CLUSTAL format seed alignment for MF_00484

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLGA_CHLMU       --------------------------------MKITHTAIEFAPVIKAGGLGDALYGLAK
GLGA_CHLTR       --------------------------------MKIIHTAIEFAPVIKAGGLGDALYGLAK
GLGA_CHLPN       --------------------------------MRIVQVAVEFTPIVKVGGLGDAVASLSK
GLGA_GEOSE       --------------------------------MKVLFAVSECAPFAKSGGLADVAGALPK
GLGA_BACSU       --------------------------------MKILFAVSECTPFVKSGGLADVAGALPK
GLGA_CLOAB       --------------------------------MKILFASSESYPFIKTGGLGDVSYALPK
GLGA_LACLA       --------------------------------MKVLFASSECAPFFKTGGLGDVAGALPK
GLGA_STRPN       --------------------------------MKILFVAAEGAPFSKTGGLGDVIGALPK
GLGA_BACHD       --------------------------------MNVLHVASECNPFFKTGGLADVLGSLPK
GLGA_THEMA       --------------------------------MKVVFVSYEVFPFAKVGGLADVAGTLPK
GLGA_AQUAE       --------------------------------MRVLFCSSEIYPYAKTGGLADFSFCLIK
GLGA_VIBCH       -----------------------------MEQFNVWFTVSEVQGLVKSGGLADVAKALPQ
GLGA_DEIRA       --------------------------------MRVLHLASEVFPFSRSGGLGDVLGALPA
GLGA_THECA       -------------------------------MIRVLHLAPEAYPLAKVGGLADVVGALPK
GLGA_PASMU       --------------------------------MKVLHACSELYPLLKTGGLADVMGALPF
GLGA_HAEIN       --------------------------------MKILHVCSELYPLLKTGGLADVLGALPQ
GLGA_ECOLI       --------------------------------MQVLHVCSEMFPLLKTGGLADVIGALPA
GLGA_RHITR       --------------------------------MKVLSVSSEVFPLIKTGGLADVVGALPI
GLGA1_AGRFC      --------------------------------MNVLSVSSEIYPLIKTGGLADVVGALPI
GLGA1_RHIME      --------------------------------MNILSVASEVYPLVKTGGLADVVGALPS
GLGA_RHILO       --------------------------------MQVLSVTPEIFPLIKTGGLADVTGALPV
GLGA2_RHIME      --------------------------------MQILSVTAEIFPLVKTGGLADVAGSLPK
GLGA_RHOS4       ---------------------------METARGRVLSVASECVPLLKTGGLADVVGALPG
GLGA_PSEAE       MGHSVAGVCLEEPAVLTAFPSLLHPQDPPQQRDRILFVTAELSDFVKVGGLGDFSAALPR
GLGA1_SYNY3      --------------------------------MKILFVAAEVSPLAKVGGMGDVVGSLPK
GLGA2_SYNY3      --------------------------------MYIVQIASECAPVIKAGGLGDVIYGLSR
GLGA_METJA       --------------------------------MKIVILAPTITPIVSYGGLGDVMRDLPK
                                                   :             **:.*    *  

GLGA_CHLMU       ALAVNHT---TEVVIPLYPKLFTSLHEQDLFATQKI----PYFFAGEQEATAFSYFYEGI
GLGA_CHLTR       ALAANHT---TEVVIPLYPKLFTLPKEQDLCSIQKL----SYFFAGEQEATAFSYFYEGI
GLGA_CHLPN       ELAKQND---VEVLLPHYPLISKFSSSQ-VLSERSF----YYEFLGKQQASAISYSYEGL
GLGA_GEOSE       ELRRLG--IDARVMLPKY---ETIAPEWKKKMKKVA-ELIVPVGWRRQYCGVEELRHDG-
GLGA_BACSU       ALARLG--NEVAVMLPKY---SQIPEPWKKRMKKQA-ECTVAVGWRQQYCGIEHMAEND-
GLGA_CLOAB       ALRKIG--IDARVIIPKY---SDIPEYFRYNTHHIA-SFGVPVGWRSQYGGLEYYEYDG-
GLGA_LACLA       ELAKKSEIDSVAVILPYFK--NEMKEEYRSLLKDEF-YDFVDVGWRHEYVGVKSLEKEG-
GLGA_STRPN       SLVKAG--HEVAVILPYY---DMVEAKFGNQIEDVL-HFEVSVGWRRQYCGIKKTVLNG-
GLGA_BACHD       ALIKQG--INVSVILPKY---GHLSDEWQNQLTLKK-SFTVSVTWRNQYCGLEQFVDQG-
GLGA_THEMA       YLKKHG--VDVTIVMPKHRIVEKNAEKFGYEIKKVAESLSVSHVKTDQKFDIYESVLPGS
GLGA_AQUAE       YLKKYG--VKVKGVMPYY---KTLKAENLRKTDKGV-----TLNLNGKDYTFEVYESED-
GLGA_VIBCH       ALKALH--QQVAIALPAY---RSVPGKEDAELVLET----ELTHWPHTQYRVLKRDLDG-
GLGA_DEIRA       VQARLGEDAEVTVLSPWYASLQGEPQELWRGEAWG------------EQAWLGELRQDG-
GLGA_THECA       ALRPLG--VEAHVLLPWHGGLEARRVGEVAFAFFGR----------EERAPLGERVEGG-
GLGA_PASMU       AQKEIGI--DARIVLPAYPAIKAGIPETTVVSEFD--------NFAGH-IVLRYGEYKG-
GLGA_HAEIN       AQNQIGL--DARFLLPAYPAITTGIPNTQVVAEFD--------NFAGH-VVLRYGEYNG-
GLGA_ECOLI       AQIADGV--DARVLLPAFPDIRRGVTDAQVVSRRD--------TFAGH-ITLLFGHYNG-
GLGA_RHITR       ALKPYGV--ETKTLIPGYPAVMKAIRDPVVRLELP--------DLLGEAATILEVEHAG-
GLGA1_AGRFC      ALEAHGV--RTRTLIPGYPAVKAAVTDPVKCFEFT--------DLLGEKADLLEVQHER-
GLGA1_RHIME      ALLPHGV--RTRTLVPGYPSVLKKLKKKKPVGRFD--------NLFGHPATVLAAEVNG-
GLGA_RHILO       ALAAKGV--TMRTLIPGFPAVMEGFKKRKAVYQYP--------LLQGGKASIHAVQIAG-
GLGA2_RHIME      ALRAHGI--HTRSFVPGYPGVMRALSDATPVAEFE--------SLFGERATLIAARAHG-
GLGA_RHOS4       ALAAEGW--EMRVLMPCYRPLKWRLEEMEEVFAEE--------DLFGGPGRVMAGEVAG-
GLGA_PSEAE       VLKREH---SVRVLLPGYRQVLERCRDLRIIGSLPG------RAAIPPCEIGLVTLDDG-
GLGA1_SYNY3      VLHQLGH--DVRVFMPYYGFIGDKIDVPKEPVWKGE------AMFQQFAVYQSYLPDTK-
GLGA2_SYNY3      ELELRGH--CVELILPMYDCMRYDHIWGLHDAYRNL-------EVPWYGSSIFCDVFCGW
GLGA_METJA       FLKKGNE--VVVLTLNHYNRYFTLPYEDIKKITVIY-------KGAKITFDVLRTKHPTT
                                  .                                          

GLGA_CHLMU       KVTLLKLDSQPELFEEAETIYTND------DAFRFCAFSAAAAAYIQK-----EGADIVH
GLGA_CHLTR       KVTLFKLDTQPELFENAETIYTSD------DAFRFCAFSAAAASYIQK-----EGANIVH
GLGA_CHLPN       TLTIITLDSQIELF-STTSVYSEN------NVVRFSAFAAAAAAYLQEA----DPADIVH
GLGA_GEOSE       -VIYYFIDNEYYFKRPQ--LYGHY-----DDGERFAYFCRAVLEVLP--EIQ-FQPDVIH
GLGA_BACSU       -VNYYFIDNEYYFNRDS--LYGHY-----DDGERFAFFSRAVLEAAK--VVN-VQADIVH
GLGA_CLOAB       -VPFYFIDNDYYFKRSG--LYGYY-----DDGERFAYFSRGVLQAIT--YMQDFNPDIIQ
GLGA_LACLA       -VKYYFLDNEHYFGRGQ--LYGYG-----DDGERFAFFDLALCQLLE--KLD-FIPDVLH
GLGA_STRPN       -VTFYFIDNQYYFFRGH--VYGDF-----DDGERFAFFQLAAIEAME--RID-FIPDLLH
GLGA_BACHD       -VTYYFIDNEYYFKRER--LYGYL-----DEAERFTFFNHAVLSSLP--FLD-ESPDLIH
GLGA_THEMA       DVKTYFVANDYYFSAED--VYAGP-----DLGEQAIFFCAATLDLVK--HLD-LKPDIVH
GLGA_AQUAE       ---CYFLRNDELFGRDY--IYGPPGWGYEDNDIRFGGFSRAVSELIS--TGQ-LEADVVH
GLGA_VIBCH       -VPIYLIDCPAYFDRPA--LYAENNQAYADNGERFGFFSAACLDVLP--KLG-IQPDIIH
GLGA_DEIRA       -VRYLFLGLNEFQR--------PGLY-HPDDVERFCAFGRAAL---PALDAVGVTPDVLH
GLGA_THECA       -VRFLLLGVEGFGR--------ERVYGYPDDAERYLRFALAA-------KEVARGYDLVH
GLGA_PASMU       -LGVYLIDAPHLYQREGNPYHDQWYNDYADNYKRFALLGWVAAELAT-GLDSWWHADVVH
GLGA_HAEIN       -VGIYLIDAPHLYGREGNPYHDAYYNDYGDNYKRFALLGWVGAELAT-GLDSWWRAEVVH
GLGA_ECOLI       -VGIYLIDAPHLYDRPGSPYHDTNLFAYTDNVLRFALLGWVGAEMAS-GLDPFWRPDVVH
GLGA_RHITR       -ISFLVLDAPAYYSRTGGPYVDATGKDYPDNWRRFAALSLAGAEIAA-GLLPGWRPDLVH
GLGA1_AGRFC      -LDLLILDAPAYYERSGGPYLGQTGKDYPDNWKRFAALSLAAARIGA-GVLPGWRPDMVH
GLGA1_RHIME      -VDLLVLDQPALYARDGGPYLDSTGRDYPDNFRRFAALSLAAAEIAGNGIIPNWKPDIVH
GLGA_RHILO       -LDLFVLDAPHLFDRPGGPYGNASGADWPDNWRRFAALSQAGADIAG-GAISGYLPEIVH
GLGA2_RHIME      -LDLFVLDAPAFYDRQGALYVDRHGRDYADNWKRFAAFSLVASQIAR-GLVPNWRPHIIH
GLGA_RHOS4       -RKMLLLDAPHLYDREGGPYAGPDG-DWGDNAQRFAALSWIGARIAREGLGDGWRPDVVH
GLGA_PSEAE       -LEVMLVLCPLLYEREGTPYMDDQGNDWPDNHLRFARLCLAAAEIAGGRGAQGWQPGLVH
GLGA1_SYNY3      -IPLYLFGHPAFDSR--------RIYGGDDEAWRFTFFSNGAAEFAW----NHWKPEIIH
GLGA2_SYNY3      VHGRLCFFIQ--PKSSDNFFNRGHYYGALDDHMRFAFFSKAAMEFLLR---SNKRPDIIH
GLGA_METJA       GVDLIVFSNESVNNLNVW------------DPIKYEIFADLVITYLD----EVKDIDVVS
                       .                          :   :                   :: 

GLGA_CHLMU       LHDWHVGLVAGLLKQQPCPQ----LQKIVLTLHNFGYRGYTTREVLEASSLNE----FYL
GLGA_CHLTR       LHDWHTGLVAGLLKQQPCSQ----LQKIVLTLHNFGYRGYTTREILEASSLNE----FYI
GLGA_CHLPN       LHDWHVGLLAGLLKNPLNPV----HSKIVFTIHNFGYRGYCSTQLLAASQIDD----FHL
GLGA_GEOSE       CHDWHTGMVPFLLREQYRHELFYVDMRTVFTIHNLQFQGLFPRGILEDLLNLD----GRY
GLGA_BACSU       THDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLE----MDH
GLGA_CLOAB       CNDWQTAIIPVLLKDHYRNYRNYNHIKTIFTIHNLKYQGVFGKSVLGELLCLN----EGY
GLGA_LACLA       VNDWQTAMVPFLLKEKYNWIKAYEKIKTVLTIHNIEFQGLMHGDALSELFGMG----MER
GLGA_STRPN       VHDYHTAMIPFLLKEKYRWIQAYEDIETVLTIHNLEFQGQFSEGMLGDLFGVG----FER
GLGA_BACHD       CHDWQSGLIPAYMKTG----SVENPVPTVFTIHNLRYQGAFPPDVFRELLHFA----PEH
GLGA_THEMA       VNDWQTALIPVYLKTVYRDDPYFSRTATVLTIHNLGYQGVFDPKYLS-FAGLP----DYV
GLGA_AQUAE       ANDWQTALIPLFLKEVFK-----TPVKTVFTIHNLAYQGLFPKETVE-RVGIP----PYL
GLGA_VIBCH       ANDWHTGLVPFLLKTRYRYDSFFEQVKSVLTVHNAIFKGIFSYHQLEVIPELN----LSG
GLGA_DEIRA       GHDWQAGLVVAHARLRGLR--------TAFSVHNLQYQGRWNLHEAAGWTGLP----DWT
GLGA_THECA       AHDWTAALLALYAP-------------TVYTIHNLAHQGLVDPGLFFSWTGLP----WSL
GLGA_PASMU       AHDWHAGLASAYLFNKGRP------AKSVFTIHNLAYQGQFAYHHLVE-IGLP----AGM
GLGA_HAEIN       AHDWHAGLCVAYLFNKGKP------AKSVFTIHNLAYQGQFSYHHLYE-IGLP----TGM
GLGA_ECOLI       AHDWHAGLAPAYLAARGRP------AKSVFTVHNLAYQGMFYAHHMND-IQLP----WSF
GLGA_RHITR       AHDWQSALVPVYMRYYPTPE-----LPSVLTIHNIAFQGQFGADIFPG-LRLP----AHA
GLGA1_AGRFC      AHDWQAAMTPVYMRYAETPE-----IPSLLTIHNIAFQGQFGANIFSK-LALP----AHA
GLGA1_RHIME      VHDWQTALTPVYMRFGPAPD-----LPTVMTIHNIAFQGQFGASVFPE-LALP----PDA
GLGA_RHILO       AHDWQSAMTLAYMRYGKAVG-----TPSMMTVHNLAFQGQFGAGIFGE-LGLP----AVA
GLGA2_RHIME      AHDWHAAMSLLYLKYAGDDT-----IPRVLTVHNLAFQGQFPAHYFPE-LGLP----AEA
GLGA_RHOS4       AHDWQAGFTPAYMNYWGSGG-----ASSVLTVHNIAFQGWAPASLLSA-LRLP----PQE
GLGA_PSEAE       ANDWPSALTPAYMAWNGVR------TPSLFTIHNLAYQGLCDLQCSAE-LGLP----DEA
GLGA1_SYNY3      CHDWHTGMIPVWMHQ--SPD-----IATVFTIHNLAYQGPWRGLLETM------------
GLGA2_SYNY3      CHDWQTGLVPVLLYEIYRFHGM-DHQRVCYTIHNFKHQGIAGANILHATGLNNDSYYFSY
GLGA_METJA       GHDWMCGLAIAKCNDILDLPTTLTIHNEAFKGEMIEYKGEVMTFLELGIKYADAVNTVSP
                  :*:  .:                      . .   .:*                     

GLGA_CHLMU       SHYQLFRDPQTCVLLKGALYCSDFVTTVSPTYAKEILQDYSDYEIHDAITAR--QHHLKG
GLGA_CHLTR       SQYQLFRDPQTCVLLKGALYCSDFVTTVSPTYAKEILEDYSDYEIHDAITAR--QHHLRG
GLGA_CHLPN       SHYQLFRDPQTSVLMKGALYCSDYITTVSLTYVQEIINDYSDYELHDAILAR--NSVFSG
GLGA_GEOSE       FTVDHLEFYGCVSFMKGALVASDLITTVSPTYKEEIQTAYYGERLDGLLRAR--RDDLLG
GLGA_BACSU       FHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYR--EDDVTG
GLGA_CLOAB       YNENALKFYDGISFMKGGILFSDKLSTVSRTYAEEIKDPYYGEHLDGLLRSR--SYDLWG
GLGA_LACLA       YFEGVVRHNGMLNMLKTGILYADRVNTVSPTYAKEIQTSEFGCGLESILQYV--DGKVSG
GLGA_STRPN       YADGTLRWNNCLNWMKAGILYANRVSTVSPSYAHEIMTSQFGCNLDQILKME--SGKVSG
GLGA_BACHD       FA--GLEMDGAINFLKGALVHSDRVTTVSPTYAQEIQTPAFGEGLHGLLHQE--RGKTRG
GLGA_THEMA       YTIDGLEFYGQLNFLKGGIVFSDVINTVSPTYAEEIQTEEYGEKLDGVLRMR--SKDLYG
GLGA_AQUAE       FHMEAVEFWGLVNFMKGGIVFSDLITTVSPTYAKEIQTQEYGYGLEGVLKKY--SYKLRG
GLGA_VIBCH       MEFLQYGH-DHVSMLRAGIAFADKVNAVSPNYAAELLTPLGAHGLVDDFVRR--ARDLHG
GLGA_DEIRA       FGPDGVEFFGDLNLMKAGLNFAGHVTTVSPTYAQEITTPQYGEGLEGLLVRLTHEGRLSG
GLGA_THECA       FHMEALEFYGRVNLMKGGIVFARRVTTVRPSYAEEIQTPEFGMGLDGVLRR--HAGKLRG
GLGA_PASMU       FHVDGLELHGQISYLKAGLYYSDAVTAVSPTYAKEITTPEFGYGLQGLLTTLNSQGKLVG
GLGA_HAEIN       FHVEGLELFGQISYLKSGLFYSDASTAVSPTYAQEITTPEFAYGLQGLLSGLKAQGRLVG
GLGA_ECOLI       FNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQRHREGRLSG
GLGA_RHITR       FSVEGIEYYGDVGFLKGGLQTAHALTTVSPSYAEEILTPEFGMGLEGVIASK--AYNLYG
GLGA1_AGRFC      FGMEGIEYYNDVSFLKGGLQTATALSTVSPSYAEEILTAEFGMGLEGVIGSR--AHVLHG
GLGA1_RHIME      FSTQFVEYYGDVGFLKGGLQTASAITTVSPSYAQEILTPEFGMGLDGLLSSR--VADLTG
GLGA_RHILO       MALDGVEYYGGVGFLKAGLQAAWAITTVSPTYAQEIRSPEFGMGLDGLINMR--SSDLYG
GLGA2_RHIME      YSIDGVEYYGDIGFLKGGLQAADAITVVSPTYAREIMSPAFGMGLEGVMNER--HADVVG
GLGA_RHOS4       FHPAALEYYGGLSSLKAGLVSADHITTVSPTYACELMRPEFGMGLQGVIAQR--AGQVTG
GLGA_PSEAE       LSHESMEFHGRLSFLKAGIAHAHHITTVSETYAQEITTPEYGCGLHGILKYKVEKRQLSG
GLGA1_SYNY3      --TWCPWYMQGDNVMAAAIQFANRVTTVSPTYAQQIQTPAYGEKLEGLLSYL--SGNLVG
GLGA2_SYNY3      DRLQDNFNPNAINFMKGGIVYSNYVNTVSPHHAWEARFSDISCGLGHTLEIH--QQKFGG
GLGA_METJA       SHAEEIKNYPYIKKYLNNKPFCGILNGIDIDEYDPMKIIERMCNLSNNKLDP-RNYAYIS
                                      .   . :                :              .

GLGA_CHLMU       ILNGIDYTILDPETDPHLAKNYSKVLFEDPKAFFEAKAENKKALYETLGLSLD-KSPCMC
GLGA_CHLTR       ILNGIDTTIWGPETDPNLAKNYTKELFETPSIFFEAKAENKKALYERLGLSLE-HSPCVC
GLGA_CHLPN       IINGIDEDVWNPKTDPALAVQYDASLLSEPDVLFTKKEENRAVLYEKLGISSD-YFPLIC
GLGA_GEOSE       ILNGIDDEFYNPEADPFLTATYS-------VHTRERKQLNKRALQRQFGLPEWDDVPLIA
GLGA_BACSU       ILNGIDDTFYQPKSDPYIEAQYD-------SGDLACKLENKTKLQQRMGLPEKNDIPLIS
GLGA_CLOAB       IVNGIDYDILNPETDKDLFFNFD-------SSTLYNKTKNKIELQKMLNLPVSENIPMIG
GLGA_LACLA       ILNGIDYDIYNPENDILIPYHFS-------EEELSGKGQMKAELQKRTGLPLNPNVPLIG
GLGA_STRPN       IVNGIDADLYNPQTDALLDYHFN-------QEDLSGKAKNKAKLQERVGLPVRADVPLVG
GLGA_BACHD       ILNGIDLEDFDPKTDPHVTYPYK-------HNQME-KRKNKQVIQRLFELPERKDIPLIA
GLGA_THEMA       ILNGIDYELYNPATDRYIYVNYD-------VNRLELKWENKVKLQEELGLPVNKETAVAG
GLGA_AQUAE       ILNGIDYEVWNPEKDKYIYQNYS-------LRNYSKKFKNKEFLSKELGIEAEK--PLIS
GLGA_VIBCH       IVNGCDYSEWNPRTDHYLPATYSD----EPESMRKGKALCKTALQEELHLPVTD-VPLFG
GLGA_DEIRA       ILNGLDQDRWNPRTDPDIAA----------YSDPAGKAGAVKALRQEFGLDD---APILA
GLGA_THECA       ILNGLDTEVFDPGKDPYLPAPYT-------REDPSGKARAKEVFRERTGLR----PPVLA
GLGA_PASMU       ILNGVDDQIWHPNHDAYIEHHYK-------LKAMTGKRKNKEALQAYFNLPQDPDALLFV
GLGA_HAEIN       ILNGVDENIWHPNVDQYIPHHYK-------LKYMAGKKKNKAELQAYFNLPQDESALAFV
GLGA_ECOLI       VLNGVDEKIWSPETDLLLASRYT-------RDTLEDKAENKRQLQIAMGLKVDDKVPLFA
GLGA_RHITR       IVNGIDADIWNPATDPMIAQTYS-------AATLKERAINRHRVVEHFGLEED-DGPIFC
GLGA1_AGRFC      IVNGIDADVWNPATDHLIHDNYS-------AANLKNRALNKKAVAEHFRIDDD-GSPLFC
GLGA1_RHIME      IVNGIDGETWDPQTDPHIPAHYG-------PGTLKRRAGNRKALEERFGLEKG-PGPIFC
GLGA_RHILO       IVNGIDTAIWDPETDKHLVSNYT-------ATTLKARAPNRAAVEERFGLDRD-DSPIVC
GLGA2_RHIME      IVNGIDLEVWDPSSDPCIEHHYS-------ARVPLRRLPNRQVLLRHFGLPDT-CGPIFA
GLGA_RHOS4       ILNGVDTDIWSPEVE---ERPYD-------AESLKAKAENRAVLSGAFKLSV--PGPLAI
GLGA_PSEAE       IVNGID-DSWQPHCDPHLVACFS-------ARQWAGKRANTRYVEERFGLEPG-KGPLFA
GLGA1_SYNY3      ILNGIDTEIYNPAEDRFISNVFD-------ADSLDKRVKNKIAIQEETGLEINRNAMVVG
GLGA2_SYNY3      ILNGLDYEVWNPEIDPLLASNFS-------VKTFGDKAKNKQALRERLLLETDDKKPMLC
GLGA_METJA       PYSAEDSHNIKPKIKYSWFYRGGVYEY-VEDWNKIDKGISATDVEVHGGVDGDIETPLIG
                   .. *     *  .                     :      .     :          

GLGA_CHLMU       IISRIAEQKGPEFMKQAILHALENAYTLIIIGTCYGGQIHKEFSNLQESLADSPNVRILL
GLGA_CHLTR       IISRIAEQKGPHFMKQAILHALENAYTLIIIGTCYGNQLHEEFANLQESLANSPDVRILL
GLGA_CHLPN       VISRIVEEKGPEFMKEIILHAMEHSYAFILIGTSQNEVLLNEFRNLQDCLASSPNIRLIL
GLGA_GEOSE       MVTRMTAQKGLDLVTCVFHEMMSE-DMQLVVLGTGDWRFEQFFSQMAAAYPGK--VGVYI
GLGA_BACSU       MVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEK--CRAYI
GLGA_CLOAB       IVSRLVSQKGLDLISCVLEDLLQD-GIQLVVLGTGDAKYENMFKYFAWKYPNK--LSANI
GLGA_LACLA       MVSRLTNQKGFDLVLSQLEKVLEE-NVQIVLLGTGFPEIEEGFRYFSQKYPDK--LSANI
GLGA_STRPN       IVSRLTRQKGFDVVVESLHHILQE-DVQIVLLGTGDPAFEGAFSWFAQIYPDK--LSTNI
GLGA_BACHD       MVSRLVEEKGVPLLTQIAGELVTTENVQLAILGTGDPSLEDQLHHLASLHPHQ--ISFKC
GLGA_THEMA       LISRLVPQKGLDLLVDVMDYLTLF-DLQIVVLGTGDEQYENAFRKFQERYPDK--VSANI
GLGA_AQUAE       FINRFTHQKGVELILNCAEEMSKL-NANFVFLGTGE--YENAFLDVSKIYKN---FKVFA
GLGA_VIBCH       MVCRLTHQKGFHYLLPILEQFLRN-NVQVVIVGTGEPEVAARLNKIAHYHRAK--FAFVE
GLGA_DEIRA       TVSRLADQKGMDLLITALPELVR--DWNVVVLGGGDP-LLEAALTGWANHPR---VAFAS
GLGA_THECA       YVGRLDYQKGLDLVLKALPRLLEM-GFRLYVQGVGDGGLQEAFLRAEEENPEG--VRFLP
GLGA_PASMU       MVTRLTEQKGVDLLIDSAEEIVKQ-GGQLTILGSGSPHLEAGILHLAQQYPHQ--IAVKI
GLGA_HAEIN       MVTRLTEQKGVDLLIESADEIVKQ-GGQLMILGSGAPHLEQGIRELAERYPQN--IAVKI
GLGA_ECOLI       VVSRLTSQKGLDLVLEALPGLLEQ-GGQLALLGAGDPVLQEGFLAAAAEYPGQ--VGVQI
GLGA_RHITR       VVSRLTWQKGMDILAEVASEVVHM-GGKLAILGAGDAALEGALFAAAGRHRGR--VGVVG
GLGA1_AGRFC      VISRLTWQKGIDLMAEAVDEIVSL-GGRLVVLGAGDVALEGALLAAASRHHGR--VGVAI
GLGA1_RHIME      VISRLTWQKGMDLVAEAADDIVAL-GGKLVVLGSGDPALESALMAAASRNRGH--IGMVT
GLGA_RHILO       VISRLTWQKGMDILATVIDGIVAT-GARLAILGSGDAGLEGALLAAAARHRGR--IGVVI
GLGA2_RHIME      SVNRLTWQKGMDLLAATAGEIVKN-GGTLIIHGQGEEKLEAAFMDLMRRFPQN--ISVSI
GLGA_RHOS4       LVSRLTYQKGIDLIPEVLPDFIAA-GGGLAVLGTGDAPLEAAMRELEVRFPGR--VGVRI
GLGA_PSEAE       VVSRLVQQKGIDLTLEISDALLQA-GGRLVSIGRGEPNLEKAMLELARRHPGQ--VGVHI
GLGA1_SYNY3      IVARLVEQKGIDLVIQILDRFMSYTDSQLIILGTGDRHYETQLWQMASRFPGR--MAVQL
GLGA2_SYNY3      FIGRLDGQKGVHLVHHSIYYALSQGAQFVLLGSATEPNLSKWFWHEKQHLNDNPNVHLEL
GLGA_METJA       FVGRATHQKGFNTMFEAIPELLEKHDIRFVFLTKGDRDIEERLKNLANEHDGR--ILALI
                  : *   :**                  .                               

GLGA_CHLMU       TYSDVLARQIFAAADMICIPSMFEPCGLTQMIGMRYGTVPVVRATGGLADTVTDG-----
GLGA_CHLTR       TYSDVLARQIFAAADMICIPSMFEPCGLTQMIGMRYGTVPLVRATGGLADTVANG-----
GLGA_CHLPN       DFNDPLARLTYAAADMICIPSHREACGLTQLIAMRYGTVPLVRKTGGLADTVIPG-----
GLGA_GEOSE       GFHEPLAHQIYAGADLFLIPSLFEPCGLSQMIALRYGTIPIVRETGGLNDTVQSYNEIT-
GLGA_BACSU       GFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEE-
GLGA_CLOAB       QFNNSLAQKIYGASDMFLMPSKFEPCGIGQLIALRYGSLPIVRETGGLKDTVRPFNPIT-
GLGA_LACLA       AFDIQFAQEIYAGSDFFLMPSAFEPCGLSQMIAMRYGTLPIVHEIGGLKDTVIPFNPIS-
GLGA_STRPN       TFDVKLAQEIYAACDLFLMPSRFEPCGLSQMMAMRYGTLPLVHEVGGLRDTVRAFNPIE-
GLGA_BACHD       VFAEPLARKLYAGADLFIMPSRFEPCGLSQMISLRYETVPIVRETGGLYDTIQSYNEEI-
GLGA_THEMA       KFDVELAQKIYAGADIFLMPSRYEPCGLGQMFSMRYGTIPVVRYTGGLADTVKEYDPQS-
GLGA_AQUAE       EFNEGFARKLYASSDFILMPSYFEPCGLTQMIGMRYGCVPIVRKTGGLRDTVKDISE---
GLGA_VIBCH       TYSERLAHWVEAGSDFFLMPSEFEACGLNQIYSMAYGTLPIVREVGGLKDTVNDYDKFP-
GLGA_DEIRA       GMNEPLAHRIYAGAHAFAMPSRFEPCGLSQLIAMRYGTLPIVRETGGLADTVPP------
GLGA_THECA       AYDEAMARLAYAGAEAVLVPSRFEPCGLVQMIASRYGTPPVARAVGGLKDTVEDG-----
GLGA_PASMU       GYDEALSHLMIAGGDVILVPSRFEPCGLTQLYGLKYGTLPLVRATGGLADTVVNATVENI
GLGA_HAEIN       GYDEALSHLMVAGGDVILVPSRFEPCGLTQLYGLQYGTLPLVRKTGGLADTVVDSTSESI
GLGA_ECOLI       GYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDCSLENL
GLGA_RHITR       RHNEPMSHLMQAGCDAIIIPSRFEPCGLTQLYGLRSGCLPIVARTGGLNDTIIDANHAAL
GLGA1_AGRFC      GYNEPLSHLMQAGCDAIIIPSRFEPCGLTQLYALRYGCIPVVARTGGLADTVIDANHAAL
GLGA1_RHIME      GYDEPLSHLMQAGADAILIPSRFEPCGLTQLYGLRYGCVPVVARTGGLTDTIIDANEAAL
GLGA_RHILO       GYDEGLSHTMQGGCDAIIIPSRFEPCGLTQLYGLRYGCVPVVARTGGLADTIIDANEAAM
GLGA2_RHIME      GYDEHLAHRIHAGADAMLVPSRFEPCGLTQLYALRYGCVPVVARTGGLSETIIDANDAAL
GLGA_RHOS4       GYDEGLSHLMFAGGDAVLVPSRFEPCGLTQMYGLRYGAIPVVALTGGLADTIINANPAAM
GLGA_PSEAE       GFDETEARRIYAGSDFLLMPSRYEPCGLSQLYAQCFGSLPIARCTGGLADTIVDG-----
GLGA1_SYNY3      LHNDALSRRVYAGADVFLMPSRFEPCGLSQLMAMRYGCIPIVRRTGGLVDTVSFYDPIN-
GLGA2_SYNY3      GFDEELAHLIYGAADIIVVPSNYEPCGLTQMIGLRYGAVPVVRGVGGLVNTVFDRDYDQN
GLGA_METJA       GYSLPLSSLVFAGSDWIIMPSYWEPCGLVQMEAMAYCTPVIATETGGLKDTIIPLHPNPY
                       :    .. . . :**  *.**: *: .       :.   *** :*:        

GLGA_CHLMU       -------VNGFSFSNPHDF-------HEFRNMLSKAIATYRDDQDKWQQIVRSCLE----
GLGA_CHLTR       -------INGFSFFNPHDF-------YEFRNMLSEAVTTYRTNHDKWQHIVRACLD----
GLGA_CHLPN       -------VNGFTFFDTNNF-------NEFRAMLSNAVTTYRQEPDVWLNLIESGML----
GLGA_GEOSE       -----KEGNGFSFTNFNA--------HDMLYTIRRALSFYRQPS-VWEQLTERAMR----
GLGA_BACSU       -----GTGNGFTFSAFNA--------HDLKFTIERALSFYCQQD-VWKSIVKTAMN----
GLGA_CLOAB       -----GEGNGFSFTNYNA--------HDMLHVIRNAEYFYYNEKYNWNKLVQTAMN----
GLGA_LACLA       -----KEGTGFGFVDFEG--------QILVETINRALEVYGKEPEVLNKMVLSAMS----
GLGA_STRPN       -----GSGTGFSFDNLSP--------YWLNWTFQTALDLYRNHPDIWRNLQKQAME----
GLGA_BACHD       -----GEGNGFSFTHYNA--------HDFLYTIKRALRFYRTEK-EWENLLLNIYS----
GLGA_THEMA       -----MEGTGFGFKKYDS--------AHLLKAVSKALHFYYREKDHWRRIMTNAMN----
GLGA_AQUAE       ------GGYGITFEEPSK--------ETFLCSLKRAIELYENAK-KFRNSVKIVMS----
GLGA_VIBCH       -----ERATGFGYQEPTP--------EALLITMQRALLFYLQQPEEMLKVQQRAMQ----
GLGA_DEIRA       -------EVGFRFADATA--------PAFLQACREAQAAF-QDPAQWQTRATRAMS----
GLGA_THECA       -------RAGVLFETYHP--------EGLLYGVLRLFRLG-AEEM-----GLRAME----
GLGA_PASMU       KS---RLATGFVFEQANR--------EALRQALVNAFALW-QKQRLWFTVRSVAME----
GLGA_HAEIN       KA---RTATGFVFESATP--------EALRHCLQRAFALW-QKPRAWAMVRTDAME----
GLGA_ECOLI       AD---GVASGFVFEDSNA--------WSLLRAIRRAFVLW-SRPSLWRFVQRQAMA----
GLGA_RHITR       QA---KVATGIQFSPVTA--------EGLLQAMRRAMHLF-QDRKVWTQMQKQGMK----
GLGA1_AGRFC      AS---KAATGVQFSPVTL--------DGLKQAIRRTVRYY-HDPKLWTQMQKLGMK----
GLGA1_RHIME      SA---KCATGFHFLPVTT--------DGLRLAIRRVLRAY-NEPKLWARLQYQGMK----
GLGA_RHILO       AA---GVATGLQFAPNNG--------GAMLHAIRRLVDAY-ADPAAFETIQRQGMK----
GLGA2_RHIME      HA---HVATGIQFAPIDE--------DGLRHALRRTFRLY-RLRRVWEGLRRQGMK----
GLGA_RHOS4       AA---GCATGLTFHPTEP--------PAFAEALRRLIHLY-ADPAAWETVQRNAMR----
GLGA_PSEAE       -------VTGFLFREETA--------QSYLDAVMRAINVY-HCPSLLNAMRCKAMA----
GLGA1_SYNY3      -----EAGTGYCFDRYEP--------LDCFTAMVRAWEGF-RFKADWQKLQQRAMR----
GLGA2_SYNY3      HPP--EKRNGFVFYQPDE--------YALETALSRAIALYKDDPVAFKTLALQGMA----
GLGA_METJA       EHPNFDKATGVLFKVPDKVGFMWGVEHALNWTFYKLNEICMFMQYIRYKCPKHPYDENSP
                          *  :                                               

GLGA_CHLMU       -------------FSSDLETAA--NKYLEIYQQ------------------------
GLGA_CHLTR       -------------FSSDLETAA--NKYLEIYKQ------------------------
GLGA_CHLPN       -------------RASGLDAMA--KHYVNLYQSLLS---------------------
GLGA_GEOSE       -------------GDYSWRRSA--NQYKQAYEQLIKKEEHTLVHG------------
GLGA_BACSU       -------------ADYSWGKSA--KEYQRIFEQVTRSGRDVLE--------------
GLGA_CLOAB       -------------DDNSWSKSA--EIYRNLYMSVL----------------------
GLGA_LACLA       -------------KDFSWGTKA--QQYIELYQEL-----------------------
GLGA_STRPN       -------------SDFSWDTAC--KSYLDLYHSLVN---------------------
GLGA_BACHD       -------------SEVGWDVSA--KQYTALYEEILGKRKVEA---------------
GLGA_THEMA       -------------TDLSWDRSA--KEYVDLYKKALAKVGR-----------------
GLGA_AQUAE       -------------LDFSCDRMT--KEYIECYEEVQSHQ-------------------
GLGA_VIBCH       -------------QNFSWEESA--QEYMKMYRLARFG--------------------
GLGA_DEIRA       -------------LDFSWDGPA--RQYLELYRGL-----------------------
GLGA_THECA       -------------KDFSWEGPA--RAYREVYREALG---------------------
GLGA_PASMU       -------------QDFSWQISA--TGYHALYQRLLSFN-------------------
GLGA_HAEIN       -------------QDFSWRKAA--EQYRTLYERL-----------------------
GLGA_ECOLI       -------------MDFSWQVAA--KSYRELYYRLK----------------------
GLGA_RHITR       -------------SDVSWGRSA--ERYAALYSSLVSRGA------------------
GLGA1_AGRFC      -------------SDVSWEKSA--GLYAALYSQLISKGH------------------
GLGA1_RHIME      -------------SDVSWAKSA--ERYVSLYSALLAKG-------------------
GLGA_RHILO       -------------ADVSWDKSA--EKYLELYRLLLSKRVA-----------------
GLGA2_RHIME      -------------TDCSWHRSA--ARYADLYSELLNPDMRLVGSA------------
GLGA_RHOS4       -------------HPVGWETSA--AAYAALYRELVA---------------------
GLGA_PSEAE       -------------APMFWSDSV--EPYNRLYRRLLRNTAPALRGVRQ----------
GLGA1_SYNY3      -------------ADFSWYRSA--GEYIKVYKGVVGKPEELSPMEEEKIAELTASYR
GLGA2_SYNY3      -------------YDYSWNKPG--LQYVEAYEYIRA---------------------
GLGA_METJA       LSMMMKNCYYHVFRNLSWQNSPSIRKYKGLFGGAIYNHYLQP---------------
                                           *   :