CLUSTAL format seed alignment for MF_00488

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LDH_MYCGE       -----------------MKGPKIAIVGSGAVGTSFLYAA-MTRALGSEYMIIDIN--EKA
LDH_MYCPN       -----------------MKSLKVALIGSGAVGTSFLYAA-MSRGLASEYMVIDIN--EKS
LDH_MYCMS       ---------------MKKTANKVVLIGAGSVGTSFLYAA-INQGIAEHYVLIDAF--PQP
LDH_MYCPE       -----------------MKTRKVVLIGCGAVGTSFLYSA-LNQGLFDEYVLIDAF--DNL
LDH_BACHD       --------------MAITKGNKIVLVGTGAVGSSYAYAL-MNQGISDELILVDLN--EEK
LDH1_STAAM      --------------MNKFKGNKVVLIGNGAVGSSYAFSL-VNQSIVDELVIIDLD--TEK
LDH_CORGL       --------------MKETVGNKIVLIGAGDVGVAYAYAL-INQGMADHLAIIDID--EKK
LDH_CORDI       --------------MKNIVGNKVVLIGAGDVGVAYAYAL-VNQGTVDHLAIIDID--EKK
LDH_COREF       ---------------MRFVGNRVVLIGAGDVGVAYAYAL-VNQGIADELCIIDID--EKK
LDH_BACSU       ---------------MNKHVNKVALIGAGFVGSSYAFAL-INQGITDELVVIDVN--KEK
LDH_GEOSE       --------------MKNNGGARVVVIGAGFVGASYVFAL-MNQGIADEIVLIDAN--ESK
LDH1_BACAN      ---------------MKKGINRVVLVGTGAVGCSYAYCM-INQAVAEEFVLVDVN--EAK
LDH1_BACC1      ---------------MKKGINRVVLVGTGAVGCSYAYCM-INQAVAEEFVLVDVN--EAK
LDH1_BACCR      ---------------MKKGINRVVLVGTGAVGCSYAYCM-INQAVAEEFVLVDVN--EAK
LDH2_BACAN      ---------------MKKGINRVVLVGTGAVGCSYAYSM-INQGVAEEFVLVDVN--EAK
LDH2_BACC1      ---------------MKKGINRVVLVGTGAVGCSYAYSM-INQGVAEEFVLVDVN--EAK
LDH2_BACCR      ---------------MKKGINRVVLVGTGAVGCSYAYSM-INQGVAEEFVLVDVN--EAK
LDH_OCEIH       ------------MRTSQQAVNRVVLIGGGSVGVSYAFAL-MNQGVTEELAIIDLD--ADK
LDH2_STAAM      ---------------MKTFGKKVVLIGDGSVGSSYAFAM-VTQGVADEFVIIDIA--KDK
LDH2_STAAW      ---------------MKTFGKKVVLIGDGSVGSSYAFAM-VTQGVADEFVIIDIA--KDK
LDH_STAES       ---------------MKKFGKKVVLVGDGSVGSSYAFAM-VTQGIADEFVIIDIA--KDK
LDH_STRMU       -------------MTATKQHKKVILVGDGAVGSSYAFAL-VNQGIAQELGIIEIPQLFEK
LDH_STRPN       -------------MTSTKQHKKVILVGDGAVGSSYAFAL-VNQGIAQELGIIEIPQLHEK
LDH_STRA3       -------------MTATKQHKKVILVGDGAVGSSYAFAL-VNQGIAQELGIIEIPALFDK
LDH_STRA5       -------------MTATKQHKKVILVGDGAVGSSYAFAL-VNQGIAQELGIIEIPALFDK
LDH_STRP1       -------------MTATKQHKKVILVGDGAVGSSYAFAL-VTQNIAQELGIIDI--FKEK
LDH1_LACLA      --------------MADKQRKKVILVGDGAVGSSYAFAL-VNQGIAQELGIVDL--FKEK
LDH1_ENTFA      ----------MTAAAGNKDHQKVILVGDGAVGSSYAFAL-VTQNIAQEVGIIDI--NVPK
LDH1_LISIN      ----------------MKDHQKIILVGDGAVGSSYAFAC-VNLSIGQEFGIIDID--KDR
LDH1_LISMO      ----------------MKDHQKIILVGDGAVGSSYAFAC-VNLSIGQEFGIIDID--KDR
LDH1_LACPL      -------------MSSMPNHQKVVLVGDGAVGSSYAFAM-AQQGIAEEFVIVDVV--KDR
LDH1_LACJO      --------------MSEEKIHKIILVGDGAVGSTYAFSL-VQQGIAQELGIVDIV--KER
LDH2_LACPL      ---------------MDKKQRKVVIVGDGSVGSSFAFSL-VQNCALDELVIVDLV--KTH
LDH2_LACJO      -----------------MSRRKVFLVGDGRVGSTFANDL-LQNVRIDELVICDVV--KKI
LDH_DEIRA       --------------------MKVGVVGTGFVGSTAAFAL-VLRGSCSELVLVDRD--EDR
LDH_THET2       --------------------MKVGIVGSGMVGSATAYAL-ALLGVAREVVLVDLD--RKL
LDH_THEMA       --------------------MKIGIVGLGRVGSSTAFAL-LMKGFAREMVLIDVD--KKR
LDH_DESVH       -------------------MNRIAVIGVGNVGMAFAYAA-AIKRLANDIVLIDAN--AAR
LDH2_BIFLO      ------------MAETTVKPTKLAVIGAGAVGSTLAFAA-AQRGIAREIVLEDIA--KER
LDH_GLOVI       MQDRLFVSMEHPRALPETDLIKGAIVGAGAVGMAIAYSM-LIQNTFDELVLVDID--RRK
LDH1_CLOAB      ----------------MKKNTKISVIGAGFVGSSTVFAL-MNGGLASEIVIVDVN--KDK
LDH_CLOPE       --------------MIREKTNKISIIGAGFVGSTTAFAL-MQDGLASEIVIVDIN--KDK
LDH_CLOTE       ---------------MNKKGIKISIIGSGFVGSTTAYAL-MMEGLASEIVIVDIN--KEK
LDH_TREDE       ---------------MDEKKRKVTVVGAGAVGSTFAYAL-AQSGYADEIAITDMN--KNF
LDH3_BACAN      ---------------MKRHTRKIAIIGTGLVGSSCAYSI-VNQGICEELLLIDIN--HER
LDH3_BACCR      ---------------MKRHTRKIAIIGTGLVGSSCAYSI-VNQGICEELLLIDIN--HER
LDH3_BACC1      ---------------MKRNTRKIAIIGTGLVGSSCAYSI-VNQGICEELLLIDIN--HER
LDH1_BIFLO      --------------MVTMNRNKVVIVGTGQVGATAAFGI-VTHGLCNELVLIDCS--AAK
LDH2_LISIN      -----------------MKPRKVMIIGAGNVGSAAAHAF-VNQKFVEELILVDLN--KER
LDH2_LISMO      -----------------MKPRKVMIIGAGNVGTAAAHAF-VNQKFVEELILVDLN--KER
LDH_FUSNN       ----------------MLQTRKVGIVGIGHVGSHCALSM-LLQGVCDEMVLMDII--PEK
LDH2_LACLA      ---------------MKITSRKVVVIGTGFVGTSIAYSM-INQGLVNELVLIDVN--QDK
LDH2_ENTFA      ---------------MKVFNKKVAIIGTGFVGTSIAYSM-INQGIANELILVDID--KAK
LDH2_CLOAB      ---------------MNFVKNKLVVVGAGMVGSAVLNSV-LSLNLLSEVVIIDIN--DNK
LDH3_LACLA      ---------------MKINNKKVVIVGAGAVGSTYAHNL-VVDDLADEIAIINTN--KSK
LDH_BORBU       ----------------MLKSNKVVLIGAGGVGSSFAYALTIDNSLVHELVIIDVN--ENK
LDH_MYCGA       -------------------MKKIAVIGCGFVGSTYILDL-LQQGVQADYLLVDKN--TNL
LDH_MYCPU       -------------------MKKVVLIGTGNVGVTVVYTM-ITKGIDAEYVLIDIN--TEF
                                     :  ::* * **               .  : :       

LDH_MYCGE       KVGNVFDLQDASSSCPN-FGKVVAGEYSQLKDYDFIFISAGRPQ------KQGGETRLQL
LDH_MYCPN       QVGNVFDLQDAVPSSPQ-YSKVIAGDYKQLKDYDFIFIGAGRPQ------KQGGETRLQL
LDH_MYCMS       AEGNALDLSDTLAVIPHSFTSIKAGSYEDCKDADVVVITAGRPQ------KPG-ETRLEM
LDH_MYCPE       SKGNAWDFEDANAIMSTPAGMIKSGTYEDCADADVVVITAGVPQ------KPGGETRLQL
LDH_BACHD       AKGDVLDLNHSIVYAPSPMEIK-FGSYEDCKDAALVVICAGAAQ-------KPGETRLDL
LDH1_STAAM      VRGDVMDLKHATPYSPTTVRVK-AGEYSDCHDADLVVICAGAAQ-------KPGETRLDL
LDH_CORGL       LEGNVMDLNHGVVWADSRTRVT-KGTYADCEDAAMVVICAGAAQ-------KPGETRLQL
LDH_CORDI       LEGNVMDLNHGVVWASSRTKVS-KGTYADCEDAAVVVICAGAAQ-------KPGETRLQL
LDH_COREF       LEGNVMDLSHGVVWAGKRTKVR-KGTYSDCEDAAMVVICAGAAQ-------KPGETRLQL
LDH_BACSU       AMGDVMDLNHGKAFAPQPVKTS-YGTYEDCKDADIVCICAGANQ-------KPGETRLEL
LDH_GEOSE       AIGDAMDFNHGKVFAPKPVDIW-HGDYDDCRDADLVVICAGANQ-------KPGETRLDL
LDH1_BACAN      AEGEAMDLSHAVPFAPAPTRVW-KGSYEDCKDADLVVITAGLPQ-------KPGETRLDL
LDH1_BACC1      AEGEAMDLSHAVPFAPAPTRVW-KGSYEDCKDADLVVITAGLPQ-------KPGETRLDL
LDH1_BACCR      AEGEAMDLSHAVPFAPAPTRVW-KGSYEDCKDADLVVITAGLPQ-------KPGETRLDL
LDH2_BACAN      AEGEAMDLSHAVPFSPSPTKVW-SGSYADCKDADLVVITAGLPQ-------KPGETRLDL
LDH2_BACC1      AEGEAMDLSHAVPFSPSPTKVW-SGSYADCKDADLVVITAGLPQ-------KPGETRLDL
LDH2_BACCR      AEGEAMDLSHAVPFSPSPTKVW-SGSYADCKDADLVVITAGLPQ-------KPGETRLDL
LDH_OCEIH       ALGDVMDLNHGKAFAPSLTNVW-LGEYGDCKDADIVCICAGANQ-------QSGETRLDL
LDH2_STAAM      VKADVQDLNHGTVHSPSPVDVK-AGEYEDCKDADLVVITAGAPQ-------KPGETRLQL
LDH2_STAAW      VKADVQDLNHGTVHSPSPVDVK-AGEYEDCKDADLVVITAGAPQ-------KPGETRLQL
LDH_STAES       VEADVKDLNHGALYSSSPVTVK-AGEYEDCKDADLVVITAGAPQ-------KPGETRLQL
LDH_STRMU       AVGDALDLSHALAFTS-PKKIY-AAKYEDCADADLVVITAGAPQ-------KPGETRLDL
LDH_STRPN       AVGDALDLSHALAFTS-PKKIY-AAQYSDCADADLVVITAGAPQ-------KPGETRLDL
LDH_STRA3       AVGDAEDLSHALAFTS-PKKIY-AATYADCADADLVVITAGAPQ-------KPGETRLDL
LDH_STRA5       AVGDAEDLSHALAFTS-PKKIY-AATYADCADADLVVITAGAPQ-------KPGETRLDL
LDH_STRP1       TQGDAEDLSHALAFTS-PKKIY-AADYSDCHDADLVVLTAGAPQ-------KPGETRLDL
LDH1_LACLA      TQGDAEDLSHALAFTS-PKKIY-SADYSDASDADLVVLTSGAPQ-------KPGETRLDL
LDH1_ENTFA      TEGDALDLSHALAFTS-PKKIY-AATYDDCHDADLVVLTAGAPQ-------KPGETRLDL
LDH1_LISIN      TIGDAMDLSHAVPFST-PKKIY-SANYSDCHDADLVVVTAGTAQ-------KPGETRLDL
LDH1_LISMO      TIGDAMDLSHAVPFST-PKKIY-SANYSDCHDADLVVVTAGTAQ-------KPGETRLDL
LDH1_LACPL      TKGDALDLEDAQAFTA-PKKIY-SGEYSDCKDADLVVITAGAPQ-------KPGESRLDL
LDH1_LACJO      TQGDAIDLADATPWIA-PKTIY-SAEYSDAKDADLVVISAGAPQ-------KPGETRLDL
LDH2_LACPL      AEGDVKDLEDVAAFTN-ATNIH-TGEYADARDADIVVITAGVPR-------KPGESRLDL
LDH2_LACJO      TEGDALDLEDLAPFVG-QCTVK-SGDYSDAKDADIAVITAGAAR-------KPGMTRLDL
LDH_DEIRA       AQAEAEDIAHAAPVSHGTRVW--HGGHSELADAQVVILTAGANQ-------KPGESRLDL
LDH_THET2       AQAHAEDILHATPFAHPVWVR--AGSYGDLEGARAVVLAAGVAQ-------RPGETRLQL
LDH_THEMA       AEGDALDLIHGTPFTRRANIY--AGDYADLKGSDVVIVAAGVPQ-------KPGETRLQL
LDH_DESVH       AEGESMDLADAMALVGPVQIR--SGGYEQCEGARIVVVTAGAKQ-------MPGQSRLDL
LDH2_BIFLO      VEAEVLDMQHGSSFYPTVSIDG-SDDPEICRDADMVVITAGPRQ-------KPGQSRLEL
LDH_GLOVI       VEGEVMDLVHGIPFVEPSVVR--AGTLADCRGVDVVVITAGARQ-------REGETRLSL
LDH1_CLOAB      AEGEAMDLSHGAAFVKPVVVK--SGDYKDTEGSDIVIITAGAAQ-------KPGETRLEL
LDH_CLOPE       AHAEAMDLAQGAAFVKSVDIK--SGDYADTKDSDIVIITAGVGP-------KPGETRLDI
LDH_CLOTE       AKGEAMDLSHGVSFVKPVDII--AGDYEDTKDSDIVIITAGAGP-------KPGETRLDL
LDH_TREDE       AEGQALDLVQGLPFLPQVDIH--AGDKTDYADSDIVVVTAGAKQ-------QSGETRIDL
LDH3_BACAN      AVGEAMDLSHCINFT-NTRTKVYAGSYEDCKDMDIVIITAGPAP------KPG-QSRLDT
LDH3_BACCR      AVGEAMDLSHCINFT-NTRTKVYAGSYEDCKDMDIVIITAGPAP------KPG-QSRLDT
LDH3_BACC1      AVGEAMDLSHCINFT-NTRTKVYAGSYEDCKDMDIVIITAGPAP------KPG-QSRLDT
LDH1_BIFLO      ALGEARDLDDGSEFQ-DRHVKVRAGDYADCKDADIVVITVGRKP------PAN-SNRMAE
LDH2_LISIN      VEGNRKDLADAAAFM-SGKMDISVREASDCADVDIAVITVTAGP------LKEGQTRLDE
LDH2_LISMO      VEGNRKDLADAAAFM-PGKMDITVRDASDCADVDIAVITVTAGP------LKEGQTRLDE
LDH_FUSNN       AKAHAIDCMDTISFL-PHRAIIRDGGIQELSKMDVIVISVGSLT------KNE--QRLEE
LDH2_LACLA      AEGEALDLLDGVSWG-QENVIVRAGDYKDCKNADIVVVTAGVNQ------KPG-QSRLDL
LDH2_ENTFA      SEGEAIDLLDGVSWG-QENVNVWAGDYQDCQDADIVVITAGANQ------KPG-QSRLDL
LDH2_CLOAB      AKGEALDASHTTSFAYSPNVKVRAGNYEDCADAQIIVITAGPSL----KPDDK-LDRLVL
LDH3_LACLA      ASANSLDLLHALPYLNAAPKNIYAADYSDVSDADIVVLSANAPS----ATFGKNPDRLQL
LDH_BORBU       AKGEVMDLNHGQMFLKKNINVL-FGTYKDCANADIVVITAGLNQ-------KPGETRLDL
LDH_MYCGA       ADGHVRDLRDSKSLKSHNGSTFNVGTYDDLKDADVVAITASIPTVPTA-DGEVFTDRLQL
LDH_MYCPU       AKGHAMDMSDAIALNSTTGSKIRTGTYADAKGADLLIVAAGRPQKQGE-------TRLEM
                  ..  *  .                           :                  *:  

LDH_MYCGE       LEGNVEIMKSIAKEIKKSGFNGVTLIASNPVDIMSYTYLKVTGFEPNKVIGSGTLLDSAR
LDH_MYCPN       LEGNVEIMKNIAKAVKESGFKGITLIASNPVDIMAYTYLKVTGFEPNKVIGSGTLLDSAR
LDH_MYCMS       VAGNAEIMKNIATEVKKSGFDGITVIASNPVDVITHVYQKVTGFDPHKVIGSGTTLDSAR
LDH_MYCPE       VGRNAKIMEEIATNVKDSGFDGITVIASNPVDIMGSVYAKVTGFEPNKVIPSGTILDSAR
LDH_BACHD       VHKNVGIFESIVGNIMKSGFNGIFLVATNPVDILAYATWKFSGLPKERVIGSGTVLDTAR
LDH1_STAAM      VSKNLKIFKSIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSAR
LDH_CORGL       VDKNVKIMKSIVGDVMDSGFDGIFLVASNPVDILTYAVWKFSGLEWNRVIGSGTVLDSAR
LDH_CORDI       VDKNMKIMKSIVDNVMANNFDGIFLVASNPVDILTYAVWKYSGFDHHRVIGSGTVLDSAR
LDH_COREF       VDKNVNIMHTIVDEVMANGFDGLFLVATNPVDILTYAVWKFSGLDHSRVIGSGTVLDTAR
LDH_BACSU       VEKNLKIFKGIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSAR
LDH_GEOSE       VDKNIAIFRSIVESVMASGFQGLFLVATNPVDILTYATWKFSGLPHERVIGSGTILDTAR
LDH1_BACAN      VEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSAR
LDH1_BACC1      VEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSAR
LDH1_BACCR      VEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSAR
LDH2_BACAN      VEKNTKIFKQIVRGIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSAR
LDH2_BACC1      VEKNTKIFKQIVRGIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSAR
LDH2_BACCR      VEKNTKIFKQIVRGIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSAR
LDH_OCEIH       VEKNMKIFKEIVTDVMNSGFNGIFLIATNPVDILTQAVISFSGLPPHRVIGSGTTLDTAR
LDH2_STAAM      VEKNTKIMKSIVKSVMDSGFDGYFLIAANPVDILTRFVKEYTGLPAERVIGSGTVLDSAR
LDH2_STAAW      VEKNTKIMKSIVKSVMDSGFDGYFLIAANPVDILTRFVKEYTGLPAERVIGSGTVLDSAR
LDH_STAES       VEKNTKIMKSIVTSVMDSGFDGFFLIAANPVDILTRYVKEVTGLPAERVIGSGTVLDSAR
LDH_STRMU       VGKNLAINKSIVTQVIESGFNGIFLVAANPVDILTYATWKFSGFPAEKVIGSGTSLDTAR
LDH_STRPN       VGKNLAINKSIVTQVVESGFKGIFLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSAR
LDH_STRA3       VGKNLAINKSIVTQVVESGFNGIFLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSAR
LDH_STRA5       VGKNLAINKSIVTQVVESGFNGIFLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSAR
LDH_STRP1       VEKNLRINKEVVTQIVASGFKGIFLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSAR
LDH1_LACLA      VEKNLRITKDVVTKIVASGFKGIFLVAANPVDILTYATWKFSGFPKNRVVGSGTSLDTAR
LDH1_ENTFA      VHKNLKINKEIVTTIVDSGFNGIFLVAANPVDILTYSTWKFSGFPKERVIGSGTSLDSAR
LDH1_LISIN      VNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTAR
LDH1_LISMO      VNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTAR
LDH1_LACPL      VNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSR
LDH1_LACJO      VNKNLKILSSIVEPIVESGFNGIFLVAANPVDILTHATWRMSGFPKDRVIGSGTSLDTGR
LDH2_LACPL      INRNTKILESIVKPVVASGFNGCFVISSNPVDILTSMTQRLSGFPRHRVIGTGTSLDTAR
LDH2_LACJO      VKTNVKILESIIKPIVESGFNGIFVVSANPVDILTTLTQKLSGFPKNKVIGTGTSLDTAR
LDH_DEIRA       LEKNADIFRELVPQITRAAPDAVLLVTSNPVDLLTDLATQLAPGQP--VIGSGTVLDSAR
LDH_THET2       LDRNAQVFAQVVPRVLEAAPEAVLLVATNPVDVMTQVAYRLSGLPPGRVVGSGTILDTAR
LDH_THEMA       LGRNARVMKEIARNVSKYAPDSIVIVVTNPVDVLTYFFLKESGMDPRKVFGSGTVLDTAR
LDH_DESVH       VRVNAGITRDILTAVMQYADDPLYIMATNPVDVLTHVARTVTGVAPGRVIGSGTVLDSAR
LDH2_BIFLO      VGATVNILKAIMPNLVKVAPNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSAR
LDH_GLOVI       VQRNVEIFRGLIGEIMEHCPNAILLVVSNPVDVMTYVAMKLAGLPPSRVIGSGTVLDTAR
LDH1_CLOAB      INKNYNIFKSIVPEVVKYNPNAILLVVSNPVDILTYITYKLSGFPKSRVIGSGTVLDTSR
LDH_CLOPE       INKNLKIFQSIVPEVVKYSPNSILLVVSNPVDILTYITYKLSGFPKERVIGSGTVLDTSR
LDH_CLOTE       INKNYEIFKGIVPEVVKYSPKSILLVVSNPVDILTYVTYKLSGFPQERVIGSGTVLDTSR
LDH_TREDE       LKRNASIITGIAKDIAESGCSGVMLIVSNPVDILTRAALKASGWERGRVIGSGTVLDTAR
LDH3_BACAN      LGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYQVWKLSGLPRNRVIGTGTSLDSSR
LDH3_BACCR      LGASAKIMESVVGGVMASGFDGIFLLASNPVDIITYQVWKLSGLPRNRVIGTGTSLDSSR
LDH3_BACC1      LGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYQVWKLSGLPRNRVIGTGTSLDSSR
LDH1_BIFLO      LGFTVGLVGEVVDNVMASGFDGVIVMVSNPVDVMAWYAWKRSGLPRTQVLGTGTALDTSR
LDH2_LISIN      LRSTSRIVASIVPEMMKGGFKGIFLIATNPCDIITYQVWKLSGLPREQVLGTGVWLDTTR
LDH2_LISMO      LRSTSRIVSGIVPEMMKGGFNGIFLIATNPCDIITYQVWKLSGLPRERVLGTGVWLDTTR
LDH_FUSNN       LKGSLEAIKSFVPDVVKAGFNGIFVTITNPVDIVTYFVRELSGFPKNRVIGTGTGLDSAR
LDH2_LACLA      VNTNAKIMRSIVTQVMDSGFDGIFVIASNPVDILTYVAWETSGLDQSRIVGTGTTLDTTR
LDH2_ENTFA      VSINAEIMKTIVNNIMKSGFDGILVIASNPVDVLTYVAWQASGLPVSRVIGTGTTLDTTR
LDH2_CLOAB      ADTNVKVTDSIMKNICKYTKDAIIIVVTNPVDIATYYCQNNFDYPKNKIIGTGTLLDTAR
LDH3_LACLA      LENKVEMIRDITRKTMDAGFDGIFLVASNPVDVLAQVVAEVSGLPKHRVIGTGTLLETSR
LDH_BORBU       VDKNSKIFKDIITNVVSSGFDGIFVVASNPVDIMTYVTMKYSKFPIHKVIGTGTILDTSR
LDH_MYCGA       MTANVKILNEIALELKRVGFKGLSIIPTNPCDVMAGVYQKVTGFDPHKIISTGCQLETMR
LDH_MYCPU       IADNSKIMKDIALEIKKSGFNGFTIVISNPVDILATVFQKVTNFPKEKVMSSGTFLDTSR
                   .      .         .   :  :** *:               :. :*  *:: *

LDH_MYCGE       LRYAIATKYQMSSKDVQAYVIGEHGDSSVSIISSAKIAGLSLKHFSKASDI---E-KEFG
LDH_MYCPN       LKFAIAEKYGMSSRDVQAYVLGEHGDSSVSIISSAKIAGLPLKHFSKASDI---E-KEFA
LDH_MYCMS       LRRLVGQKLNVKPESVQAYVAGEHGDSSVAIWSQANIMGRPILDYVKCGCL---TLEDLD
LDH_MYCPE       LQWEVAKRIKINPASLEVYVVGEHGDSSVSVFSQASVGSIPLSKYRKFSD------SQKR
LDH_BACHD       FRYLLGEEMNAAPTSVHGYIIGEHGDSQLPVWSSATIAGTPIAPRLTD-EK--K-----Q
LDH1_STAAM      FRLLLSEAFDVAPRSVDAQIIGEHGDTELPVWSHANIAGQPLKTLLEQ-RP--EGKAQIE
LDH_CORGL       FRYMLGELYEVAPSSVHAYIIGEHGDTELPVLSSATIAGVSLSRMLDK-DP--ELEGRLE
LDH_CORDI       FRYMLGERYDVAPSSIHAYIIGEHGDTELPVLSSATVAGVSMRRQLQK-NP--GLEEELE
LDH_COREF       FRYMLGELYDVSPKSIHAYIIGEHGDTELPVLSSATIAGVSMRKMLEK-DP--ELEPRLE
LDH_BACSU       FRFMLSEYFGAAPQNVHAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDA--YKQEELD
LDH_GEOSE       FRFLLGEYFSVAPQNVHAYIIGEHGDTELPVWSQAYIGVMPIRKLVESKGE--EAQKDLE
LDH1_BACAN      FRYMLGEYFNIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNT--YNQEDLD
LDH1_BACC1      FRYMLGEYFNIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNT--YNQEDLD
LDH1_BACCR      FRYMLGEYFDIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNT--YNQEDLD
LDH2_BACAN      FRYMLGDYLDVDPRNVHAYIVGEHGDTELPVWSHATIGVQKLETILANNEQ--YKQEDLD
LDH2_BACC1      FRYMLGDYLDVDPRNVHAYIVGEHGDTELPVWSHATIGVQKLETILANNEQ--YKQEDLD
LDH2_BACCR      FRYMLGDYLDVDPRNVHAYIVGEHGDTELPVWSHATIGVQKLETILANNEQ--YKQEDLD
LDH_OCEIH       LRYELGEYFHLSPKNIHAYIIGEHGDTELPLWSTATIGTVPLLTYLNRSES--YTTEDLD
LDH2_STAAM      LQYLISQELGVAPSSVDASIIGEHGDTELAVWSQANVAGISVYDTLKE-QT--GSEAKAE
LDH2_STAAW      LQYLISQELGVAPSSVDASIIGEHGDTELAVWSQANVAGISVYDTLKE-QT--GSEAKAE
LDH_STAES       FRYLISKELGVTSSSVHASIIGEHGDSELAVWSQANVGGISVYDTLKE-ET--GSDAKAN
LDH_STRMU       FRQALAEKLDVDARSVHAYIMGEHGDSEFAVWSHANVAGVNLENYLQDVQN--FNGEELI
LDH_STRPN       FRQALAEKLDVDARSVHAYIMGEHGDSEFAVWSHANIAGVNLEEFLKDTQN--VQEAELI
LDH_STRA3       FRQALADKIGVDARSVHAYIMGEHGDSEFAVWSHANVAGVQLEQWLQENRD--IDEQGLV
LDH_STRA5       FRQALADKIGVDARSVHAYIMGEHGDSEFAVWSHANVAGVQLEQWLQENRD--IDEQGLV
LDH_STRP1       FRQALAAKIGVDARSVHAYIMGEHGDSEFAVWSHANVAGVGLYDWLQANRD--IDEQGLV
LDH1_LACLA      FRQALAEKVDVDARSIHAYIMGEHGDSEFAVWSHANVAGVKLEQWFQENDY--LNEAEIV
LDH1_ENTFA      FRQAIAELVDVDARNVHAYILGEHGDTEFPVWSHANVAGLQIYEWVKNNPD--VDEEAMV
LDH1_LISIN      FRMSIADYLKVDARNVHGYILGEHGDTQFPAWSHTTVGGLPITEWINED-----EQGAMD
LDH1_LISMO      FRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISED-----EQGAMD
LDH1_LACPL      LRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGV--SDED-LA
LDH1_LACJO      LQKVIGEMEHVDPRSVNAYMLGEHGDTEFPVWSYNNVGGVKVSDWVKAHPE--VGENKLE
LDH2_LACPL      LRVALAQKLNVATTAVDAAVLGEHGDSSIVNFDEIMINAQPLKTVTTVD------DQFKA
LDH2_LACJO      LRVALSHKTGVNVDHIDAYVLGEHGDTSFENFDEAIIDHKPLRSYKELD------EETLV
LDH_DEIRA       FRHLMAQHAGVDGTHAHGYVLGEHGDSEVLAWSSAMVAGMPVADFMQAQNL-PWNEQVRA
LDH_THET2       FRALLAEHLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARGR-ALSPEDRA
LDH_THEMA       LRTLIAQHCGFSPRSVHVYVIGEHGDSEVPVWSGAMIGGIPLQNMCQICQK-CDS-KILE
LDH_DESVH       FRGHVAEILGVDVRGVHAHIVGEHGDSEVALWSRANVSGIPVAEMCARRGI-AYDAAFRE
LDH2_BIFLO      LRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMCDWTPLPGHDPLDADKRE
LDH_GLOVI       FRYLLAERLRVDPRSLHAYIIGEHGDSEVPVWSRANVAGAFLSEIEPAVGT-PDDPAKMF
LDH1_CLOAB      FRYMLSEHFEIDVRNIHTYIMGEHGDSEIATWSLTNIAGMDVNEYCEA-SCKKCDGSLKY
LDH_CLOPE       LKYMLSEHFDIDARNVHTYIIGEHGDSEITAWSLTNIAGANVEEYCKT-VCANCDGSFKK
LDH_CLOTE       FRYLLGEHFKIDVRNVHTYILGEHGDSEIAAWSLTNIAGISVEDYCKD-ICKGCEGNFKN
LDH_TREDE       FRYTLSKECGVDARNIHGYILGEHGDSEFAAWSMTSVAGRRIDEYCSGGVCSSGPHFDKA
LDH3_BACAN      LRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKER-FGEIDLD
LDH3_BACCR      LRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKER-FGEIDLD
LDH3_BACC1      LRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEKKDQ-FGEIDLD
LDH1_BIFLO      LKTIIGEETGLDPRNVGGFVMGEHGDSQFTAWSTVSLGGKPFARFLADNQDR-FASVSTT
LDH2_LISIN      LRRLLAEKLDIAAQSIDAFILGEHGDSQFPVWSHSSIYGKPVNEY--SMEKL-GESLDLK
LDH2_LISMO      LRRLLAEKLDIAAQSIDAFILGEHGDSQFPVWSHSSIYGKPVNEY--SLEKL-GESLDLK
LDH_FUSNN       LKRILSEVTNIDSQVIQAYMLGEHGDTQIANFSSATIQGVPFLDYMKTHPEQ-FKGVELS
LDH2_LACLA      FRKELATKLEIDPRSVHGYIIGEHGDSEVAVWSHTTVGGKPILEFIVKNKK--IGVEDLS
LDH2_ENTFA      FRKELSQRLAIDPRNVHGYIIGEHGDSEVAVWSHTMIGTKPILEIVDTTER--LTSDDLP
LDH2_CLOAB      MRKIIGKKYNVDSKNVHGYVLGEHGGSSFTSWSDVNIAGIPFNQLNDIFKD--HYKVDKD
LDH3_LACLA      MRQIVAEKLQINPKSIHGYVLAEHGKSSFAAWSNVTVGAIPLTTWLKKYPN--PEFPTFD
LDH_BORBU       LRYFLSDHFNVNTQNIHSYIMGEHGDSSFATWDETKIAMKPLSEYLAEGKI---TELELD
LDH_MYCGA       TRKMISEALGVNSDSVEGFVVGEHGSGAIVPWSVFRVGNVPMKQLIAEGKI---KEEYVK
LDH_MYCPU       FRKFLSEKTGVPTNSVHGFVIGEHGDKSVVVFSRMQIGFSRLDDFLKSKAL---TEDDLK
                 :  :.               .***   .   .   :    .                  

LDH_MYCGE       EIDQFIRRRAYEIIERKGATFYGIGEASADVAEQILKDTKEVRVVAPLLTGQYG--AKDM
LDH_MYCPN       EIDHFIRRRAYEIIERKGATFYGIGEATAEVAELILRDTKEVRVVASLINGQYG--AKDV
LDH_MYCMS       QIQKDTVDMAYKIINLKRATFYGIGACLTKIVNAVLRDEKSTLMVGAQLNGEYK--NKDL
LDH_MYCPE       AIHKDVMRKAYKIINTKRATFYGIGACLARICKAVLRDENVILPVSIKKNADS-----DI
LDH_BACHD       EIAENVRDAAYKIIEAKGATYYGIATGLARITRAILKNENVVLPVGTLLEGENG--HDDV
LDH1_STAAM      QIFVQTRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYD--EEDV
LDH_CORGL       KIFEDTRDAAYHIIDAKGSTSYGIGMGLARITRAILQNQDVAVPVSALLHGEYG--EEDI
LDH_CORDI       KIFEETRDAAYTIIDAKGSTSYGIGMGLARITRAIIHNQEVALPVSAYLEGQYG--QEDI
LDH_COREF       KIFEDTRDAAYRIIDAKGSTSYGIGMGLARITRAILNNQDVALPVSAYLEGQYG--EEDI
LDH_BACSU       QIVDDVKNAAYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYG--ADDV
LDH_GEOSE       RIFVNVRDAAYQIIEKKGATYYGIAMGLARVTRAILHNENAILTVSAYLDGLYG--ERDV
LDH1_BACAN      KIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYG--QKDV
LDH1_BACC1      KIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYG--QKDV
LDH1_BACCR      KIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYG--QKDV
LDH2_BACAN      KIFENVRDAAYHIIERKGATYYGIGMSLLRVTKAILNNENSVLTVSAYLEGQYG--EKDA
LDH2_BACC1      KIFENVRDAAYHIIERKGATYYGIGMSLLRVTKAILNNENSVLTVSAYLEGQYG--EKDA
LDH2_BACCR      KIFENVRDAAYQVIERKGATYYGIGMSLLRVTKAILNNENSVLTVSAYLEGQYG--EKDA
LDH_OCEIH       DIFTNVRDAAYRIIQKKGATYYGIAMSLVRVTEAILKDEHSILTTSSFLQGEYG--VDNV
LDH2_STAAM      EIYVNTRDAAYEIIQAKGSTYYGIALALMRISKAILNNENNVLNVSIQLDGQYGG-HKGV
LDH2_STAAW      EIYVNTRDAAYEIIQAKGSTYYGIALALMRISKAILNNENNVLNVSIQLDGQYGG-HKGV
LDH_STAES       EIYINTRDAAYDIIQAKGSTYYGIALALLRISKALLNNENSILTVSSQLNGQYG--FNDV
LDH_STRMU       DLFEGVRDAAYTIINKKGATFYGIAVALARITKAILDDENAILPLSVFQDGQYG--FNEV
LDH_STRPN       ELFEGVRDAAYTIINKKGATYYGIAVALARITKAILDDENAVLPLSVFQEGQYG--VENV
LDH_STRA3       DLFISVRDAAYSIINKKGATYYGIAVALARITKAILDDENAVLPLSVYQEGQYGD-VKDV
LDH_STRA5       DLFISVRDAAYSIINKKGATYYGIAVALARITKAILDDENAVLPLSVYQEGQYGD-VKDV
LDH_STRP1       DLFISVRDAAYSIINKKGATFYGIAVALARITKAILDDENAVLPLSVFQEGQYEG-VEDC
LDH1_LACLA      ELFESVRDAAYSIIAKKGATFYGVAVALARITKAILDDEHAVLPVSVFQDGQYG--VSDC
LDH1_ENTFA      NLFFNVRDAAYTIIEKKGATFYGIAVALARITKAILNDENSVLPLSVYLEGEYG--QNDI
LDH1_LISIN      TIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYG--MNDI
LDH1_LISMO      TIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYG--MNDI
LDH1_LACPL      KLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYG--LNDI
LDH1_LACJO      AIHKEVADMAYDIINKKGATFYGIGTALAFITKAILNNEHRVLPLSVPMDGEYG--LHDI
LDH2_LACPL      EIEQAVRGKGGQIISQKGATFYGVAVSLMQICRAILNDENAELIVSAALSGQYG--INDL
LDH2_LACJO      ELETDVRKKGGKIIANKGATFYGVAMCLTQICKAILENKALVMPLSAPMTGEYG--IHDL
LDH_DEIRA       KIDEGTRNAAASIIEGKRATYYGIGAALARITEAVLRDRRAVLTVSAPTPE------YGV
LDH_THET2       RIDEGVRRAAYRIIEGKGATYYGIGAGLARLVRAILTDEKGVYTVSAFTPEVEG--VLEV
LDH_THEMA       NFAEKTKRAAYEIIERKGATHYAIALAVADIVESIFFDEKRVLTLSVYLEDYLG--VKDL
LDH_DESVH       KALGHVRHAAYEIIGRKGATGYGIGMSLCRIVEAILHDEHSVLTVSCPVAGHYG--LGDV
LDH2_BIFLO      EIHQEVKNAAYKIINGKGATNYAIGMSGVDIIEAVLHDTNRILPVSSMLKDFHG--ISDI
LDH_GLOVI       EVFEHVKNAAYEIIERKGATSWAIGLATTQIVRAITRNQNRVLPVSVLMSGLHG--IEEV
LDH1_CLOAB      KIYDDVKNAAYHVIEKKGATYYAVALAVKRIVEAILRDENSILTVSSLLEGQYG--IKDV
LDH_CLOPE       ELPEKVKNAAYEIINSKGYTNYAVALAVTRIVEAILRDENAILTVSSLFEGQYG--IDNV
LDH_CLOTE       RIPEEVKNAAYEVLERKGYTSYAIALAVRRIVEAIIRDEDSILTVSTLLRGEYG--INDI
LDH_TREDE       KILEEVRNSAYHIIDYKGSTYFAVGLALTRIAGAILRNEHSILSVSMTLDGEFG--LKDV
LDH3_BACAN      EIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYG--EYDI
LDH3_BACCR      EIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYG--EYDI
LDH3_BACC1      EIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDYRVIAVSAILDGEYG--EYDL
LDH1_BIFLO      EIEEKTRTRGNEIVAAKGGTNFGIASTVAGIVQTILWDERRIVPVSTLLDGEYG--EHDV
LDH2_LISIN      LIGETARDTGFEIYHQKGCTEYGIAGTIVEICRHIFSGSQRALTVSCVLDGEYG--QTGL
LDH2_LISMO      QIGETARDTGFEIYHQKGCTEYGIGGTIVEICRHIFSGSQRALTVSCVLDGEYG--ESGL
LDH_FUSNN       VLEKQVVRTAWDIISGKNCTEFGIGCTCSNLVKAIFHNERRVLPCSAYLNGEYG--HSGF
LDH2_LACLA      NLSNKVKNAAYEIIDKKQATYYGIGMSTARIVKAILNNEQAILPVSAYLRGEYG--QEGV
LDH2_ENTFA      IISDKVKNTAYEIIDRKQATYYGIGMSTARIVKAILNNEQAILPVSAYLDGQYG--QQDV
LDH2_CLOAB      EVDKEVRDSGIEVLKLKGYTSAGIAMSVSRLVKAMLLNEQSILPVSSTLEGEYG--INDV
LDH3_LACLA      EIDQEIREVGLDIFMQKGNTSYGIAASLARLTRAIFRNESVILPVSAYLTGEYG--QFDL
LDH_BORBU       EIHKKVVNAAYEVIKLKGATYYAIGLGIKNIVNAIIGDQNVILPISSYINGQYGGLIKDI
LDH_MYCGA       DIFSRVVKEAFEIIKFKKATYFGIAESMSLITRAYIYNLNTVLGVGVQLDDKYV--ASGI
LDH_MYCPU       WISEKTYKEAYEIINRKRSTYFGIGASVAEMAESVLYNQRRIFPIGIYLDESKP--GGGI
                         .  :   *  *  .:.     :      .       .              

LDH_MYCGE       MFGTPCVLSRKGIEKILEIELSNTEKVALENSIKVLKDNIKLAKL----------
LDH_MYCPN       MFGTPCVLGRNGVEKILEIELSATEKAGLDKSIQVLKDNIKLAKL----------
LDH_MYCMS       YTGVPAIIGSNGWERIIEWDLTKEEQEKFDKSCETLHKTIDSVKHLFE-------
LDH_MYCPE       YIGWPAVVGKDGWHSPLKLTLLAEEKRGFQKSYNSLKKVFEVTWSELGRSEY---
LDH_BACHD       YIGVPAIINREGVRQVVELSLNDEEKEKFARSVETLKDIQAAIWS----------
LDH1_STAAM      YIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSAKTLKDIMAEAEELK--------
LDH_CORGL       YIGTPAVVNRRGIRRVVELEITDHEMERFKHSANTLREIQKQFF-----------
LDH_CORDI       YIGTPAVINRAGINRVVELELTAHEMERFIHSANTLREVQEKFFPPAN-------
LDH_COREF       YIGTPAIIDRSGIHRVVELEISDREMSRFKHSAQTLRAIKDEIFPVGE-------
LDH_BACSU       YIGVPAVVNRGGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN-----
LDH_GEOSE       YIGVPAVINRNGIREVIEIELNDDEKNRFHHSAATLKSVLARAFTR---------
LDH1_BACAN      YIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL-----------
LDH1_BACC1      YIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL-----------
LDH1_BACCR      YIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL-----------
LDH2_BACAN      YVGVPAVINREGVREIVELELNEEEKAKFAHSVKVLKETMAPVL-----------
LDH2_BACC1      YVGVPAVINREGVREIVELELNEDEKAKFAHSVKVLKETMAPVL-----------
LDH2_BACCR      YVGVPAVINREGVREIVELELNEDEKAKFAHSVKVLKETMAPVL-----------
LDH_OCEIH       CIGVPTIINRNGVSEIIEVPMNEDEQKQFNHSVQTLKGIYEPTMQMMK-------
LDH2_STAAM      YLGVPTLVNQHGAVKIYEMPLSAEEQALFDKSVKILEDTFDSIKYLLED------
LDH2_STAAW      YLGVPTLVNQHGAVKIYEMPLSAEEQALFDKSVKTLEDTFDSIKYLLED------
LDH_STAES       YLGLPTLINQNGAVKIYETPLNDNELQLLEKSVKTLEDTYDSIKHLV--------
LDH_STRMU       FIGQPAIVGAHGIVRPVNIPLNDAEKQKMQASAKELKAIIDEAFSKEEFAAAARN
LDH_STRPN       FIGQPAVVGAHGIVRPVNIPLNDAETQKMQASAKELQAIIDEAWKNPEFQEASKN
LDH_STRA3       FIGQPAIVGAHGIVRPVNIPLNDAELQKMQASAEQLKDIIDEAWKNPEFQEASKN
LDH_STRA5       FIGQPAIVGAHGIVRPVNIPLNDAELQKMQASAEQLKDIIDEAWKNPEFQEASKN
LDH_STRP1       YIGQPAIVGAYGIVRPVNIPLNDAELQKMQASANQLKAIIDEAFAKEEFASAAKN
LDH1_LACLA      YLGQPAVVGAEGVVNPIHIPLNDAEMQKMEASGAQLKAIIDEAFAKEEFASAVKN
LDH1_ENTFA      YIGAPAIINRQGVKQVIEIPLTDAEQEKMEASASALKEVIETAFAKFEAEEAK--
LDH1_LISIN      YIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID-------
LDH1_LISMO      YIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID-------
LDH1_LACPL      YIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK-----
LDH1_LACJO      HIGTPAVVGRHGLEQVIEMPLNADEQAKMEASAKQLKEVMDKAFKETGVKVRQ--
LDH2_LACPL      YLGSPAIINRNGLQKVIEAELSDDERARMQHFAAKMLTMMNVAS-----------
LDH2_LACJO      YIGSPAVVTANGISDVIELHLSEDENKKMAYSAAKMKEVVDGIDL----------
LDH_DEIRA       SLSLPRVVGRQGVLSTLHPKLTGDEQQKLEQSAGVLRGFKQQLGL----------
LDH_THET2       SLSLPRILGAGGVEGTVYPSLSPEEREALRRSAEILKEAAFALGF----------
LDH_THEMA       CISVPVTLGKHGVERILELNLNEEELEAFRKSASILKNAINEITAEENKHQNTSG
LDH_DESVH       SLSLPCVIGSDGIEEVLDAPIAEDEQAALAASARVLGEHLAAL------------
LDH2_BIFLO      CMSVPTLLNRQGVNNTINTPVSDKELAALKRSAETLKETAAQFGF----------
LDH_GLOVI       CLAYPAVLNRQGIDRLVKFSLSPGEEEQLQRSARVMRQTLDGIQF----------
LDH1_CLOAB      YMGVPSIVGINGVKDIIEVPLNDEEKNNLTDSAKTLKESLDSIF-----------
LDH_CLOPE       YLAMPTIVDRSGARQILDVPISNEEKENLIKSAEILKGHIANSELD---------
LDH_CLOTE       YMGIPSVIGETGIKRVLEVKLSKDEEKQLKESAEVLKENLNKIPIK---------
LDH_TREDE       CLSVPCIVGRSGAERVIESDLPADEQAALEASAKRLKEAFTEMN-----------
LDH3_BACAN      CTGVPAIITRDGIREIVELNLTEDEESRFAKSNDILRDYMKTIGY----------
LDH3_BACCR      CTGVPAIITRDGIREVVELNLTEDEESRFAKSNDILRDYMKTIGY----------
LDH3_BACC1      CTGVPAIITRDGIKEIVELNLTEDEESRFAKSNDILRDYMKTIGY----------
LDH1_BIFLO      FLGVPTELRANGANEIVELDLSEDERAKLHHSAELVREHCEGLL-----------
LDH2_LISIN      AIGVPAVLSQNGVKEIISLKLNEQEQQAFDHSAAVIKENIKSI------------
LDH2_LISMO      AIGVPAVLSQNGVKEIISLKLDEQEQQAFANSVSVIKKSIASI------------
LDH_FUSNN       YTGVPAIIGSNGVEEILELPLDERERKGFEDACAVMKKYIEVGKSYKIV------
LDH2_LACLA      FTGVPSIVNQNGVREIIELNIDAYEKKQFEKSVSQLKEVIESIK-----------
LDH2_ENTFA      FTGIPAVVGNQGVTDIIELNLNAAEKELFQKSVTQLKQVMASLQPNA--------
LDH2_CLOAB      ALSIPCIITSNGIEKKLEIPLSKDEVEKLNKSADNLKSIIKGLNTNK--------
LDH3_LACLA      YTGSPAIIDRTGVRAVLELELTQEEQEKFKASTVLLKENFDSIKEKCTL------
LDH_BORBU       YIGAPAIVCKEGVKEVLNFKISPKELDKFNSSANQLKSYIDKMEF----------
LDH_MYCGA       YFTVPAVVGKHGWKLHSKLQLSQEEQAAFDKSALNIQKVTKDALDLIGFKN----
LDH_MYCPU       YISRPAILGENGWEEVKNYDLSPAEQKAFDESAINLKKHWDDVQKEISF------
                    *  :   *        :   *   :      :