKMAE----------ANRAFVHYRW----------------------
RS7_PORGI       NNQGAAFKRKEDMHRMAE----------ANRAFAHFRF----------------------
RS7_CYTH3       KGEGAAVKKRDDVHRMAE----------ANKAFSHFRF----------------------
RS7_GRAFK       KEEGAAVKKRVDTHKMAE----------ANKAFSHFRF----------------------
RS7_SULMW       KKEGAAFKIRENIHKMAE----------ANKAFSHLKF----------------------
RS7_CHLCH       NDQGASVKKRDEVHRMAE----------ANKAFAHFRF----------------------
RS7_CHLTE       NEQGASVKKRDEVHRMAE----------ANKAFAHFRF----------------------
RS7_SALRD       RGEGGAVKKKDDTHRMAE----------SNKAFAHFQF----------------------
RS7_ECOLI       ENKGTAVKKREDVHRMAE----------ANKAFAHYRWLSLRSFSHQAGASSKQPALGYL
RS7_BUCAP       ENKGTSVKKKEEVHKMAE----------ANKAFAHYRW----------------------
RS7_BUCBP       ENKGSAVKKREDVHRMAE----------ANKAFAHYRW----------------------
RS7_BUCCC       ENKGAAVRKREEVHKMAD----------ANKAFAHYRW----------------------
RS7_BAUCH       EHKGAAVKKREEVHRMAD----------ANKAFAHYRW----------------------
RS7_WIGBR       ENKGTAVKKREEVHRMAE----------ANKAFAHYRW----------------------
RS7_BLOFL       EGKGNAVKKREEVHRLAE----------SNKAFAHYRW----------------------
RS7_BLOPB       EGKGHAVKKREEIHRIAE----------SNKAFAHYRW----------------------
RS7_PHOPR       DNKGTAVKKREDVHRMAD----------ANKAFAHYRW----------------------
RS7_SHESH       DNKGTAVKKREDVHRMAE----------ANKAFAHYRW----------------------
RS7_PSYIN       DNKGSAVKKREDVHRMAD----------ANKAFAHYRW----------------------
RS7_PSEPF       EGKGAAVKKREDVHRMAE----------ANKAFSHYRF----------------------
RS7_MARMS       ENKGSAVKKREDVHRMAE----------ANKAFSHYRF----------------------
RS7_ALCBS       EGKGAAMKKREDVHRMAE----------ANKAFSHFRF----------------------
RS7_MARHV       DSKGAAVKKREDVHRMAE----------ANKAFSHFRF----------------------
RS7_CHRSD       EGKGAAVKKREDVHRMAD----------ANKAFSHYRF----------------------
RS7_SACD2       QSKGGAVKKREDVHRMAE----------ANKAFSHFRF----------------------
RS7_PSYWF       EGKGSAVKKRDEVHRMAD----------ANKAFSHYRF----------------------
RS7_NITOC       EGKGTAVKKREDTHRMAE----------ANKAFAHYRW----------------------
RS7_LEGPH       ENKGSAVKKREDTHKMAK----------ANQAFAHFRWN---------------------
RS7_HYDCU       ENRGSAIKKKEDTHRMAE----------ANKAFSHFRW----------------------
RS7_COXBR       EGRGGAIKKREDVHRMAK----------ANQAFAHYRW----------------------
RS7_DICNV       EERGAAVKKRDETHRMAE----------ANKAFAHFRW----------------------
RS7_FRAP2       EGRGAAVKKREDTHKMAE----------ANKAFAHFRW----------------------
RS7_XYLFT       ESRGGAIKKRDETHRMAE----------ANKAFAHYRW----------------------
RS7_METCA       ESRGSAVKKREDTHRMAE----------ANKAFSHYRW----------------------
RS7_METPP       EGRGGAMKKRDEVHRMAE----------ANKAFSHFRF----------------------
RS7_JANMA       ESRGGAMKKRDEVHRMAE----------ANKAFSHFRF----------------------
RS7_POLAQ       EGRGGAMKKREEVHRMAE----------ANKAFSHFRF----------------------
RS7_AROAE       EGRGSAMKKREEVHRMAE----------ANKAFSHYRF----------------------
RS7_DECAR       ENRGGAVKKRDEVHRMAE----------ANKAFAHFRF----------------------
RS7_NITMU       EGRGGAVKKREEVHRMAE----------ANKAFAHYRF----------------------
RS7_METFK       EGRGAAIKKREEVHRMAE----------ANKAFSHFRF----------------------
RS7_CHRVO       EGRGGAMKKRDEVHRMAE----------ANKAFSHFRF----------------------
RS7_BORA1       EGRGAAMKKREDTHKMAE----------ANKAFSHFRW----------------------
RS7_HALHL       ESRGTAVKKREDTHRMAE----------ANKAFSHYRW----------------------
RS7_CHESB       SNRGTAVKKREDTHKMAE----------ANRAFSHYRW----------------------
RS7_MARMM       ANRGTAVKKREDTHRMAE----------ANRAFSHYRW----------------------
RS7_RHOP5       NNRGNAVKKREDVHKMAE----------ANRAFSHYRW----------------------
RS7_HYPNA       QGRGNAVKKREDTHRMAD----------ANKAFAHYRW----------------------
RS7_AZOC5       NNRGNAVKKREDTHRMAE----------ANRAFSHYRW----------------------
RS7_CAUSK       NNRGTAVKKREDTHKMAE----------ANRAFSHYRW----------------------
RS7_PARL1       NNRGSAVKKREDTHRMAE----------ANRAFSHYRW----------------------
RS7_MAGSA       NNRGAAVKKREDTHRMAE----------ANKAFSHYRW----------------------
RS7_RHORT       SNRGGAVKKREDTHRMAD----------ANKAFSHYRW----------------------
RS7_PARDP       NGRGTAVKKREDTHKMAD----------ANKAFSHYRW----------------------
RS7_ZYMMO       NNRGNAVKKREDTHRMAE----------ANRAFSHYRW----------------------
RS7_ACICJ       NNRGAAVKKREDTHRMAE----------ANKAFSHYRW----------------------
RS7_MYXXD       NNRGNAVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_SORC5       QNRGNAVKKRDDTHKMAE----------ANKAFAHYRW----------------------
RS7_PELCD       ANRGAAVKKREDTHRMAE----------ANKAFAHYRW----------------------
RS7_GEOUR       NNRGAAVKKREDTHKMAE----------ANRAFAHYRW----------------------
RS7_PELPD       NSRGAAVKKREDVHKMAE----------ANRAFAHYRW----------------------
RS7_SYNAS       NNRGGSIKKRESVHKMAE----------ANKAFAHYRF----------------------
RS7_SYNFM       QNRGGSVKKREDTHRMAE----------ANKAFAHYRW----------------------
RS7_MAGMM       QGRGATIKKRDDTHRMAE----------ANKVFAHYRW----------------------
RS7_DESPS       NNRGAAVKKRDDTHRMAE----------ANKAFAHYRW----------------------
RS7_LEPIC       KGTGSAIKKKEDIRKMAE----------ANKAFSHYRW----------------------
RS7_BDEBA       NNRGNAIKKKDDVHRMAE----------SNKAFSHYNW----------------------
RS7_LAWIP       NNRGGAVKKKEDTHRMAE----------ANKAFAHYRW----------------------
RS7_DESAG       NNRGGAVKKKDDTHRMAE----------ANKAFAHFRW----------------------
RS7_KORVE       NGRGAAIKKKEDVHRMAE----------ANKAFAHYRW----------------------
RS7_SOLUE       NLRGGAIKKRDDVHRMAE----------ANKAFAHYRW----------------------
RS7_THEP1       NNTGTAIKKKEDTHRMAE----------ANRAFAHYRW----------------------
RS7_THEM4       NNTGTAIKKKEDVHRMAE----------ANRAFAHFRW----------------------
RS7_PSELT       QGTGTAMKKKEDVHKMAE----------ANRAFAHLRW----------------------
RS7_FERNB       NNTGAAIKKREDVHKMAE----------ANRAFAHFRW----------------------
RS7_PETMO       NNTGPSVKKKEDVHRMAE----------ANRAFAHFRW----------------------
RS7_DEIRA       QGRGGAIKKKDDVERMAE----------ANRAYAHYRW----------------------
RS7_THET8       EGKGGAVKKKEDVERMAE----------ANRAYAHYRW----------------------
RS7_HELHP       NERGAAFKKKEDVHKMAE----------ANKAFAHYRW----------------------
RS7_ARCB4       NERGASFKKKEDVHRMAE----------ANKAFAHYRW----------------------
RS7_SULNB       TEKGSAFKKKEDTYKMAE----------ANKAFAHYRW----------------------
RS7_SULDN       SDKGNAFKKKEDTYRMAE----------ANKAFAHYRW----------------------
RS7_NITSB       NKRGAAYKKKEDTYKMAE----------ANKAFAHYRW----------------------
RS7_CAMHC       NSKGSSFKKKEDTYKMAE----------ANKAFAHYRW----------------------
RS7_FUSNN       NNEGATIKKKEDTYKMAE----------ANRAFAHYRV----------------------
RS7_KINRD       NGLGAAVKRREDTHKMAE----------SNRAFAHYRW----------------------
RS7_NOCSJ       NGLGAAVKKREDTHKMAE----------SNKAFAHYRW----------------------
RS7_CUTAK       NGLGASVKRREDTHKMAE----------ANRAFAHYRW----------------------
RS7_CORJK       NGLGASVKRREDTHKMAE----------ANRAFAHYRW----------------------
RS7_THEFY       NGLGAAVKRREDTHKMAE----------SNKAFAHYRW----------------------
RS7_ACIC1       NGLGASVKRREDTHKMAE----------SNRAFAHYRW----------------------
RS7_RENSM       NGLGAAVKRREDTHKMAE----------ANRAFAHYRW----------------------
RS7_STRCO       NGLGAAVKKREDTHKMAE----------SNKAFAHYRW----------------------
RS7_LEIXX       NGLGAAVKRREDTHKMAE----------SNKAFAHYRW----------------------
RS7_BIFLO       NGLGASVKRREDTHKMAE----------ANKAFAHYRW----------------------
RS7_TROWT       NGVGATVKCKEDTHRMAE----------SNRAFAHYRW----------------------
RS7_RUBXD       DNIGASIRKKEETHRMAE----------ANRAFAHYRW----------------------
RS7B_AQUAE      NERGGAYKKKEETHRMAH----------ANMVFSHFRW----------------------
RS7_CHLAA       NNTGTTIKRKEDVHRMAE----------ANRAFAHYGRL---------------------
RS7_HERA2       NNTGATVKRREEVHRMAE----------ANRAFSHYARF---------------------
RS7_LISW6       NNTGASVKKREDTHKMAD----------ANRAFAHYRW----------------------
RS7_ENTFA       NNTGASVKKREDTHKMAD----------ANRAFAHYRW----------------------
RS7_PEDPA       NNTGASVKKREDTHKMAE----------ANRAFAHYRW----------------------
RS7_LACPL       NNTGASVKKREDTHRMAE----------ANRAFAHYRW----------------------
RS7_OENOB       NGTGASVKKRDDTHKMAE----------ANRAFAHYRW----------------------
RS7_STRMU       NNTGASVKKREDTHRMAE----------ANRAFAHFRW----------------------
RS7_STAS1       NNTGGAVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_OCEIH       NNTGAAVKRREDMHKMAE----------ANKAFAHYRW----------------------
RS7_GEOTN       NNTGAAVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_LACDB       NNTGSAVKKREDVHRMAE----------ANRAFAHYRF----------------------
RS7_ONYPE       LGNGVLVKKREETHRMAE----------ANKAFAHYRW----------------------
RS7_ACHLI       QGTGAAVKKREEVHKMAE----------ANKAFAHYRW----------------------
RS7_ALKMQ       NNTGSSVKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_CLOD6       NNTGASVKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_ALKOO       NSTGATVKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_DESRM       NNTGATVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_MOOTA       NNTGGAVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_PELTS       AGTGGAVKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_CLOTE       NNLGAAVKKREETHKMAE----------ANKAFAHYRY----------------------
RS7_CLONN       NNTGAAVKKREDTHKMAE----------ANKAFAHYRY----------------------
RS7_LACP7       ANTGSAVKRKEDMHKMAD----------ANKAFAHYRW----------------------
RS7_DESHY       NNTGGSIKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_SYNWW       NHTGAAVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_CARHZ       NGVGGAVKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_CALS4       NNTGGSVKKKEDTHRMAE----------ANKAFAHYRW----------------------
RS7_HUNT2       NNMGGAYKKKEDTHKMAE----------ANKAFAHYRW----------------------
RS7_MYCGA       NNTGASVKKREDTHKMAE----------ANKAFAHMRM----------------------
RS7_MYCPN       NNTGAAIKKKDDTHKMAE----------ANKAFAHMRW----------------------
RS7_MYCPE       KGTGAAFKKKEDTHKMAE----------ANKAFAHLRF----------------------
RS7_UREPA       NNVGAAIKKKEDTHKMAE----------ANKAFAHLRW----------------------
RS7_MESFL       NNMGGSVKKREDTHKMAE----------ANKAFAHYRW----------------------
RS7_MYCPU       NKTGGAIKKREDTHKMAE----------ANRAFAHFRW----------------------
RS7_MYCS5       NKTGGAIKKREDTHKMAE----------ANKAFAHFRW----------------------
RS7_MYCMO       NKTGSSIKKREDTHKMAE----------ANKAFAHFRW----------------------
RS7_MYCHJ       NKTGGAFKKKEDTHKMAE----------ANRAFAHFKW----------------------
RS7_SYMTH       NNTGGAVKKKEEVHRMAE----------ANKPFAHYRW----------------------
RS7_RICBR       NNRGVAIKKKEDTHKMAE----------ANKAFSHFSPKKTKQGN---------------
RS7_ORITB       NGRGGAVKKKDDNHKMAE----------ANQAFSHLITKRRSRGN---------------
RS7_ANAMM       NKRGSACKMKEEKFRMAE----------ANKAFSHFRF----------------------
RS7_ANAPZ       NKRGGACKIKEEKYRMAE----------ANKAFSHFRF----------------------
RS7_EHRRW       NKRGGAYKIREEKYKMAE----------ANKAFSHFRFN---------------------
RS7_WOLPM       NKRGGAFKMCEEKYKMAE----------ANKAFSHLRF----------------------
RS7_WOLTR       NKRGGAFKMCEEKYKMAE----------ANKAFSHLRF----------------------
RS7_NEOSM       SGHGGAFRKFEENVKVAE----------SGRAFSHFRFFNTGGARRSNPSNNIGGNR---
RS7_PELUB       EKKGSAVKKREDVHKMAE----------SNKAFAHFRW----------------------
RS7_GLOVI       NDTGSAVRKREETHRMAE----------ANKAFAHYRY----------------------
RS7_SYNJA       NETGNAIRRREEVHRMAE----------ANKAFAHYRY----------------------
RS7_TRIV2       NESGNAIRKREETHRMAE----------ANKAFAHYRY----------------------
RS7_TRIEI       NETGSAIRKREETHKMAE----------ANKAFAHYRY----------------------
RS7_ACAM1       NETGAAIRKREETHRMAE----------ANKAFAHYRY----------------------
RS7_THEEB       NETGSTIRKREETHKMAE----------ANKAFAHYRY----------------------
RS7_MICAN       NETGGTIKKREETHRMAE----------ANKAFAHYRY----------------------
RS7_SYNY3       NETGAAIKKREETHRMAE----------ANKAFAHYRY----------------------
RS7_PROMP       NETGSAVKKREDTHKMAE----------ANKAFAHYRY----------------------
RR7_PYRYE       NETGNSIRKREDTHRMAE----------ANKAFAHYRY----------------------
RR7_RHDSA       NETGNSVRKREEVHKMAE----------ANKAFAHYRF----------------------
RR7_GRATL       NESGNTIRKREETHRMAE----------ANKAFAHYRY----------------------
RR7_THAPS       NDIGNTIKKKEETHKMAD----------ANKAFAHFRY----------------------
RR7_PHATC       NDIGNTIKKKEETHKMAE----------ANKAFAHFRY----------------------
RR7_EMIHU       KNAGGSIRRKEQTHKMAE----------ANKAFAHFRY----------------------
RR7_CYAPA       NETGNTIKKREEMHRMAE----------ANKAFVHYRY----------------------
RR7_CYAM1       HGTGGAIRKKEETHRMAE----------ANKAFAHYR-----------------------
RR7_CYACA       KNLGNSIRKKEDTHKMAE----------ANRAFAHYRY----------------------
RR7_BIGNA       NGMGEAIKKRDEMHRMAE----------ANKTIVKYNVL---------------------
RR7_EUGLO       NNTGAAVQKKEEIEKSKSPVNNNKKFISKNKKSKNKKQKKRLKRKKNIY-----------
RR7_EUGGR       NNTGEAVKKKEEIHKTAE----------ANKAFSNMKF----------------------
RS7_CARRP       YNNSLSTKQKDELNKIID----------QNKAYSNFKI----------------------
                   .          :              .                              

RR7_CHLRE       -
RR7_TETOB       -
RR7_STIHE       -
RR7_JASNU       -
RR7_PELHO       -
RR7_ORYSJ       -
RR7_PHYPA       -
RR7_ANTAG       -
RR7_HUPLU       -
RR7_ANGEV       -
RR7_CHAGL       -
RR7_ZYGCR       -
RR7_STAPU       -
RR7_CRYJA       -
RR7_GNEPA       -
RR7_ADICA       -
RR7_ANEMR       -
RR7_PSINU       -
RR7_CHAVU       -
RR7_CHLAT       -
RR7_NEPOL       -
RR7_OSTTA       -
RR7_OLTVI       -
RR7_TUPAK       -
RR7_CHLVU       -
RR7_PLETE       -
RS7_TREDE       -
RS7_TREPA       -
RS7_BORBU       -
RS7_CHLPN       -
RS7_PARUW       -
RS7_RHOBA       -
RS7_DEHM1       -
RS7_PORGI       -
RS7_CYTH3       -
RS7_GRAFK       -
RS7_SULMW       -
RS7_CHLCH       -
RS7_CHLTE       -
RS7_SALRD       -
RS7_ECOLI       N
RS7_BUCAP       -
RS7_BUCBP       -
RS7_BUCCC       -
RS7_BAUCH       -
RS7_WIGBR       -
RS7_BLOFL       -
RS7_BLOPB       -
RS7_PHOPR       -
RS7_SHESH       -
RS7_PSYIN       -
RS7_PSEPF       -
RS7_MARMS       -
RS7_ALCBS       -
RS7_MARHV       -
RS7_CHRSD       -
RS7_SACD2       -
RS7_PSYWF       -
RS7_NITOC       -
RS7_LEGPH       -
RS7_HYDCU       -
RS7_COXBR       -
RS7_DICNV       -
RS7_FRAP2       -
RS7_XYLFT       -
RS7_METCA       -
RS7_METPP       -
RS7_JANMA       -
RS7_POLAQ       -
RS7_AROAE       -
RS7_DECAR       -
RS7_NITMU       -
RS7_METFK       -
RS7_CHRVO       -
RS7_BORA1       -
RS7_HALHL       -
RS7_CHESB       -
RS7_MARMM       -
RS7_RHOP5       -
RS7_HYPNA       -
RS7_AZOC5       -
RS7_CAUSK       -
RS7_PARL1       -
RS7_MAGSA       -
RS7_RHORT       -
RS7_PARDP       -
RS7_ZYMMO       -
RS7_ACICJ       -
RS7_MYXXD       -
RS7_SORC5       -
RS7_PELCD       -
RS7_GEOUR       -
RS7_PELPD       -
RS7_SYNAS       -
RS7_SYNFM       -
RS7_MAGMM       -
RS7_DESPS       -
RS7_LEPIC       -
RS7_BDEBA       -
RS7_LAWIP       -
RS7_DESAG       -
RS7_KORVE       -
RS7_SOLUE       -
RS7_THEP1       -
RS7_THEM4       -
RS7_PSELT       -
RS7_FERNB       -
RS7_PETMO       -
RS7_DEIRA       -
RS7_THET8       -
RS7_HELHP       -
RS7_ARCB4       -
RS7_SULNB       -
RS7_SULDN       -
RS7_NITSB       -
RS7_CAMHC       -
RS7_FUSNN       -
RS7_KINRD       -
RS7_NOCSJ       -
RS7_CUTAK       -
RS7_CORJK       -
RS7_THEFY       -
RS7_ACIC1       -
RS7_RENSM       -
RS7_STRCO       -
RS7_LEIXX       -
RS7_BIFLO       -
RS7_TROWT       -
RS7_RUBXD       -
RS7B_AQUAE      -
RS7_CHLAA       -
RS7_HERA2       -
RS7_LISW6       -
RS7_ENTFA       -
RS7_PEDPA       -
RS7_LACPL       -
RS7_OENOB       -
RS7_STRMU       -
RS7_STAS1       -
RS7_OCEIH       -
RS7_GEOTN       -
RS7_LACDB       -
RS7_ONYPE       -
RS7_ACHLI       -
RS7_ALKMQ       -
RS7_CLOD6       -
RS7_ALKOO       -
RS7_DESRM       -
RS7_MOOTA       -
RS7_PELTS       -
RS7_CLOTE       -
RS7_CLONN       -
RS7_LACP7       -
RS7_DESHY       -
RS7_SYNWW       -
RS7_CARHZ       -
RS7_CALS4       -
RS7_HUNT2       -
RS7_MYCGA       -
RS7_MYCPN       -
RS7_MYCPE       -
RS7_UREPA       -
RS7_MESFL       -
RS7_MYCPU       -
RS7_MYCS5       -
RS7_MYCMO       -
RS7_MYCHJ       -
RS7_SYMTH       -
RS7_RICBR       -
RS7_ORITB       -
RS7_ANAMM       -
RS7_ANAPZ       -
RS7_EHRRW       -
RS7_WOLPM       -
RS7_WOLTR       -
RS7_NEOSM       -
RS7_PELUB       -
RS7_GLOVI       -
RS7_SYNJA       -
RS7_TRIV2       -
RS7_TRIEI       -
RS7_ACAM1       -
RS7_THEEB       -
RS7_MICAN       -
RS7_SYNY3       -
RS7_PROMP       -
RR7_PYRYE       -
RR7_RHDSA       -
RR7_GRATL       -
RR7_THAPS       -
RR7_PHATC       -
RR7_EMIHU       -
RR7_CYAPA       -
RR7_CYAM1       -
RR7_CYACA       -
RR7_BIGNA       -
RR7_EUGLO       -
RR7_EUGGR       -
RS7_CARRP       -