CLUSTAL format seed alignment for MF_00487

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MDH_PSEP1       -------------MN--KLTIVGAGLVGEAAAQIIARDELCRELVLMDVQG--E-----L
MDH_SULDN       ----------MNQGK--RVGIIGAGNVGATVAYSLAMLGSCHEIILRDNKI--D-----V
MDH_WOLSU       ------------------MGIIGAGHVGSTVAFILATQGICQEIIIKDLNL--D-----T
MDH_BACTN       -------------MS--KVTVVGAGNVGATCANVLAFNEVADEVVMLDVKE--G-----V
MDH_BACFR       -------------MS--KVTVVGAGNVGATCANVLAFNEVADEVVMLDVKE--G-----V
MDH_HYDS0       ----------MGHKK--TVSIIGAGNVGEHIASLLVLKGA-VNIRLFDLPKKDGEKLYAH
MDH_DEHM1       -------------MP--KISVIGAGNVGATLAQRLIEKDF-ADVVMLDVVE--G-----I
MDH_GLOVI       --------MAARSCRESKVSILGAGNVGSALAQRLIQGNV-ADVVLLDIVE--G-----R
MDH_TRIV2       MSSSPDSPPILHRLP--RVAIIGAGRVGSTLAQRIAEKNL-ADVVLLDIVE--G-----M
MDH_NOSS1       MFSSPDS-PILHCLP--RVAIIGAGRVGSTLAQRIAEKNL-ADVVLLDIVE--G-----I
MDH_NEOSM       --------------M--KVSLIGAGNIGGTLAYLIASKKLASEVELIDVNG--D-----L
MDH_CHLTE       --------------M--KITVIGAGNVGATTAFRLAEKQLARELVLLDVVE--G-----I
MDH_CHLPD       --------------M--KISVIGAGNVGATAAHRLAEKQLAHEVVLIDIVE--G-----I
MDH_CHLCH       --------------M--KITVIGAGNVGATAALKIAEKQFANEVVLIDVVE--G-----I
MDH_CHLSY       ------------MRK--KISIIGAGFVGSTTAHWLAAKEL-GDIVLLDIVE--G-----V
MDH_CHLAA       ------------MRK--KISIIGAGFVGSTTAHWLAAKEL-GDIVLLDFVE--G-----V
MDH_HELMI       -----------MARK--KISIIGAGNVGATAAHWAASKEL-GDIVLLDIME--G-----I
MDH_DESAP       -----------MRRK--KISIVGAGNVGATCAHWIAAKEL-GDIVLLDVAE--G-----V
MDH_STAES       --------MLMVNRR--KISIIGAGHTGGTLAFILAQKEL-GDIVLIERQQSEG-----M
MDH_SYMTH       -----------MKRK--KIAIVGSGFTGQGTALFAAARDL-GDIVLVDLPAREN-----Y
MDH_STAS1       -----------MTKK--KISIIGAGNTGATLAFIVAQHEL-ADVVLIDRPDNEG-----Q
MDH_BACSU       ---------MGNTRK--KVSVIGAGFTGATTAFLIAQKEL-ADVVLVDIPQLEN-----P
MDH_BACHK       ---------MTIKRK--KVSVIGAGFTGATTAFLLAQKEL-ADVVLVDIPQLEN-----P
MDH_ANOFW       ---------MGMKRK--KISIIGAGFTGATTAFILAQKEL-GDIVLVDIPQLEN-----P
MDH_SORC5       ----------MANRR--KIALIGAGNIGGELAALIARKEL-GDVVLFDIPQKTD-----F
MDH_ANAMM       ----------MRSSRSAKVSLVGAGNIGGALAHMLGASQVVKELVLVDVAG--G-----M
MDH_ANAPZ       ----------MRSHRSVKVSLVGAGNIGGTLAYMLGVAGICQELVFVDVMD--G-----V
MDH_GEOBB       -----------MARK--KIALIGGGQIGGVLAQLAALREL-GDVVMFDIVE--G-----L
MDH_GEOLS       -----------MGRK--KISLIGGGQIGGVLAQLCALREL-GDVVMFDIVE--G-----M
MDH_RICB8       ----------MKKNP--KISLIGSGNIGGMLAHLISLKNL-GDIVLFDVAE--G-----I
MDH_RICRS       ----------MKQHP--KISLIGSGNIGGTLAHLISLREL-GNIVLFDVTE--G-----V
MDH_FRAT1       -----------MARK--KITLVGAGNIGGTLAHLALIKQL-GDVVLFDIAQ--G-----M
MDH_RHOSK       -----------MARP--KIALIGAGQIGGTLAHLAAIKEL-GDVVLFDIAE--G-----T
MDH_RHOP2       -----------MARD--KIALIGSGQIGGTLAHMIGLKEL-GDVVLFDIAE--G-----V
MDH_BRUAB       -----------MARN--KIALIGSGMIGGTLAHLAGLKEL-GDVVLFDIAE--G-----T
                                  : ::*.*  *   *          :: : :            

MDH_PSEP1       AQGKALDVWQAAVDSGSDTHVHG------GAKAEMLEGSELVVITAGVPRKPGQSRQDVL
MDH_SULDN       AKGKALDMSQAAAAVRSHTIVSV------AEEMADLTNCDVVVVTAGSPRLPGMSRDDLL
MDH_WOLSU       ARGIALDMGHAASATKTHTIVRV------ANEPSDLRGCDVVVFCAGSPRQPGMSRDDLL
MDH_BACTN       SEGKAMDMMQTAQLLGFDTTVVG-----CTNDYAQTANSDVVVITSGIPRKPGMTREELI
MDH_BACFR       SEGKAMDMMQTAQLLGFDTTIVG-----CTNDYAQTANSDVVVITSGIPRKPGMTREELI
MDH_HYDS0       VKGKALDMLQMACALGIDTDISGFVVDQNGNGYEALEGSDIVVITAGFPRKPGMSRDDLL
MDH_DEHM1       PQGKALDISQSANVLGFSHTITG------SNDYAETAGSEIVVITAGIARKPGMTREELL
MDH_GLOVI       PQGITLDLLEACGVEGHTCRITG------TNDYAQTAGSDVLVVAAGFARQPGMSRDDLL
MDH_TRIV2       PQGLALDLLEARGIELHNRQIIG------TNNYADTSGSQIVVITAGFPRKPGMSRDDLL
MDH_NOSS1       PQGLALDLLEARGIELHNRQIIG------TNNYADTSGSQIVVITAGFPRKPGMSRDDLL
MDH_NEOSM       ARGKALDVSQTLPLIGYTMKING------SANMERIKGSSVIIITAGIPRKPGMTREELI
MDH_CHLTE       PQGKALDMYESGPVGLFDTKVTG------SNDYADTANSDIVVITAGLPRKPGMTREDLL
MDH_CHLPD       PQGKALDMYESGPVGLFDTAIHG------SNDYMASADSDIVLITAGLARKPGMTREDLL
MDH_CHLCH       PQGKALDMYESGAVSLFDTRVIG------SNDYKDSADSDIILITAGLARKPGMTREDLL
MDH_CHLSY       PQGKALDLYEASPIEGFDVRVTG------TNNYADTANSDVIVVTSGAPRKPGMSREDLI
MDH_CHLAA       PQGKALDLYEASPIEGFDVRVTG------TNNYADTANSDVIVVTSGAPRKPGMSREDLI
MDH_HELMI       PQGKGLDLMEASPVEGFDCHIIG------TNSYADTANSDVVVITAGIARKPGMSRDDLI
MDH_DESAP       PQGKALDLMEAAPVEGFDCMITG------TNDYRDTAGSDVAVITAGVARKPGMSRDDLV
MDH_STAES       AKGKALDILESGPIWGFDTSVHG------SVNIEDIKDSDIVVMTAGIPRKSGMTREELV
MDH_SYMTH       AKGVALDMMEAMPVYGSDTRLVG------TSDYAEIAGADVVVITAGVPRKPGMSREDLV
MDH_STAS1       VKGKALDIFESSPVYGFDAKVTG------SVNYADTADSDIVVITAGSPRKPGMSRDDLV
MDH_BACSU       TKGKALDMLEASPVQGFDAKITG------TSNYEDTAGSDIVVITAGIARKPGMSRDDLV
MDH_BACHK       TKGKALDMLEASPVQGFDANIIG------TSDYADTADSDVVVITAGIARKPGMSRDDLV
MDH_ANOFW       TKGKALDMLESSPVLGFDANIIG------TSDYADTADSDVVVITAGIARKPGMSRDDLV
MDH_SORC5       AKGKALDLEQNGAVLGYDASIKG------TSSWADCAGADVLIVTAGIPRKPGQSRDDLV
MDH_ANAMM       TEGKVLDVGQALALLGSDVYITG------GSDYAAIEHSDAVVVTAGIPRKEGMSREDLL
MDH_ANAPZ       PRGKLLDIGHALAISGVDITAVG------GSDYAAIEGSDAIVVTAGLPRKEGMSREDLL
MDH_GEOBB       PQGKMLDIAEVGSVDGFDCNLKG------TNSYEDIKGADVVIVTAGLPRKPGMSRDDLI
MDH_GEOLS       PQGKMLDIAEASPVDGFDVCLQG------TQDYKDIAGSDVVIVTAGLPRKPGMSRDDLI
MDH_RICB8       PQGKALDIMQANTLAGSDIKIKG------TNDYKDIEGSDAIIITAGLPRKPGMSRDDLI
MDH_RICRS       PQGKALDLMQAVTIAGSDIKIKG------TNDYKDIKGSDAIIITAGLPRKPGMSRDDLI
MDH_FRAT1       PNGKALDLLQTCPIEGVDFKVRG------TNDYKDLENSDVVIVTAGVPRKPGMSRDDLL
MDH_RHOSK       PQGKALDIAQSGPSEGFDAVMKG------ANSYEEIAGADVCIVTAGVPRKPGMSRDDLI
MDH_RHOP2       PQGKALDIAESSPVDGFDANFTG------ANSYEAIEGASVVIVTAGVPRKPGMSRDDLL
MDH_BRUAB       PQGKGLDIAESSPVDGFDAKFTG------ANDYAAIEGADVVIVTAGVPRKPGMSRDDLL
                  *  :*:                              ..  :. :* .*  * :*::::

MDH_PSEP1       STNLPILDSIMADIKHHAPTATVLVVSNPVDVLTYRAWSVSGQGRDKVFGQAGVLDTARM
MDH_SULDN       MINANITKDVIAGVAKYSPDAIIIMVSNPLDAMTYVALKESGFDRSRVIGMAGILDSARM
MDH_WOLSU       LANAKVIRTVLSEVKPYIQESVLVMVSNPLDAMVYTAIKESGLSPLQVLGMAGILDSARM
MDH_BACTN       GVNAGIVKSVAENILKYSPNAILVVISNPMDTMTYLSLKALGLPKNRIIGMGGALDSSRF
MDH_BACFR       GVNAGIVKSVAENLLKYSPNAIIVVISNPMDTMTYLALKSLGLPKNRVIGMGGALDSSRF
MDH_HYDS0       GINISIMNTISEQIKKYAKNSIVIVVTNPVDIMTYAVYKLLGCNRKRVIGMAGVLDSSRF
MDH_DEHM1       AINQKIMTDVVSNCLKYSPEATLVVVSNPVDTMTYLAWKLSGLPRKRVVGLSGVLDGGRL
MDH_GLOVI       LTNTRIVFEVTQKAVAHSPEATVVVVTNPLDAMSHVAWRASGLVPERVMGMAGVLDAARF
MDH_TRIV2       RTNAKIVVEAAKQAIAYSPCAIFIVVTNPLDVMTYLAWEATGLPRNRIMGMAGVLDSARF
MDH_NOSS1       RTNAKIVIEAAKQAIAYSPYAIFIVVTNPLDVMTYLAWEATGLPRNRIMGMAGVLDSARF
MDH_NEOSM       DVNAVVMKEVGEKIKKFAPKAFVIVVTNPLDVMVWVLYKAAEISPDKIVGMAGVLDASRM
MDH_CHLTE       SMNAGIVREVTGRIMEHSKNPIIVVVSNPLDIMTHVAWQKSGLPKERVIGMAGVLDSARF
MDH_CHLPD       MKNAGIVKEVTDQVMKHSSNPILVMVSNPLDVMTFVAHASSGLGKERVIGMAGVLDAARF
MDH_CHLCH       MKNAAIIKEVTSQVMKYSTNPIIVMVSNPVDIMTYVAHRVSGLPKERVIGMGGVLDTARY
MDH_CHLSY       KVNADITRACISQAAPLSPNAVIIMVNNPLDAMTYLAAEVSGFPKERVIGQAGVLDAARY
MDH_CHLAA       KVNADITRACISQAAPLSPNAVIIMVNNPLDAMTYLAAEVSGFPKERVIGQAGVLDAARY
MDH_HELMI       TTNTKIVADCAKKAAEQSPDSIIIIVSNPLDAMTYVAQKASGFPTNRVFGMSGILDAARF
MDH_DESAP       SINVKIVRQAAAEIARYSPDALIIVVTNPLDVMCYVAYKASGLPRGKVFGMSGILDGARF
MDH_STAES       QTNEQIVRETALQIATYAPHSIIIVLTNPVDVMTYTAFKASGFPKERIIGQSGILDAARY
MDH_SYMTH       NTNAGIVKDVAEKVARYAPDSVIIVLTNPVDSMTYVALKASGFPKNRVIGQSGVLDTARF
MDH_STAS1       QINEKVMFDVTKEIVKYSPDCKIIVLTNPVDAMTYSVLKASGFPKERVIGQSGVLDTARY
MDH_BACSU       STNEKIMRSVTQEIVKYSPDSIIVVLTNPVDAMTYAVYKESGFPKERVIGQSGVLDTARF
MDH_BACHK       ATNSKIMKSITRDIAKHSPNAIIVVLTNPVDAMTYSVFKEAGFPKERVIGQSGVLDTARF
MDH_ANOFW       TTNQGIMKAVTKEVVKYSPNCFIIVLTNPVDAMTYTVFKESGFPKNRVIGQSGVLDTARF
MDH_SORC5       ATNLPIIRSVADGAKEHCPNALVIVISNPIDAMVYEFKRRTGFPRERVLGMAGVLDSARF
MDH_ANAMM       NTNAAVVRNIAENIAKYSPGALVIVVTNPLDAMVWCMYKYSGLPANRVVGMAGVLDSARF
MDH_ANAPZ       MANAAVIKGVAENIRKYSPDAFVIVVTNPLDAMVWYMHQCSGLPVNKVVGMAGVLDSARF
MDH_GEOBB       EVNSKIMTSVAEGIKANAPNAFVIVISNPLDAMVTLCQKITGFPYNRVIGQAGVLDSARF
MDH_GEOLS       ATNSKIMTSVAEGIKQYASNAFVIIISNPLDAMVTLCQKITGMPANRVVGQAGVLDSARF
MDH_RICB8       SVNTGIMKSVAENVKKYAPNAFVIVITNPLDVMVYVMLKESGLPHNKVIGMAGVLDSSRF
MDH_RICRS       SINTGIMKTVAANVKKYAPDAFVIVITNPLDVMVYVMLKESGLPHNKVIGMAGVLDSSRF
MDH_FRAT1       GINIKVMQTVGEGIKHNCPNAFVICITNPLDIMVNMLQKFSGVPDNKIVGMAGVLDSARF
MDH_RHOSK       GINLKVMKSVGEGIKAHAPNAFVICITNPLDAMVWALQQFSGLPAEKVVGMAGVLDSARF
MDH_RHOP2       SINLKVMEQVGAGIKKYAPDAFVICITNPLDAMVWALQKASGMPAKKVVGMAGVLDSARF
MDH_BRUAB       GINLKVMEQVGAGIKKYAPEAFVICITNPLDAMVWALQKFSGLPAHKVVGMAGVLDSARF
                  *  :                .: :.**:* :             .:.* .* ** .* 

MDH_PSEP1       KCFIAEQTGFSARDITALVLGGHGD-SMVPLMRYCQIGSVPLSHF---------LSSEQI
MDH_SULDN       ASFIQEKLGYGGGQIRASVMGGHGD-DMVPLARYSTVAGVPLTDL---------MSTSEI
MDH_WOLSU       ASFIFEKLGYGSDQIVASVMGGHGD-DMVPLPRYSNVAGVPITEL---------LEPQEI
MDH_BACTN       KYFLSQALGCNANEVEGMVIGGHGDTTMIPLTRFATYKGMPVTNF---------ISEEKL
MDH_BACFR       KYFLSQALGCNANEVEGMVIGGHGDTTMIPLARLATYKGQPVSTL---------LSEEKL
MDH_HYDS0       RTFISLELNVSPKDVHAYVIGGHGD-EMVPLAGVSNVGGIPISTL---------IDEKKI
MDH_DEHM1       ATFVARELGVKPSAVTPCVMGEHGG-SMVVMPRFTLVSGKPLSEL---------VSAEKA
MDH_GLOVI       ETFIAWELGFSVRDIRAMVLGGHGD-LMVPLPRYTTISGVPLTQL---------LSSARI
MDH_TRIV2       ETFIALELGVLPADVKAMVLGSHGD-LMVPLSRHATVNGIPITEL---------LDAATI
MDH_NOSS1       ETFIALELGVLPADVKAMVLGSHGD-LMVPLSRYATVNGIPITQL---------LDAVTI
MDH_NEOSM       NLFLAQELGVSVADVKSLVLGSHGD-SMVPLFRHSTVSGMSLPELVSVGL----ITKDKV
MDH_CHLTE       RSFIAMELGVSMQDVTACVLGGHGD-AMVPVVKYTTVAGIPVADL---------ISAERI
MDH_CHLPD       RSFIAEELNVSMQDVNAFVLGGHGD-SMVPVVKYTSVAGIPITEL---------LSQEKI
MDH_CHLCH       KNFIAETLNISMQDISALVLGGHGD-AMVPVVNYTNVAGIPLTEL---------LPLDII
MDH_CHLSY       RTFIAMEAGVSVEDVQAMLMGGHGD-EMVPLPRFSTISGIPVSEF---------IAPDRL
MDH_CHLAA       RTFIAMEAGVSVEDVQAMLMGGHGD-EMVPLPRFSTISGIPVSEF---------IAPDRL
MDH_HELMI       KTFIAMEMGCSVKDVSTILLGGHGD-DMVPLPSYTFIGGIPIRQL---------LPEEKI
MDH_DESAP       RTFVALELGISFEDVTTLVLGGHGD-HMVPLVRYTYAGAIPVEKL---------IPADRL
MDH_STAES       RTFIAQELNVSVKDVNGFVLGGHGD-TMLPLINNTHINGIPVKHL---------ISEEKI
MDH_SYMTH       RTFLANAIGCSFQDVVGCVLGGHGD-DMVPLVRYTSAGGIPVEKL---------LPKETI
MDH_STAS1       QSFIAEALNVSIKDIRGLVLGGHGD-TMVPLVNSTNVNGVPLHQL---------LNQTQI
MDH_BACSU       RTFVAEELNLSVKDVTGFVLGGHGD-DMVPLVRYSYAGGIPLETL---------IPKERI
MDH_BACHK       RTFIAQELNLSVKDITGFVLGGHGD-DMVPLVRYSYAGGIPLETL---------IPKERL
MDH_ANOFW       RTFVAQELNLSVKDITGFVLGGHGD-DMVPLVRYSYAGGIPLETL---------IPKERL
MDH_SORC5       QLFLAREANVSVKDVRAMVLGGHGD-DMVPIPSACTINGVRATEL---------ISKEKL
MDH_ANAMM       SFFLARHMNVSVSSVSAMVLGGHGD-LMLPLLRYSTVGGVPVESLIESGR----LNRDDI
MDH_ANAPZ       SFFLAKHMSVSVSSVSSVVLGGHGD-LMLPLLKYSTVGGVSVSDLISCGR----LSSEDV
MDH_GEOBB       KTFIAWELGVSVKDVNAMTLGGHGD-DMVPLVRYASVNGIPVMELLEKKYKDKAKAKEVM
MDH_GEOLS       KAFIAWELGVSVKDVSAMTLGGHGD-DMVPLVRYAAVNGIPVMELLEQKYGAE-KAKEVM
MDH_RICB8       NFFLAEEFKVSTNSVSSIVLGGHGD-AMVPLARYSTVKGVPIPDLVKMGL----STNERI
MDH_RICRS       NLFLAEEFKVSVSNVNSMVLGGHGD-AMVPLARYSTISGVPIPDLIKMGL----SSNENI
MDH_FRAT1       RTFLADELNVSVQQVQAYVMGGHGD-TMVPLTKMSNVAGVSLEQLVKEGK----LKQERL
MDH_RHOSK       RHFLSVEFNVSMRDVTAFVLGGHGD-TMVPLVRYSTVAGIPLPDLVQMGW----TTQEKL
MDH_RHOP2       RYFLADEFNVSVEDVTAFVLGGHGD-TMVPLVKYSTVAGIPLPDLVKMGW----TSQARL
MDH_BRUAB       RYFLSEEFNVSVEDVTVFVLGGHGD-SMVPLARYSTVAGIPLPDLVKMGW----TSQDKL
                  *:          :    :* **.  *: :       .     :               

MDH_PSEP1       EQIVERTRKGGGEILGLKKTGSACDAPGVAIAQMVDAIGNGRNRILPAVAILE-GE----
MDH_SULDN       NEIVIRTRNGGAEIVGHLKTGSAYYAPAKATALMVEAILKDTKQIHPCAVFLE-GE----
MDH_WOLSU       EEIIHRTRNAGAEIVGYLKKGSAYFAPAKSTAIMVEAILKNSHQVFPCSVLLQ-GE----
MDH_BACTN       NEVAAATMVGGATLTKLLGT-SAWYAPGAAGAFVVESILHDQKKMIPCSVYLE-GE----
MDH_BACFR       NEVVASTMVGGATLTKLLGT-SAWYAPGAAGAYVVESIIHNQKKMVPCSVMLE-GE----
MDH_HYDS0       KELVERTRFGGGEIVDYMGT-SAYHAPAASVVEMIESVALNAKRVLTCSVLLD-EEASKY
MDH_DEHM1       DELAKRAVNGGAEIVAFLKTGSAFYAPSASIAAMAEAIFTGSGKVMNCAAVLD-GE----
MDH_GLOVI       DALIERTRTGGAEIVHLLKRGGAYYAPAAAAARMIETLLGDERRLLPVAAYLS-GE----
MDH_TRIV2       ERLVERTRNGGAEIVELMQTGGAFFAPASATSLMVESILLNQSRLLPVSVYLQ-GE----
MDH_NOSS1       ERLVERTRNGGAEIVELMQTGGAFFAPASATSLMVESILLNQSRLLPVSIYLQ-GE----
MDH_NEOSM       DSIIERTRSGGAEIVALLKTGSAYYTPAASVLEMAEAYLLDQKKTLVCSVMMR-GR----
MDH_CHLTE       AELVERTRTGGAEIVNHLKQGSAFYAPATSVVEMVESIVLDRKRVLTCAVSLD-GQ----
MDH_CHLPD       DALVERTRNGGVEIVNYLKNGSAFYAPAASAVEMIEAIVKDRKRILACTTLLE-GE----
MDH_CHLCH       DGLVERTRNGGIEIVNYLKSGSAYYAPAASTVEMIEAIARDRKRILPCTTLLD-GQ----
MDH_CHLSY       AQIVERTRKGGGEIVNLLKTGSAYYAPAAATAQMVEAVLKDKKRVMPVAAYLT-GQ----
MDH_CHLAA       AQIVERTRKGGGEIVNLLKTGSAYYAPAAATAQMVEAVLKDKKRVMPVAAYLT-GQ----
MDH_HELMI       QAMVDRARKGGAEIVAYLKTGSAYYAPSASVIQMVEAILKDQKRILPVAAYLN-GE----
MDH_DESAP       AELVQRTRQGGAEIVELLKTGSAYYAPGAAITQMLEAVLKDKKRILPCAAYLD-GE----
MDH_STAES       DQIVERTRKGGAEIVALLGQGSAYYAPATAIYETIDAIFNDRKRLLPSIAYLE-GE----
MDH_SYMTH       DAIVERTRKGGGEIVNLMGT-SAGYAPGMALVEMIDAILNDRKRILPSIAYLE-GE----
MDH_STAS1       EQIVERTRKGGAEIVALLGNGSAYYAPASAVFEMIEAILKDQHRLLPSIALLE-GE----
MDH_BACSU       DAIVERTRKGGGEIVNLLGNGSAYYAPAASLTEMVEAILKDQRRVLPTIAYLE-GE----
MDH_BACHK       EAIVERTRKGGGEIVGLLGNGSAYYAPAASLVEMTEAILKDQRRVLPAIAYLE-GE----
MDH_ANOFW       DAIVERTRKGGGEIVNLLGNGSAYYAPAASLAEMVEAIVKDQRRVLPAIAYLE-GE----
MDH_SORC5       DALIARTRKGGGEIVQLMGT-SAYYAPASSAVAMAESYLLDQKRLLPVAAYLD-GE----
MDH_ANAMM       AAIVERTRKGGEEIVKLLKTGSAYCAPAASCAHMLESYVRDKRSIMPCSAYLD-GQ----
MDH_ANAPZ       HAIIERTRKGGEEIVKLLKSGSAYYAPAASCMNMLESYLFDKRCVIPCSVGLD-GK----
MDH_GEOBB       EAMVKRTRGAGGEVVALLKTGSAFYSPASSAIQMAESILKDQKRVLPTCAHLN-GE----
MDH_GEOLS       EAMVNRTRLAGGEVVALLKTGSAFYSPASSAIAMAESVLKDQKRVLPTCCLLN-GE----
MDH_RICB8       EKIIDRTRNGGGEIVALLKTGSAYYAPAASAVEMLESYLQDKRQILTCAAYLQ-GE----
MDH_RICRS       EKIIDRTRNGGGEIVALLKTGSAYYAPAASAIEMLESYLKDKRQILTCAAYLQ-GE----
MDH_FRAT1       DAIVSRTRSGGGEIVALLKTGSAYYAPAAAGIQMAESFLKDKKMILPCAAKVKAGM----
MDH_RHOSK       DQIVQRTRDGGAEIVGLLKTGSAFYAPATSAIEMAEAYLKDQKRLLPCAAYVD-GA----
MDH_RHOP2       DEIVDRTRNGGAEIVNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPVAAYLN-GE----
MDH_BRUAB       DKIIQRTRDGGAEIVGLLKTGSAFYAPAASAIQMAESYLKDKKRVLPVAAQLS-GQ----
                  :   :  .*  :       .*  :*. :     ::   .          :        

MDH_PSEP1       YGRT-DIAMGVPCVLAEKGLARVIELPLDAQEQAMFDHSADQVARDIAEMKAL-------
MDH_SULDN       YGHS-DVVSGVPVMLGANGAEKIIEISLDESEKIMFEGSCNSVRTLIDTLNKNKFFDKGE
MDH_WOLSU       YGYS-DVVGGVPVKLGSRGVCEIIELELLHEERERFDQSIQSVKSLIDALYHHAFFVSSR
MDH_BACTN       YGES-DICIGVPVILGKNGIEKIVELDLNADEKAKFAASAKAVHGTNAALKEVGAL----
MDH_BACFR       YGES-DLCIGVPVILGKNGIEKIVELELNADEKAKFAASAAAVHKTNAALKEVGAL----
MDH_HYDS0       YEAE-NLCVGVPVKLGENGVEKIVKVPMTDFERDLWMKSVASVKKNIAIADEFVSKYI--
MDH_DEHM1       YGLK-NIVLGVPVKLGKGGLQEIITLPLDGTENARLLASAEVVKGQIAALSL--------
MDH_GLOVI       YGLR-NIHMGVPVILSRHGVERVVELTLETEEKAALYRSAHTIRASLDQIAHLMPANQPP
MDH_TRIV2       YGLK-DVVIGVPCRLGLNGIESVIELNLSDSEREALQTSAQSVQKNIERWHSTQHS----
MDH_NOSS1       YDLK-DVVIGVPCRLGLNGIESVIELNLSDSEREALHISAKSVQKNIERWRSLQNS----
MDH_NEOSM       YGVEDDIFSGIPVIMGSGGVERVIELDLTPDERRMFENSVAATRKLVLEARKYF------
MDH_CHLTE       YGID-GTFVGVPVKLGKNGVEHIYEIKLDQSDLDLLQKSAKIVDENCKMLDASQG-----
MDH_CHLPD       YGIN-NVFCGVPVKIGKNGVEEILEINLAPAELDALKHSASLVQENCKSLEALLA-----
MDH_CHLCH       YGIN-SVFCGVPVKLGKNGIEQVLEINLSAPERSALQRSADIVEKNCKMLESLFA-----
MDH_CHLSY       YGLN-DIYFGVPVILGAGGVEKILELPLNEEEMALLNASAKAVRATLDTLKSL-------
MDH_CHLAA       YGLN-DIYFGVPVILGAGGVEKILELPLNEEEMALLNASAKAVRATLDTLKSL-------
MDH_HELMI       YGYE-GIYTSVPVMLGANGVEKVFEIELTAEERQLFAKSVDSVKNLIAVTGM--------
MDH_DESAP       YGHR-DICAGVPTIVGAGGIERIIELELTAEEQAAFDRSVSAVRGVLKGLDI--------
MDH_STAES       YGCS-DICFGVPTIIGYQGIEKIIEVDMNNDEYQQLQHSAQAVSEVKNSLKFK-------
MDH_SYMTH       YGYT-DMCLGVMTVLGGGGLEKVIELDLTDEEKVALDKGAQGVRNLIEMLKAGILAQ---
MDH_STAS1       YGFS-DICLGVPTVLSEKGIENIVELALSDNEQAQLRISADSVEEVKQALKNQ-------
MDH_BACSU       YGYE-GIYLGVPTIVGGNGLEQIIELELTDYERAQLNKSVESVKNVMKVLS---------
MDH_BACHK       YGYS-DLYLGVPVILGGNGIEKIIELELLADEKEALDRSVESVRNVMKVLV---------
MDH_ANOFW       YGYE-GIYLGVPTILGGNGIEKVIELELTEEEKAALAKSVESVKNVMKVLQ---------
MDH_SORC5       YGYK-DIFMGVPVILGGKGIEKIVELPLTAEEKEMLAKSAKSVQGITDVVKASS------
MDH_ANAMM       YGVR-DLFVGVPVIIGEKGVEEVVEFPLTAEEQAVFDQSVELIRGSVSAIS---------
MDH_ANAPZ       YGVNGGLFVGVPAVIGKNGVEEVIEYVLSQEEREIFEKSVGLISNSVKIISEQK------
MDH_GEOBB       FGVK-GFYVGVPCVLGENGVEQILEFELDAEEQAMMDKSVAAVKELVGSMK---------
MDH_GEOLS       FGVN-GYYVGVPAVLGASGVEKILQFKLDATEQAMMDKSVAAVKGLVDSLDSILKG----
MDH_RICB8       YGVK-DLYAGVPIIIGKNGVEKVIELQLTTNEQALFDKSVDGVRKLIEAVK---------
MDH_RICRS       YGVH-DLYVGVPIMIGKEGVLKVIELQLTTEEKALFDKSVEGVKKLIETIK---------
MDH_FRAT1       YGLDEDLFVGVPTEISANGV-RPIEVEISDKEREQLQVSINAIKDLNKAAAEILAK----
MDH_RHOSK       FGLN-GMYVGVPTIIGAGGIEKIVDIKLNDDEQAMFDKSVNAVKGLVEACKGIDSSLA--
MDH_RHOP2       YGVK-DMYVGVPVVIGAKGVERIVEIEMAGKDREAFDKSVGAVQGLVDACKKIAPDLLGR
MDH_BRUAB       YGVK-DMYVGVPTVIGANGVERIIEIDLDKDEKAQFDKSVASVAGLCEACIGIAPSLK--
                :    .   .:   :.  *        :   :      .                     

MDH_PSEP1       ---
MDH_SULDN       ---
MDH_WOLSU       P--
MDH_BACTN       ---
MDH_BACFR       ---
MDH_HYDS0       ---
MDH_DEHM1       ---
MDH_GLOVI       SAV
MDH_TRIV2       ---
MDH_NOSS1       ---
MDH_NEOSM       ---
MDH_CHLTE       ---
MDH_CHLPD       ---
MDH_CHLCH       ---
MDH_CHLSY       ---
MDH_CHLAA       ---
MDH_HELMI       ---
MDH_DESAP       ---
MDH_STAES       ---
MDH_SYMTH       ---
MDH_STAS1       ---
MDH_BACSU       ---
MDH_BACHK       ---
MDH_ANOFW       ---
MDH_SORC5       ---
MDH_ANAMM       ---
MDH_ANAPZ       ---
MDH_GEOBB       ---
MDH_GEOLS       ---
MDH_RICB8       ---
MDH_RICRS       ---
MDH_FRAT1       ---
MDH_RHOSK       ---
MDH_RHOP2       ---
MDH_BRUAB       ---