CLUSTAL format seed alignment for MF_00494

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TAL_CAUVC       MQIFLDSTDTKVIADLASTGLIDGVTTNPTLIAKSGR--------PMLEVIAEICDIVPG
TAL_CAUSK       MQIFLDSTDTKVIADLASTGLVDGVTTNPTLIAKSGR--------PMLEVIAEICDLVPG
TAL_BRUSI       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_BRUA2       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_BRUO2       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_BRUC2       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_BRUAB       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_BRUSU       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_BRUME       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_OCHA4       MKFFVDTADVKEIRELNDLGLVDGVTTNPSLILKSGR--------DIIEVTKEICNIVKG
TAL_RHIME       MKFFVDTADVKDIRELNDLGLLDGVTTNPSLILKAGR--------DIVEVTKEICSIVEG
TAL_SINMW       MKFFVDTADVKDIRELNDLGLLDGVTTNPSLILKAGR--------DIVEVTKEICSIVEG
TAL_RHILO       MKFFVDTADIKDIRELNDLGLLDGVTTNPSLILKSGG--------KIADVTKQICDIVQG
TAL_CHESB       MKFFVDTADVNEIRELSETGLLDGVTTNPSLIMKSGR--------PILEVTREICEIVDG
TAL_MARMM       MKFFVDTAETAEIAELAEAGLVDGVTTNPSLIAKSGR--------NFLEVVKEICDLVEG
TAL_LEPIC       MELYLDTANVDEIKEIASYGLVDGVTTNPSLIAKSGR--------SFKEVIKEICSIVSG
TAL_LEPIN       MELYLDTANVDEIKEIASYGLVDGVTTNPSLIAKSGR--------SFKEVIKEICSIVSG
TAL_DEIRA       MEFFIDTAIVDEIREINAWGVLSGVTTNPSLIVASGR--------DFKEVIGEIAELVPG
TAL_PORGI       MKFFIDTANLDQIREANDMGVLDGVTTNPSLMAKEGISGKD----NCMRHYLAICEIVDG
TAL_BACTN       MKFFIDTANLEQIQEAYDLGVLDGVTTNPSLMAKEGIKGTE----NQREHYIKICKIVNA
TAL_CHLTE       MKFFIDTASLDEIKAANELGVLDGVTTNPSLIAKIVKDSTNFTYADFKAHIAKICEIVDG
TAL_GEOSL       MKFFIDTADVKEIRQAHDLGLVDGVTTNPSLIAKSG--------RKFEDVIKEITEIVD-
TAL_GEOMG       MKFFIDTADVNEIREAHELGLVDGVTTNPSLIAKSG--------RKFEEVIKEITGIVD-
TAL_GEOUR       MKFFIDTADVKEIREAHELGVVDGVTTNPSLIAKSG--------RKFADVIKEITSIVD-
TAL_PELPD       MKFFIDTADVREIREAHELGLVDGVTTNPSLIAKSG--------RKFQEVIQEITSIVD-
TAL_CLOTE       MKFFIDTANVEEIKKVAKWGVLDGVTTNPTLIAREG--------RDLKEVIEEICSIVD-
TAL_CLOPE       MKIFIDTANVEEIRKASKLGVLAGVTTNPSLIAKEG--------RDIKEVIEEICSIVD-
TAL1_LISMF      MRFFIDTANVEEIKKANRMGFIAGVTTNPSLVAKEG--------RDFNEVIQEITSIVD-
TAL1_LISMO      MRFFIDTANVEEIKKANRMGFISGVTTNPSLVAKEG--------RDFNEVIQEITSIVD-
TAL1_LISIN      MRFFIDTANVEEIKKANRMGFIAGVTTNPSLVAKEG--------RDFNEVIQEITSIVD-
TAL_CLOAB       MKLFIDTANVEEIKEVNDMGVICGVTTNPSLVAKEG--------RDFNEVIREITSIVD-
TAL_CALS4       MKFFLDTANIEEIKEAYSLGVISGVTTNPSLVAKEG--------RDFKEVIREIAEIVD-
TAL_CLOD6       MRFFIDTANIEEIKEANDLGVICGVTTNPSLIAKEG--------RDFIEVVKEISEIVD-
TAL_CALS8       MKLFIDTANINEIKEAYSWGIICGVTTNPSLIAKEG--------RDFKEVVNEICSIVD-
TAL_CLOK5       MKLFIDTANVDEIRKANDMGIICGVTTNPSLIAKEG--------RNFKEVVKEITDIVD-
TAL_DESRM       MLLFIDTANVDEIRAANALGVIAGVTTNPSLIAREG--------RDFAEVVKEITSIVD-
TAL_BACHK       MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEG--------VDFHERIREICNVVE-
TAL_BACC1       MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEG--------VDFHERIREICNVVE-
TAL_BACCZ       MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEG--------VDFHERIREICNVVE-
TAL1_BACAN      MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEG--------VDFHERIREICNVVE-
TAL1_BACCR      MKFFIDTANINEIKEANELGVLAGVTTNPSLVAKEG--------VDFHERIREICNVVE-
TAL_BACCN       MKFFIDTANINEIKEANELGILAGVTTNPSLVAKEG--------VDFHERIREICGVVE-
TAL_BACHD       MKFFIDTANINEIREANDLGILAGVTTNPSLVAKEG--------VDFHERLREITSLVK-
TAL_BACSU       MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEAN-------VSFHDRLREITDVVK-
TAL_BACSK       MKFFVDTANINEIKEANELGILDGVTTNPSLVAKEG--------VDFHERIAEIAKLVP-
TAL_GEOTN       MKFFIDTANLEEIKHAHELGILAGVTTNPSLVAKEN--------VSFHDRLREITSIVS-
TAL_OCEIH       MKFFIDTANIDDIRAANSLGILAGVTTNPSLVAKEG--------VSFHDRLREITKEVS-
TAL2_BACCR      MRFFIDTANLEDIKKAYKLGVLAGVTTNPSLVAKEG--------VKFEDRIAEICQAVPK
TAL2_BACAN      MKFFIDTANLEDIKKAYKLGVLAGVTTNPSLVAKEG--------IKFEDRIAEICQAVPK
TAL_ALKOO       MKLFIDTANIEEIREISKWGILSGVTTNPSLIAKEG--------RDLKAVIQEITELVD-
TAL_ALKMQ       MKLFIDTANIEEIKEVAQWGILSGVTTNPSLIAKEG--------RDFKQVIAEITAIVE-
TAL_THEAC       MKIFLDTANIDEIRTGVNWGIVDGVTTNPTLISKEAVN-----GKKYGDIIREILKIVDG
TAL_THEVO       MKIFLDTANISEIKEGIDLGLVDGVTTNPTLISKEAGG-----SKKYAEIIKEILKIVDG
TAL_PICTO       MKIFLDTANIDEIKDAIEYGLIDGVTTNPTLISREQKE-----GRGFSDIVKDILKTVDG
TAL_AQUAE       MKFFLDTANVEEIKKAMEWGILDGVTTNPTLISKT--------GRPFKEVVKEILELVDG
TAL_METM7       MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKE--------GRDFYEVIKEICAIVDG
TAL_METMP       MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKE--------GRDFYEVIKEICSIVDG
TAL_METM5       MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKE--------GRDFYEVIKEICSIVDG
TAL_METVS       MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKE--------GRDFYEVIKEICSIVKG
TAL_META3       MKFFLDTANVDKIKEFNDLGMVDGVTTNPTLIAKE--------GRDFHEVIKEICSIVDG
TAL_METJA       MKFFLDTANVEEIKKYAELGLVDGVTTNPTLVAKE--------GRDFYEVVKEICEIVEG
TAL_THEMA       MKIFLDTANLEEIKKGVEWGIVDGVTTNPTLISKE--------GAEFKQRVKEICDLVKG
TAL_THEP1       MKIFLDTANLEEIKKGVEWGIVDGVTTNPTLISKE--------GAEFKQRVKEICDLVKG
TAL_THEM4       MKIFLDTAKIDEIKKGVEWGIVDGVTTNPTLVSKA--------GTPFKETIKQICEIVQG
TAL_FERNB       MKIFLDTANIDEIRQGVEWGIVDGVTTNPTLISKE--------GADFEKRIKEICELVQG
TAL_STRPG       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRP6       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRPF       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRP3       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRPM       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRPC       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRPB       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRP8       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRP1       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRPD       MKFFLDTANVAAIKAINELGVVDGVTTNPTIISRE--------GRDFETVIKEICDIVDG
TAL_STRA5       MKYFLDTADVSEIRRLNRLGIVDGVTTNPTIISRE--------GRDFKEVINEICQIVDG
TAL_STRA3       MKYFLDTADVSEIRRLNRLGIVDGVTTNPTIISRE--------GRDFKEVINEICQIVDG
TAL2_LISMO      MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKE--------GRPFEEVIKEICSIVDG
TAL2_LISIN      MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKE--------GRPFEEVIKEICSIVDG
TAL2_LISMF      MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKE--------GRPFEEVIKEICSIVDG
TAL_LACPL       MKFFLDTANTEDIKHFAELGLVDGVTTNPTLVSRE--------GRDFETVIKEITQIVSG
                *  ::*::    *      *.: ******:::                     *   *  

TAL_CAUVC       ---PISAEVA--ATTADAMIAEGQKLAKIA---PNVVVKIPLTRDGLIACAAFADE-EIK
TAL_CAUSK       ---PISAEVA--ATTHEAMVAEGRKLAAIA---PNVVVKIPLTRDGLIACAAFAGE-GIS
TAL_BRUSI       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_BRUA2       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_BRUO2       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_BRUC2       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_BRUAB       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_BRUSU       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_BRUME       ---PVSAEVA--ATEYEQMMKEAAVIARIA---DNICIKLPVTLDGLKACKALTSE-GHK
TAL_OCHA4       ---PVSAEVA--ATEYEQMMKEAAVIAKIA---DNICIKLPVTLDGLKACKALSSD-GHK
TAL_RHIME       ---PVSAEVT--ATEYSAMMKEAAALSKIA---DNICIKLPLTLDGLKACKALTSD-GHQ
TAL_SINMW       ---PVSAEVT--ATEYSAMMKEAAALSKIA---DNICIKLPLTLDGLKACKALTSD-GHQ
TAL_RHILO       ---PVSAEVV--ATEYKDMMAEAEVLAKIA---PNVCIKVPLTLDGLKACKTIRTQMNRM
TAL_CHESB       ---PVSAEVT--AVDFKEMMREADILSKIA---DNIAIKVPLTMDGLKACKALTSS-GRM
TAL_MARMM       ---PVSAEVT--ALEAPAMIAEGKKLALLA---DNVVVKLPLTFEGLKACQALTAE-NIQ
TAL_LEPIC       ---PVSAEVL--STKFDGMMKEALELVEIA---ENVVIKVPLIPEGLKTVVELTKR-NIP
TAL_LEPIN       ---PVSAEVL--STKFDGMMKEALELVEIA---ENVVIKVPLIPEGLKTVVELTKR-NIP
TAL_DEIRA       G--AISAEVT--ALDAEGMIKEGKDVAAWH---KQVVVKLPLTPAGLQACKALTSE-GIK
TAL_PORGI       ---DVSAEVI--ATDYEGMIREGEELAALH---PQIVVKVPCTAEGIKAIKYFSDK-GIR
TAL_BACTN       ---DVSAEVI--ATDYEGMIREGEELAALN---PHIVVKVPCIADGIKAIKYFTEK-GIR
TAL_CHLTE       ---PVSAEVT--TLKAGEMIAQGEELAAIH---KNIVVKCPLTVDGLKAIKHFSSN-GIK
TAL_GEOSL       --GPISAEVV--SLEAAGMIREAGELAKIH---KNIVIKLPMTPEGLKACAALTRE-GIK
TAL_GEOMG       --GPISAEVV--SLDHDGMIREAEELAAIH---KNIVIKLPMTPEGLKACTTLTKK-GIK
TAL_GEOUR       --GPISAEVV--ALDHDGMIKEAEELVKIH---PNIVIKLPMTTEGLKATKTLHGE-GIK
TAL_PELPD       --GPISAEVI--ALDAPGMIREAEELVKIH---ANIVVKVPMTPEGLKATKALSAK-GIK
TAL_CLOTE       --GPISAEVI--SLESEKMVEEAKELIKIH---KNIVIKVPMCEEGLKAVSELTKL-GIK
TAL_CLOPE       --GPISAEVM--ALECDEMVREGRELAKIH---KNIVIKIPMCEEGLKAVKVLASE-GIR
TAL1_LISMF      --GPISGEVV--SLEADEMIAEGRVIAKIH---PNMVVKIPMTGEGLAAVKVLTEE-GIK
TAL1_LISMO      --GPISGEVV--SLEADEMIAEGRVIAKIH---PNMVVKIPMTGEGLAAVKVLTEE-GIK
TAL1_LISIN      --GPISGEVV--SLNAEEMIEEGRVIAKIH---PNMVVKIPMTGEGLAAVKVLTEE-GIK
TAL_CLOAB       --GPISGEVI--ALDAEGMIKEGREIAKIH---KNMVVKIPMTEEGLKAVKVLSSE-GIK
TAL_CALS4       --GPISAEVI--SDDHEGMVKEARELAKIH---KNIVIKIPMTAEGLKAVNILSKE-GIK
TAL_CLOD6       --GPISAEVI--SLEHKGMIEEAEKLSKIH---KNIVIKIPMTAEGLKAVKVLSSK-GIK
TAL_CALS8       --GPISAEVI--SLKAEGMIEEARDLAKIH---KNVVIKIPMTTEGLKAVSVLSKE-GIK
TAL_CLOK5       --GPISAEVI--SLEWKEMVKEARELVKIH---KNIVIKIPMTQEGLKAVKVLSQE-EIK
TAL_DESRM       --GPISAEVI--SLDAEGMMKEAVELAAIH---PNIVIKIPMTTEGLKATRACMEK-GIK
TAL_BACHK       --GPVSAEVI--SLEADKMIEEGKELAKIA---PNVVVKVPMTTEGLKAVKAFSDL-GIR
TAL_BACC1       --GPVSAEVI--SLEADKMIEEGKELAKIA---PNVVVKVPMTTEGLKAVKAFSDL-GIR
TAL_BACCZ       --GPVSAEVI--SLEADKMIEEGKELAKIA---PNVVVKVPMTTEGLKAVKAFSDL-GIR
TAL1_BACAN      --GPVSAEVI--SLEADKMIEEGKELAKIA---PNVVVKVPMTTEGLKAVKAFSDL-GIR
TAL1_BACCR      --GPVSAEVI--SLEADKMIEEGKELAKIA---PNVVVKVPMTTEGLKAVKAFSDL-GIR
TAL_BACCN       --GPVSAEVI--SLEADKMIEEGKELAKIA---PNVVVKVPMTKEGLKAVKAFSDL-GIR
TAL_BACHD       --GSVSAEVV--ALDAEGMIKEGKELAAIA---PNITVKVPMTTEGLKAVHAFHQE-GIT
TAL_BACSU       --GSVSAEVI--SLKAEEMIEEGKELAKIA---PNITVKIPMTSDGLKAVRALTDL-GIK
TAL_BACSK       --GSVSAEVI--SLDAEGMIEEGKTLAAIS---ENITVKVPMTVDGLKAVKAFAEL-GIK
TAL_GEOTN       --GSVSAEVI--STDAPGMIEEGEELAKIA---PNITIKVPMTPEGLKAVKAFSEK-GIK
TAL_OCEIH       --GSVSAEVI--SEDAEGMIEEGKELAAIA---PNITVKVPMTLEGLKAVKVFSEL-NIK
TAL2_BACCR      -VESVSAEVTPDAVTAEEMIAQAEELIKINGGDKNVTIKLPMTLAGLEACRYLTEK-GVK
TAL2_BACAN      -VESVSAEVTPDAVTAEEMIAQAEELIKINGGDEKVTIKLPMTLAGLEACRYLTEK-GVK
TAL_ALKOO       --GPISAEVV--GETYEEMLEEAKELVRIH---PNVVIKVPMTEEGLKAVSKFSEQ-GIR
TAL_ALKMQ       --GPISAEVV--SLQAEEMLKEAQDLVAIH---PNVVIKVPMTAEGLKAVKGFSEQ-GIK
TAL_THEAC       ---PVSVEVV--STKYEGMVEEARKIHGLG---DNAVVKIPMTEDGLRAIKTLSSE-HIN
TAL_THEVO       ---PVSVEVV--STKSDGMVEEARKIHALG---DNAVVKIPMTDEGLKAIRKLSQE-NIE
TAL_PICTO       ---PVSIEVV--ATDYQGMIDQATKIHNLG---PNAVIKIPMTLAGLRAMKTLSEK-HIP
TAL_AQUAE       ---PVSLETV--SLDAEGMIREGRMLAELG---ENVVVKIPMTPEGLKAVIALESE-GIP
TAL_METM7       ---PVSAEVI--ALDAEGMVKEARELVKLA---ENVVVKIPMTKEGMKAVNILSKE-GIK
TAL_METMP       ---PVSAEVI--ALDSEGMVKEARELVKLA---ENVVVKIPMTKEGMKAVNILSKE-GIK
TAL_METM5       ---PVSAEVI--ALDAEGMVKEARELVKIA---ENVVVKIPMTKEGMKAVNTLSNE-GIK
TAL_METVS       ---PVSAEVI--ALDAEGMIKEAKELVKIA---ENVVIKIPMTKEGMKAVNILSKE-GIK
TAL_META3       ---PVSAEVI--ALDAEGMIEEARELVKLA---DNVVVKIPMTKEGLKAVNVLSKE-GIQ
TAL_METJA       ---PVSAEVI--STDAEGMVKEARELAKLA---DNIVIKIPMTKDGMKAVKILSAE-GIK
TAL_THEMA       ---PVSAEVV--SLDYEGMVREARELAQIS---EYVVIKIPMTPDGIKAVKTLSAE-GIK
TAL_THEP1       ---PVSAEVV--SLDYEGMVREARELAQLS---EYVVIKIPMTPDGIRAVKTLSAE-GIK
TAL_THEM4       ---PVSAEVV--SSDWQGMVEEARNLAKID---EHVVIKIPMTPDGLKAVKILSTE-GIK
TAL_FERNB       ---PVSAEVI--SLKWDEMVEEARKLASID---DFVVVKIPMTPDGIKAVKILSAE-GIK
TAL_STRPG       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRP6       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRPF       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRP3       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRPM       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRPC       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRPB       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRP8       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRP1       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRPD       ---PISAEVT--GLTADAMVEEARSIAKWH---DNVVVKIPMTTEGLKATNILSKE-GIK
TAL_STRA5       ---PVSAEVT--GLTCDEMVTEAREIAKWS---PNVVVKIPMTEEGLAAVSQLSKE-GIK
TAL_STRA3       ---PVSAEVT--GLTCDEMVTEAREIAKWS---PNVVVKIPMTEEGLAAVSQLSKE-GIK
TAL2_LISMO      ---PVSAEVI--GLEADKMVEEARILAKWA---PNVVVKIPMTEEGLKAVHTLTAE-GIK
TAL2_LISIN      ---PVSAEVI--GLEADKMVEEARILAKWA---PNVVVKIPMTEEGLKAVHTLTAE-GIK
TAL2_LISMF      ---PVSAEVI--GLEADKMVEEARILAKWA---PNVVVKIPMTEEGLKAVHTLTAE-GIK
TAL_LACPL       ---PVSAEVT--ATKAEEMIAQARNEIKWA---SNIVVKIPMTEEGLKAVKVLSGE-GIK
                    :* *.         *: :.              :* *    *: :           

TAL_CAUVC       TNVTLCFSPTQALLAAKAGATYISPFIGRLDDYGFDGMDLIRDIRAIYD-NYGYETEILA
TAL_CAUSK       TNVTLCFSPTQALLAAKAGATYVSPFIGRLDDYGFDGMDLIRDIRAIYD-NYGYETEILA
TAL_BRUSI       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_BRUA2       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_BRUO2       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_BRUC2       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_BRUAB       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_BRUSU       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_BRUME       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDFRTEILA
TAL_OCHA4       VNMTLCFSANQALLAAKAGATFISPFIGRLDDTGINGMELIAEIRTIYD-NYDYRTEILA
TAL_RHIME       TNVTLCFSANQALLAAKAGATFVSPFIGRLDDIAVDGMDLIREIRQIFD-NYGYETEILA
TAL_SINMW       TNVTLCFSANQALLAAKAGATFVSPFIGRLDDIAVDGMDLIREIRHIYD-NYGYETEILA
TAL_RHILO       VNVTLCFSANQALLAAKAGASFISPFVGRIDDTGSDGMELIQEIRQIYD-NYDYQTEILT
TAL_CHESB       VNVTLCFSANQALLAAKAGATFISPFIGRIDDMGIDGMELIAEIRTIYD-NYDFDTEILA
TAL_MARMM       TNVTLCFSANQGLLAAKAGATYVSPFIGRLDDLGVDGMELIANLRMIFD-NYAFDTQILA
TAL_LEPIC       TNVTLCFSAPQALLAAKAGATFISPFIGRVDDTSWDGMELISEIREIYD-NYGYDTRILA
TAL_LEPIN       TNVTLCFSAPQALLAAKAGATFISPFIGRVDDTSWDGMELISEIREIYD-NYGYDTRILA
TAL_DEIRA       TNVTLCFSVPQALLAARAGATYVSPFVGRVDDTGWDGSELIRQIKEAFV-LGDIQTKVLA
TAL_PORGI       TNCTLIFTVGQALLAAKAGASYVSPFVGRLDDIASDGIKLVENIVAMFG-FYRYETEVLA
TAL_BACTN       TNCTLVFSVGQALLAAKAGATYVSPFVGRLDDICEDGVGLVGDIVRMYR-TYDYKTQVLA
TAL_CHLTE       TNATLVFSPTQALLAAKAGADFVSPFVGRLDDISTSGMELVRQIVTIYD-NYGYLTEVIV
TAL_GEOSL       TNVTLIFTPMQALLAAKAGATYVSPFVGRLDDISQDGMGIIDDIKTIFD-NYGYQSEIIV
TAL_GEOMG       TNVTLIFTAMQALLAAKAGATYVSPFVGRLDDISQDGMGIIDDIKTIFD-NYGYTAEIIV
TAL_GEOUR       TNVTLIFSPMQALLAAKAGASYVSPFVGRLDDISQDGMGIVEEIRTIFD-NYGYTTEIIV
TAL_PELPD       TNVTLIFSSLQALLAAKAGATYVSPFVGRLDDISQDGMGIIEEIRTMFD-NYGYTSEIIV
TAL_CLOTE       TNVTLIFSAQQALLAAKAGATYVSPFLGRIDDIGSFGIQLVEDIVTIFT-NFGIESEIIC
TAL_CLOPE       TNVTLIFSPLQALLAARAGASFVSPFLGRLDDIGNPGIEIVTQIAEMFA-LHGIDTEIIS
TAL1_LISMF      TNVTLVFSATQALLAARAGATYVSPFLGRLDDIGDDGLVLIRDIADIFE-IYGIPTEIIS
TAL1_LISMO      TNVTLVFSATQALLAARAGATYVSPFLGRLDDIGDDGLVLIRDIADIFE-IHGIPTEIIS
TAL1_LISIN      TNVTLVFSATQALLAARAGATYVSPFLGRLDDIGDDGLVLIRDIAEIFE-THGIPTEIIS
TAL_CLOAB       TNVTLIFSAGQALLAARAGATFVSPFLGRLDDIGADSIGLIESIVNIFD-IHDIRTEIIA
TAL_CALS4       TNVTLIFSANQALLAARAGATYVSPFVGRLDDINTDGMQIIEDIVTIFT-NYDIQAEIIT
TAL_CLOD6       TNVTLIFSAGQALLAARAGATYVSPFVGRLDDISQNGLDLIEEIVDIFS-VNSIEAQIIV
TAL_CALS8       TNVTLIFSAAQALLAAKAGATYVSPFVGRLDDIGQNGIELIKEIVQIFRNYPDIKTEIIA
TAL_CLOK5       TNVTLIFSAAQALLAAKAGASYVSPFLGRLDDVGMDGIKLIEEIVTIFK-VQNIVTEIIA
TAL_DESRM       TNVTLIFSANQALLAARAGATYVSPFVGRLDDIGQDGIGLIYDIADIFN-NYDLATQIIS
TAL_BACHK       TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFA-IHGIETEIIA
TAL_BACC1       TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFA-IHGIETEIIA
TAL_BACCZ       TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFA-IHGIETEIIA
TAL1_BACAN      TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFA-IHGIETEIIA
TAL1_BACCR      TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFA-IHGIETEIIA
TAL_BACCN       TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQVAEIFA-IHDIETEIIA
TAL_BACHD       TNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHDGLDLISQIAEIFH-VHDLDIQIIA
TAL_BACSU       TNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFD-IHGLDTQIIA
TAL_BACSK       TNVTLIFSVPQALLAARAGATYVSPFLGRLDDIGHDGLQLISDIADIFS-THGLPTQIIA
TAL_GEOTN       TNVTLVFTANQALLAARAGATYVSPFLGRLDDIGHNGLELISTIADIFN-IHGIETEIIA
TAL_OCEIH       TNVTLIFNANQALLAARAGATYVSPFLGRLDDIGQDGMTLISAIAEIFD-RHSVSTEIIA
TAL2_BACCR      TNVTLIFTVNQALLAARAGATYVSPFLGRLDDISEDGVLLVAKIAELFD-VHQLDTQIIA
TAL2_BACAN      TNVTLIFTVNQALLAARAGATYVSPFLGRLDDISEDGVLLVAKIAELFD-VHQLDTQIIA
TAL_ALKOO       TNVTLVFSAPQALIAARAGATFVSPFLGRLDDIGADGIGLIEDIAHIFH-IHHIDTEIIG
TAL_ALKMQ       TNVTLVFSANQALLAARAGASFVSPFVGRLDDIGQEGSELVRQIIEIYD-IHGIETEIIA
TAL_THEAC       TNCTLVFNPIQALLAAKAGATYVSPFVGRLDDIGEDGMQIIDMIRTIFN-NYIIKTQILV
TAL_THEVO       TNCTLVFNPIQALLAAKSGATYVSPFVGRLDDIGQDGMQIIDEIKTIFN-NYIIKTQILV
TAL_PICTO       VNCTLVFNAIQATLAARNGAEYVSPFVGRLDDIGEDGMEIINQIRTIYN-NYSFKTKILV
TAL_AQUAE       TNVTLVFSPTQALLAAKAGASYVSPFVGRLDDISGEGMKLIEEIKTIFS-NYEFDTEIIV
TAL_METM7       TNVTLIFSANQALLAAKAGASYVSPFVGRLDDVGQDGMFLISEVMQVFS-AYGIETEVIV
TAL_METMP       TNVTLIFSANQALLAAKAGASYVSPFVGRLDDVGQDGMFLISEVMQVFG-AYGIETEVIV
TAL_METM5       TNVTLIFSANQALLAAKAGASYVSPFVGRLDDVGQDGMFLISEVMQVFG-AYGIETEVIV
TAL_METVS       TNVTLIFSANQALLAAKAGATYVSPFVGRLDDIGQDGLLLISEIMQIFS-AYGIETEVIV
TAL_META3       TNVTLIFSANQALMAAKAGATYVSPFVGRLDDNGQNGMDLIAEIVQIFT-NYGIATEVIV
TAL_METJA       TNVTLVFSPLQALVAAKAGATYVSPFVGRLDDIGHVGMKLIEDVVKIYK-NYDIKTEVIV
TAL_THEMA       TNVTLVFSPAQAILAAKAGATYVSPFVGRMDDLSNDGMRMLGEIVEIYN-NYGFETEIIA
TAL_THEP1       TNVTLVFSPAQAILAAKAGATYVSPFIGRMDDLSNDGMRMLGEIVEIYD-NYGFETEIIA
TAL_THEM4       TNVTLVFSANQSLLAAKAGASYVSPFVGRMDDIANDGMRMVEEIITIYS-NYGFETEIIV
TAL_FERNB       TNVTLVFSANQALLAAKAGATYVSPFIGRIDDNGNDGLRLLEEIMQIYT-NYGFETEVIA
TAL_STRPG       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRP6       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRPF       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRP3       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRPM       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRPC       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRPB       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRP8       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRP1       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQAEIIA
TAL_STRPD       TNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIID-LYDFQTEIIA
TAL_STRA5       TNVTLIFTVAQGLSAMKAGATFISPFVGRLEDIGTDAYALIRDLRHIID-FYGFQSEIIA
TAL_STRA3       TNVTLIFTVAQGLSAMKAGATFISPFVGRLEDIGTDAYALIRDLRHIID-FYGFQSEIIA
TAL2_LISMO      TNVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLD-NYGLKAEIIS
TAL2_LISIN      TNVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLD-NYGLKAEIIS
TAL2_LISMF      TNVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLD-NYGLKAEIIS
TAL_LACPL       TNVTLVFSVSQGLLAAKAGATYISPFLGRLDDIGGNGIQLVKDLRQVLD-TYGFKTEIIA
                .* ** *.  *.  * : ** ::***:**::*    .  ::  :            .:: 

TAL_CAUVC       ASVRNAAHVKEAAIVGADVVTIPPAVFSDLYKHPLTDKGLEQFLKDWASTGQSIL-----
TAL_CAUSK       ASVRNVTHVKDAAIVGADVVTIPPATFSDLFKHPLTDKGLEQFLKDWAGTGQSIL-----
TAL_BRUSI       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_BRUA2       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_BRUO2       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_BRUC2       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_BRUAB       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_BRUSU       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_BRUME       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTYKGLETFLADWAKTGQKIA-----
TAL_OCHA4       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_RHIME       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLEMFLADWAKTGQKIA-----
TAL_SINMW       ASVRTVNHVKEAALIGADVVTAPPATLKALVKHPLTDKGLETFLADWAKTGQKIA-----
TAL_RHILO       ASVRTVNHVKQAALIGADVITAPPATLKALVNHPLTDKGLAAFLADWAKTGQKIG-----
TAL_CHESB       ASIRSVNHVKQAAIIGADVATVPPAVLKSLVKHPLTDKGLEAFLADWAKTGQKIG-----
TAL_MARMM       ASIRSADHIQQCALLGADVATAPPSVLKGLVKHQLTDKGLEAFMADWQKTGQSIL-----
TAL_LEPIC       ASIRGPIHLKESALRGADCATMPHSAFLQLFKHPLTDIGLEKFLEDSKKLKW--------
TAL_LEPIN       ASIRGPIHLKESALRGADCATMPHSAFLQLFKHPLTDIGLEKFLEDSKKLKW--------
TAL_DEIRA       ASIRHPQHVVQAALAGADVATIPYKVFTQMVKHPLTQAGLDSFMADWAKRQGASPETPPS
TAL_PORGI       ASIRHTQHIIQCLEAGADVATCPLNAIKGLLKHPLTDSGLKAFLEDHRRVNEGK------
TAL_BACTN       ASIRNTKHIIECVEVGADVATCPLSAIKGLLNHPLTDSGLKKFLEDYKKVNG--------
TAL_CHLTE       ASVRNPLHVVESAMVGADIATIPYSVIKQLANHPLTDKGLEKFMEDAAVMKP--------
TAL_GEOSL       ASVRNPVHVLNAALIGADIATIPYSVMLQLAKHPLTDSGIERFLKDWESVPK--------
TAL_GEOMG       ASVRNPIHVLNAALIGADIATIPYSVMLQLAKHPLTDAGIERFLKDWEKVPK--------
TAL_GEOUR       ASVRNPVHVLNSALIGADVATIPYSVIMQLAKHPLTDAGIKKFLEDWEKVPK--------
TAL_PELPD       ASVRNPIHVLNSALIGADIATIPYSVMLQLSKHPLTDAGIKKFLADWESVPK--------
TAL_CLOTE       ASIRTPIHVLECARVGGDIATVPYKVFAQMLKHPLTDRGIEQFLEDY-KSMNK-------
TAL_CLOPE       ASVRNPMHVLDSAMAGSHIATIPYNVILQMVKHPLTDAGMKKFIEDYNKAFNK-------
TAL1_LISMF      ASVRHPIHVIECAKAGADIATVPFKVFEQMLKHPLTDSGIDKFLADWEAAKK--------
TAL1_LISMO      ASVRHPIHVIECAKAGADIATVPFKVFEQMLKHPLTDSGIDKFLADWEAAKK--------
TAL1_LISIN      ASVRHPIHVIECAKAGADIATVPYKVFEQMLKHPLTDSGIDKFLADWEAAKK--------
TAL_CLOAB       ASIRSPKHVIDSAEAGAHIGTVPYKVLKQLIKHPLTDIGIERFMKDWKEAFNK-------
TAL_CALS4       ASVRHPIHVLEAAKLGAHIATVPYKVLMQMIKHPLTDIGIERFKEDWKKAGLKI------
TAL_CLOD6       ASVRNPIHVLQAARMGADIATVPLKVINQMIKHPLTDKGIDSFMKDWEGASLKL------
TAL_CALS8       ASIRHPIHVIEAAKAGADIATVPFKVLEQMTKHALTDIGIERFLKDWEKVPKKN------
TAL_CLOK5       ASIRGPIHVVKCAALGSHIATVPYKVLVQMCKHPLTDIGIERFLKDWESVPDK-------
TAL_DESRM       ASIRHPLHVQQSAKAGAHIATVPYKVLLQMAKHPLTDKGIDAFLADWAKLTPKA------
TAL_BACHK       ASVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK-------
TAL_BACC1       ASVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK-------
TAL_BACCZ       ASVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK-------
TAL1_BACAN      ASVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK-------
TAL1_BACCR      ASVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK-------
TAL_BACCN       ASVRHSVHVTEAALNGAHIATIPANVIGALVKHPLTDQGIEKFLADWEKTQEK-------
TAL_BACHD       ASIRHPQHVTEAALRGAHIATIPFKVISQLSKHPLTDKGIEQFLKDWNNR----------
TAL_BACSU       ASIRHPQHVTEAALRGAHIGTMPLKVIHALTKHPLTDKGIEQFLADWNK-----------
TAL_BACSK       ASVRHPVHVSEAAKRGAHIATIPLNVIKQLTGHPLTDKGIEKFLADWNKENVEK------
TAL_GEOTN       ASIRHPHHVTEAALRGAHIATVPYKVLMQLFNHPLTDQGIEKFLADWNRQQ---------
TAL_OCEIH       ASIRHPLHVTDAALNGAHIATIPYKVLEQLVKHPLTDQGIQKFLDDWNSQK---------
TAL2_BACCR      ASVRHPDHVTRVAMAGAHIATIPYKVIEQLAMHPLTDQGIEKFAADWAKAPKL-------
TAL2_BACAN      ASVRHPDHVTRVAMAGAHIATIPYKVIEQLAMHPLTDQGIEKFAADWAKAPKL-------
TAL_ALKOO       ASIRHNLHVMNAAKAGAHIATIPYKVLKDMVKHPLTDIGIEKFMADWNKTKK--------
TAL_ALKMQ       ASIRHTQHLTDAALAGAHIATVPYKVLKQSLLHPLTDQGIEKFLKDWEGLVK--------
TAL_THEAC       ASIRNPIHVLRSAVIGADVVTVPFNVLKSLMKHPKTDEGLAKFLEDWKKVSPDGKLIL--
TAL_THEVO       ASVRNPIHVLRAAIIGADVVTIPFSVLKLLIKHPKTDEGLTRFLEDWKKVSPDGKFII--
TAL_PICTO       ASVRNPVHVLRSMIIGADVITMPYDVIKKLAMHPKTDEGLSKFLSDWKKVSPDGSFPI--
TAL_AQUAE       ASVRHPMHVLESALIGADICTMPFKVMEQLFKHPLTDIGLERFLKDWEKV-PEKPF----
TAL_METM7       ASVRHPIHVIESAKMGADIATIPFDVLDKLFNHPLTDNGIEKFLADWEAHMNR-------
TAL_METMP       ASVRHPIHVLESAKMGADIATIPFDVLDKLFNHPLTDNGIAKFLSDWEAHMNR-------
TAL_METM5       ASVRHPIHVLESAKMGADIATIPFDVLDKLFNHPLTDNGIAKFLADWEAHTNR-------
TAL_METVS       ASVRHPIHVTESAKMGADVATIPFDVLDKLFNHSLTDIGIEKFLADWDAHLKR-------
TAL_META3       ASVRHPIHVIQSAEMGADVATIPFAVLDKMFNHPLTDKGIESFMKDWEEFQKNK------
TAL_METJA       ASVRHPWHVLEAAKIGADIATMPPAVMDKLFNHPLTDIGLERFLKDWDEYLKSRK-----
TAL_THEMA       ASIRHPMHVVEAALMGVDIVTMPFAVLEKLFKHPMTDLGIERFMEDWKKYLENLKK----
TAL_THEP1       ASIRHPMHVVEAALMGVDIVTMPFAVLEKLFKHPMTDLGIERFMNDWKKYLENLKK----
TAL_THEM4       ASIRHPRHVLEAALMGADIATVPFAVLEKMFYHPMTDLGIERFLRDWEKYKAGR------
TAL_FERNB       ASVRHPMHVVEAAMIGVDIATIPFDVLKKMFLHPLTDVGIKRFLQDWEEYKKNKK-----
TAL_STRPG       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRP6       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRPF       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRP3       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRPM       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRPC       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRPB       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRP8       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRP1       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRPD       ASIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK--------
TAL_STRA5       ASIRGLAHVEGVAKCGAHIATIPDKTFASLFTHPLTDKGIETFLKDWDSFKKK-------
TAL_STRA3       ASIRGLAHVEGVAKCGAHIATIPDKTFASLFTHPLTDKGIETFLKDWDSFKKK-------
TAL2_LISMO      ASIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN----
TAL2_LISIN      ASIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN----
TAL2_LISMF      ASIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN----
TAL_LACPL       ASVRGPQHVQEAALAGADIATIPATVFGKLWSHPLTDKGLASFASDWKAFQATQK-----
                **:*   *:      * .  * *   :     *  *  *:  *  *              

TAL_CAUVC       -----------
TAL_CAUSK       -----------
TAL_BRUSI       -----------
TAL_BRUA2       -----------
TAL_BRUO2       -----------
TAL_BRUC2       -----------
TAL_BRUAB       -----------
TAL_BRUSU       -----------
TAL_BRUME       -----------
TAL_OCHA4       -----------
TAL_RHIME       -----------
TAL_SINMW       -----------
TAL_RHILO       -----------
TAL_CHESB       -----------
TAL_MARMM       -----------
TAL_LEPIC       -----------
TAL_LEPIN       -----------
TAL_DEIRA       EAGTNPVKKEG
TAL_PORGI       -----------
TAL_BACTN       -----------
TAL_CHLTE       -----------
TAL_GEOSL       -----------
TAL_GEOMG       -----------
TAL_GEOUR       -----------
TAL_PELPD       -----------
TAL_CLOTE       -----------
TAL_CLOPE       -----------
TAL1_LISMF      -----------
TAL1_LISMO      -----------
TAL1_LISIN      -----------
TAL_CLOAB       -----------
TAL_CALS4       -----------
TAL_CLOD6       -----------
TAL_CALS8       -----------
TAL_CLOK5       -----------
TAL_DESRM       -----------
TAL_BACHK       -----------
TAL_BACC1       -----------
TAL_BACCZ       -----------
TAL1_BACAN      -----------
TAL1_BACCR      -----------
TAL_BACCN       -----------
TAL_BACHD       -----------
TAL_BACSU       -----------
TAL_BACSK       -----------
TAL_GEOTN       -----------
TAL_OCEIH       -----------
TAL2_BACCR      -----------
TAL2_BACAN      -----------
TAL_ALKOO       -----------
TAL_ALKMQ       -----------
TAL_THEAC       -----------
TAL_THEVO       -----------
TAL_PICTO       -----------
TAL_AQUAE       -----------
TAL_METM7       -----------
TAL_METMP       -----------
TAL_METM5       -----------
TAL_METVS       -----------
TAL_META3       -----------
TAL_METJA       -----------
TAL_THEMA       -----------
TAL_THEP1       -----------
TAL_THEM4       -----------
TAL_FERNB       -----------
TAL_STRPG       -----------
TAL_STRP6       -----------
TAL_STRPF       -----------
TAL_STRP3       -----------
TAL_STRPM       -----------
TAL_STRPC       -----------
TAL_STRPB       -----------
TAL_STRP8       -----------
TAL_STRP1       -----------
TAL_STRPD       -----------
TAL_STRA5       -----------
TAL_STRA3       -----------
TAL2_LISMO      -----------
TAL2_LISIN      -----------
TAL2_LISMF      -----------
TAL_LACPL       -----------