CLUSTAL format seed alignment for MF_00489

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YQXD_BACSU       MEGWRITLLNEQEKTIFVDADACPVKDEILQTASEYEVQVLFVASFEHYQLSRSNEE-KW
Y1456_LISMO      ---------MECVPQILVDADACPVKAEIKQVAKEFQLEVTFVASFNHYSVNTNGE--NW
Y1374_ALKHC      ----MKNEDSTQIFEVFVDADSCPVKDEIELVAESYKVKVTFVSSYAHNMTVGPTS--KV
Y2825_CLOAB      -------------MKIYVDADACPVVSIVERVAQEMKIPVTLLCDTNHILNSTYS---DI
Y681_STAAM       ------------MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVST
Y1215_CAUVC      -----------MVATLFIDADACP--VKDEAYKVAARHGYKTFVVSNSWIRVPATPVIEQ
Y875_RHILO       ----------MPAPTIYVDADACP--VKAEVEKVAERLGVVVTYVSNGGLRPSRDPMIRN
YAII_ECOLI       -------------MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFIRT
Y881_VIBCH       -------------MKIWVDADACPKVIRETLIRAAERTGVECTFVANHLIPLPKRDNIRA
YPAH_PAULE       -------------MHIWVDADACPSVIKDILFRVADRLQLNVTLVANQLMRVPGSRFIRA
Y5247_PSEAE      -------------MRIWIDADACPKAAKELVCKFALKRKLEVWMVAGQPQVKPPFACVRL
Y845_TREPA       -------------MTLWVDADSCPARVRVLVARAAARLGCVARFVANRPIPLVQSPHCIM
Y029_BORBU       -----------MLSKIFVDADSCNFKIIKFLQKFILHNKSKLIVVSNKFFSLEITE----
                                : :*.*:*                                     

YQXD_BACSU       KYVDPHKEAADLYIANHVKPGDIVVTQDIGLASLLLNRNVSVMSERGRLYKEDTIDFALE
Y1456_LISMO      IFVDTGKESADMRMMNLAKKGDIIVTQDIGLASILLAKGTFVFSNRGELYREEEMSLMLD
Y1374_ALKHC      VMVDAEREAVDLYIANHIKKKDVCVTHDYGLASLLLTKGATVISPRGQMFDHTIIDSLLA
Y2825_CLOAB      KIIGAGADAVDFALINLCHRGDVVVTQDYGVAAMALGKGAYAIHQSGKLYENDNIDRMLM
Y681_STAAM       LYVDDGPDAVDYKIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLD
Y1215_CAUVC      IVVDAGPDVADDWIAERCGPGDVVVTNDIPLADRVLKAGGAAVAPNGRVFSHDMIGSALA
Y875_RHILO       VVVSKGADAADDWIVENAKSNDVVVTADIPLAARAVALGAHVLGPTGRPFTPETIGMAVA
YAII_ECOLI       LRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRERLT
Y881_VIBCH       LQVSSGFDIADNEIVRRTEAGDLVITADIPLADEVISKGGLALNPRGELYTKETIKARLN
YPAH_PAULE       LQVPAGADAADAEIVARVSPGDIVVTGDIPLASLVLEKGGLPLNPRGEWYTKDTIAQQLT
Y5247_PSEAE      VVVESGMDAADDYLVEQAEPGDLAICSDVPLADRLIKKQVAALDPRGREFDARNMGDKLA
Y845_TREPA       VETQPVDQAADRHIIAYARAGDLVVTRDIVLAKAIVDARISVINDRGDVYTEENIRERLS
Y029_BORBU       NVALEVVDNVDSFILNLADRYSLVITRDIFFAKLLLDLGVKVMNDEGRIFDINNINYLYF
                        : .*  :       .: :  *  .*   :      .   *  :    :     

YQXD_BACSU       GRHFSGKQRRKGVYA--KGPKKLNKEDRERFITLLQKILSNDEGILH-------------
Y1456_LISMO      IRYRHAKERQQGKYS--KGPKAMSDQDRSLFKDRLTTFLQNK------------------
Y1374_ALKHC      QRHQSQKDRRAGKKT--KGPRAYLKGDRERFIQQFEKILSNRAGI---------------
Y2825_CLOAB      ERHIAKKARRASSKNHMKGPRKRTSEDDERFEAAFRRLIMRGKV----------------
Y681_STAAM       KRYINAQIRKQGGR--HKGPPPFTKQDQKVFEQSLLKVIHRIKELD--------------
Y1215_CAUVC      SRSIGEHLRSMGEVT--KGPAAFANADRSRFLQALDQLVVKAKRAAPR------------
Y875_RHILO       MRDLKQHLRETGESK--GYNASFAPQDRSRFLGELDRILRRALKSATPG-----------
YAII_ECOLI       MRDFMDTLRASGIQT--GGPDSLSQRDRQAFAAELEKWWLEVQRSRG-------------
Y881_VIBCH       IRDFMDTMRASGIQT--GGPAALSQTERREFANHLDRILAKRTG----------------
YPAH_PAULE       MRAFMEELRGSGVDT--GGPAAFSQADRQNFANALDRELARRRNHSGPR-----------
Y5247_PSEAE      MRNLMADLRDQGQMG--GGQAPYGERDRQAFANALDRLLTRLQREADLRASQPHR-----
Y845_TREPA       VRNFMYDLRGQGLAP--ETTSPFGRRDAARFADSLDRETAKLLRLARRREAKTGEEQCDW
Y029_BORBU       RSKINFNLKIKIKKY---YDEDFNKSRYEKFITNFYSLFFS-------------------
                         :                     *   :                         

YQXD_BACSU       ------------
Y1456_LISMO      ------------
Y1374_ALKHC      ------------
Y2825_CLOAB      ------------
Y681_STAAM       ------------
Y1215_CAUVC      ------------
Y875_RHILO       ------------
YAII_ECOLI       ------------
Y881_VIBCH       ------------
YPAH_PAULE       ------------
Y5247_PSEAE      ------------
Y845_TREPA       PSAQGKSQTGRR
Y029_BORBU       ------------