CLUSTAL format seed alignment for MF_00495

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GPH_XANCP             -----------------------------MRFPRAVLFDLDGTLLDSAPDMLATVNAMLS
Q5GZB6_XANOR          MGFATAVGWGLDGPGGVPGDTQLTTDVAAADFPRVVLFDLDGTLLDSAPDMLATVNAMLD
GPH_XYLFA             ---------------------MPLNEPSSNAFPRTVLFDLDGTLLDSAPDMLATANAMLA
GPH_XYLFT             ---------------------MPLNEVSGNAFPRTVLFDLDGTLLDSAPDMLATANAMLA
B1M4B6_METRJ          ---------------------MPAPPPAAPSRFDAVLLDLDGTLVDSLADLRTALNETLA
GPH_CERS4             --------------------------------MPGVVFDLDGTLVHSAPDIHAAVNKALA
S5YB11_PARAH          ----------------------MEDDMNTCLHPCPLVFDLDGTLIDSAPDIRAAVNEVLA
GPH_RHOCA             -------------------------------MAPALIFDLDGTLIDSAPAIHKVSNDVLR
A8LIZ8_DINSH          ------------------------------MRYDAVVFDLDGTLVDSAPDMARAINGVLA
GPH_RHILO             ------------------------------MSRPIIVFDLDGTLIDTAPDLLDSLNHSLA
X6FX63_9RHIZ          ------------------------------MTRPIIVFDLDGTLVDTAPDLLDSLNHSLA
GPH_AGRFC             --------------------------MTSRPLSPLAIFDLDGTLVDTAADLVSSLNHTIA
GPH_CAUVC             ------------------------MSTLHDLNGATIAFDLDGTLVDTAPDLVGALNIILA
A0A246KA99_BREDI      ------------------------MSIERDLEGWTIAFDLDGTLVDSAPDLIGTLNRMLA
B1M274_METRJ          ------------------------MSTEPTRKPPIAVFDLDGTLAETAGDLIGTLNVLMK
D7A672_STAND          ------------------------MSAPPTR-PAVIAFDLDGTLVDTAPDLLDTLDVILD
F2J5C3_POLGS          --------------------------------MSVLVFDLDGTLVDTIADLTATLNAVLT
GPH_RHORT             ------------------------------MP-KAVIFDLDGTLVHSLPGLTDALNKTLA
G8AMG8_9PROT          -----------------------MSIMSATIPFSAVVFDLDGTLIDSARDMTRVLNRTLS
GPH_THIDA             -------------------------MKSFPLPIKAVVIDLDGTLLNTAPDLAHAAELMMA
Q7VU63_BORPE          -----------------------------MHTINAVLLDLDGTLLDSVPDLAIAANAIRR
B1Y7K4_LEPCP          -------------------------MQLFGREFDAAIVDLDGTMVDTQGDFVVALGLCLT
Q8Y1V8_RALSO          --------------------MPNMSTHFHHQPVEAFIIDLDGTMVDTIDDLAIAFNTALN
Q1LIH7_CUPMC          -------------------MSLEILRRTDWHAIRAVIVDLDGTMVDTAGDFHAAVNAMLL
GPHC_CUPNH            -------------------------MATVSMPCTAVLIDLDGTLVDSAPDIVEAANRMLA
GPHP_CUPNH            -------------------------MATVSLPCTAVLIDLDGTLVDCAPDIVEAANRMLA
E1TES8_BURSG          --------------MIAQPPGLPHLQGSVRSATHAVLIDLDGTMVHTAPDIVEAASRMLA
B2JVP0_PARP8          -----------------------MQVMPRNLPIDAVLFDLDGTLLHTSPDIGNALNRALA
GPH_PECAS             --------------------------MAELTAIRGLAFDLDGTLIHSAPGLAAAIDQALV
GPH_YERPE             --------------------------MVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALA
GPH_ECOLI             --------------------------MNKFEDIRGVAFDLDGTLVDSAPGLAAAVDMALY
GPH_SHIDS             --------------------------MNKFEDIRGVAFDLDGTLVDSALGLAAAVDMALY
C5BGQ0_EDWI9          --------------------------MNKGIPVQALAFDLDGTLVDSASGLAAATDAAML
GPH_PHOPR             --------------------------MKQFEGIKFIAFDLDGTLLDSVPDLAEAADKAMQ
GPH_PASMU             -----------------------------MTQFKLIGFDLDGTLVNSLPDLALSVNSAFA
GPH_MANSM             ----------------------------MNSQFKLIGFDLDGTLVNSLPDLALSVNSALA
B0UV01_HISS2          -----------------------------MTQFKLIGFDLDGTLVNSLPDLALSINSALK
A3N3I7_ACTP2          ----------------------------MTAKYKVIGFDLDGTLVNTLPDLTLVANSMFA
GPH_NITOC             ----------------------------MLKQPEMILIDVDGTLVDSVPDLTFCTDTMME
GPH_PSYA2             ----------------------------MDKQ--LLIFDFDGTLIDSVPDLADAVNAMLT
GPH_PSEF5             --------------------MSAFEQLFQGRLPRLVMFDLDGTLVDSVPDLAAAVDQMLL
A1U6G7_MARHV          ---------------------MSLKGLFNARWPGVALFDLDGTLVDSAPDLAAAVDQMLE
GPH_NEIG1             -------------------------MNAAIEHVQAVAFDLDGTLCDSVPDLAAAAEAMLE
GPH_CHRVO             ---------------------------MNLKHIKAVAFDLDGTLVDSIPDLANAANAMRE
GPH_AQUAE             --------------------------------MRVILFDLDGTLIDSAKDIALALEKTLK
                                                           .*.***: .    :         

GPH_XANCP             ERGLPCITLAQLRPV--------VSKGSRAMLAVAFAHL---------------------
Q5GZB6_XANOR          ARGRAPIALASLRPV--------VSKGARAMLGVAFAEL---------------------
GPH_XYLFA             ARGRAPITLAQLRPV--------ISIGTFRILAVAFPEL---------------------
GPH_XYLFT             ARGRAPITLMQLRPV--------ISRGTFRIIAVAFPEL---------------------
B1M4B6_METRJ          REGLPPVGAAAMRAM--------VGDGAVALLRRALRASG--G-----------------
GPH_CERS4             EEGGAPFTLAEITGF--------IGNGVPVLIQRVLAARGEAP-----------------
S5YB11_PARAH          ENGLPALTLAEVHGF--------IGGGVEVLWRKIIAAKGLSP-----------------
GPH_RHOCA             ARGYAPLGLDQIRSF--------VGQGAPHLVRCLLTTAGEDP-----------------
A8LIZ8_DINSH          TRGRRALSLAEVISF--------IGSGARILVQRSLRATG-GI-----------------
GPH_RHILO             ASELTAVDEAGFRRF--------VGHGGRVMIERAHAAQQRSL-----------------
X6FX63_9RHIZ          ASELAAVDEAGFKRF--------VGHGGRVMIERAHAAQQRSL-----------------
GPH_AGRFC             AAGLAPVTYDDLTHL--------VGQGARVMIKRAFALRETEL-----------------
GPH_CAUVC             QESLPPLPFDDVRLM--------VGRGARALLERGFAAAGAPL-----------------
A0A246KA99_BREDI      EYELPPVPMSSTRHL--------VGHGAMAMLRHGFVEAGAAW-----------------
B1M274_METRJ          REGLAELPLSQARGL--------IGAGARALIRRGFEAEGRPL-----------------
D7A672_STAND          EVGAPRLPREETRKM--------IGAGAKALVNRGLTAAGIDV-----------------
F2J5C3_POLGS          GAGHPAVPVETMRVA--------AGQGARVMLREGLALSGTRL-----------------
GPH_RHORT             EDDLAPLDEAAVKRM--------VGEGAGLLVARAFAAYGLGR-----------------
G8AMG8_9PROT          RFARPTLTEEQVRGM--------VGDGSAALVRQAFAATGDAL-----------------
GPH_THIDA             ELGRPCPSLETISTY--------IGNGVSRLVKRVLTGEMD-AEPDP-------------
Q7VU63_BORPE          DLGMAQLPEALVATF--------VGKGVDNLVRRALAGSLDGAAPDE-------------
B1Y7K4_LEPCP          ELGLPVVDAAFVELT--------VGKGSEHLIRSTLAHVGGDP-----------------
Q8Y1V8_RALSO          QLGLAPVATAFVERM--------INKGPEHLVRAALGDAGTDM-----------------
Q1LIH7_CUPMC          ALAHKHPNLGPVEPMSQEDIVSFVGKGSENLIRRVLDARFSPLHAN--------------
GPHC_CUPNH            DFGSPALPFDTVAGF--------IGRGVPNLVRRVLETAGLTPRVE--------------
GPHP_CUPNH            DLGSPALPFGTVAGF--------IGRGVPNLVRRVLETAQLAPRVD--------------
E1TES8_BURSG          DFGHAPLPFEMVSGF--------IGKGVPNLVRRTLAAAALNEQVD--------------
B2JVP0_PARP8          ENGLPLLAPGVAQTL--------IGGGSEILVDRALTLLGVESRPATL------------
GPH_PECAS             AQSLPAAGESRVATW--------IGNGADVMVERALRWAGVE-----------------P
GPH_YERPE             HQGLPAAGEALVSTW--------IGNGADVLVERALHWAGRE-----------------H
GPH_ECOLI             ALELPVAGEERVITW--------IGNGADVLMERALTWARQERATQRKTMGKPPVDDDIP
GPH_SHIDS             ALKLPIAGEERVITW--------IGNGADVLMERALTWARQERATLRKTMGKPPVDDDIP
C5BGQ0_EDWI9          ALDYPAPGVERVKLW--------LGNGADVLMQRALSWAGAP-----------------Q
GPH_PHOPR             ALGRDRVTVEQVTTW--------IGNGADILIGRALSQSIEL--------------DPEL
GPH_PASMU             EFDLPQAPEDLVLTW--------IGNGADILIARALAWAKAQ-------------TGKTL
GPH_MANSM             EFELPQAPEELVLTW--------IGNGADILIGRALDWAKEQ-------------SGKSL
B0UV01_HISS2          DVNLPQASENLVMTW--------IGNGADVLSQRAVDWACTQ-------------AEKEL
A3N3I7_ACTP2          EYGLPTTTQEKVLTW--------IGKGADIFFQNAIAYT-----------------GQVF
GPH_NITOC             RLGLPLRGETKVRQW--------VGNGVERLIKRALVDNME----------------GEP
GPH_PSYA2             TLGKAPYPIDTIRNW--------VGNGSRMLVERALVGKIEV-------------SEGEL
GPH_PSEF5             KLGRKPAGVEAVREW--------VGNGAPMLVRRALANSLE---------------AQGV
A1U6G7_MARHV          HLGRSPAGMDKVRTW--------VGNGAQVLVRRALAGKTDWE------------PATAK
GPH_NEIG1             QLGMKPLPAKVVESY--------VGDGIGKLVHRVLTNDRDR----------------EA
GPH_CHRVO             HLGLPPLDPERIKSH--------VGDGIASLVHRAITDERHA----------------EA
GPH_AQUAE             ELGLEEYYPDNVTKY--------IGGGVRALLEKVLKDK---------------------
                                              . *   :                             

GPH_XANCP             DAAAREALVPEFLKRYEALLGTQ----AQLFDGVEVMLQRLEQAGCVWGIVTNKPEYLAQ
Q5GZB6_XANOR          DAEACVALVPEFLQRYEDVIGTQ----SQLFDGVEELMVRLENAGCVWGIVTNKPEYLAR
GPH_XYLFA             DAAAIQGLIPEFLQRYEALIGSV----SKPFDGVEMMLDALECAGTVWGIVTNKPEFLAR
GPH_XYLFT             DAAAIQGLIPEFLQRYEALIGSV----SKPFDGVEMMLHALECAGTVWGIVTNKPEFLAR
B1M4B6_METRJ          DPGRAPALLPAFLAVYEPLAAAG----TPLFPGAAAAVRDLRTAGYALAIVTNKPARATG
GPH_CERS4             DAHRQAELQGRFMAHYEADPAT----LTSVYPGAEAAIRHLRAEGWRIGLCTNKPVGASR
S5YB11_PARAH          EDH--ARYVAAFLTRYEAATG-----LSALYPGVTEALETLATRGHALAICTNKPLEPAR
GPH_RHOCA             EGPLFDAIYADLVSRYETDVE-----GNTLYPGVITALQRLREMGCPMAITTNKPYKPAL
A8LIZ8_DINSH          EGE--DDALAEFLRRYETGVDH----ETAVYTGVMEMLGALRAAGLPMALCTNKPEAPAR
GPH_RHILO             DVAEHDRLLKLFLDHYTDNIPGK----SRPYPGVIEAIARFEKAGYLLAICTNKYEANSL
X6FX63_9RHIZ          VVEEHDRLLKLFLDHYTDNIPGK----SLPYPGVVETIARFEAAGYLLAVCTNKYEANSV
GPH_AGRFC             PEADIDPLYERFITHYRAEMPGE----SRPYPGIIETLDALSQAGITLAVCTNKTEILAV
GPH_CAUVC             DAEQAPALVQRFIDVYLARIADE----SAPFPGVVEVLSDLKTAGAKLVVCTNKLTNLST
A0A246KA99_BREDI      DEAHAPGLFERFIEHYLAHIADE----SRPFDGCVAALDRLSARGATLCVATNKRTDLSV
B1M274_METRJ          SPEDHDRLFDAFIAHYGAHLADT----SHLFPGVVEALDALEAAGFRLAVCTNKYEGQSV
D7A672_STAND          APPDFDKLYERFLEHYAAHIADS----SAPFPGLVAALDELSARGHVLAVCTNKLEYLSR
F2J5C3_POLGS          AEEEIDPLYTAFLAHYEAHIADF----SRPFPGAVAAIEALRAEGWRCAVCTNKLERLAR
GPH_RHORT             ADDADDTATQARLARFLAHYAPDPLAGASVYPGALALLGALAARGIRLGVCTNKPEGPAR
G8AMG8_9PROT          TEDALKTALADYLDAYFQDDEP-----PVLYPGVPETLAVLADSGVRLGLCTNKPERITR
GPH_THIDA             --ALFAQAIASYQKHYGEHVSLHS----RPFDGVVEGLQAFKAMGLHMACITNKAEQFTV
Q7VU63_BORPE          --ALFARGRLSFFKHYHAVNGAHA----TVFDGVKAGLAAMREQGLPLAVVTNKPTEFTL
B1Y7K4_LEPCP          --ALYDAAWAAYQRHYLAINGRHS----RVYDGVIDGLTQLRGAGLRLACLTNKPGDFAR
Q8Y1V8_RALSO          --ALYERCLQLYRKAYGEINGKYA----RVYPGVGESLAELRALGMKLACLTNKPGSFAR
Q1LIH7_CUPMC          --GLFADAYALYDREYVRINGQFS----NVYPNVREGLTALKAMGLRMACVTNKPWNFTE
GPHC_CUPNH            ----AAEAVAMFHRHYAETNGRLG----SVFPGVEAGLEALRRQGYRLACVTNKPRALAV
GPHP_CUPNH            ----ATDAVAMFHRHYADTNGRLG----SVFPGVEAGLAALRRQGYRLACVTNKPRALAV
E1TES8_BURSG          ----QETALMVFHRHYEETNGRYG----YVYPHVAAGLRELRRLGYRLACVTNKPEALAA
B2JVP0_PARP8          --DLVLRRYESCYHQICRGEDQLT----QPYPGAEATLDSLRGMGLKLGLVTNKETRFVD
GPH_PECAS             TAARVQETRERFDSYYAQTVDSGS----TLFLQVKETLAQLAQQGVPMAVVTNKPTPFVA
GPH_YERPE             NAQLVAQTRELFDHYYAKTVEQGS----QLFPQVKATLAQLAANGLPIGLITNKPTPFVA
GPH_ECOLI             AEEQVRILRKLFDRYYGEVAEEGT----FLFPHVADTLGALQAKGLPLGLVTNKPTPFVA
GPH_SHIDS             AEEQVRILRKLFDRYYGEVAEEGT----FLFPHVADTLGALQAKGLPLGLVTNKPTPFVA
C5BGQ0_EDWI9          DAALCQRARRAFDAHYAESANQGC----QLFPGVRETLGVLAAKGFPLAVITNKPSPFVR
GPH_PHOPR             DLALHQEARALFDRFYDEGGHKQS----HLYAGVKETLAAFHQANIPMAIVTNKPAQFVP
GPH_PASMU             NDEQIKALKRRFGFYYGENLCNLS----VLYPNVKSTLETLKQKGYLLAVVTNKPTKHVQ
GPH_MANSM             TDEQTAQLKERFSFYYAENLCNVS----RLYPNVKETLETLKEQGFILAVVTNKPTRHVQ
B0UV01_HISS2          TEDEFKYFKRQFGFYYGENLCNIS----RLYPNVKETLEALKAQGYILAVVTNKPTKHVQ
A3N3I7_ACTP2          DAPKLVRLRTSFDKYYAAYVCEES----ELYPNVKQTLETLRAQGYTLVVITNKPTKLVE
GPH_NITOC             EEDLYQKAETIFLALYADNTSKRS----HLYPGVNEGLAWLKSQGYRVGCVTNKAAQFTY
GPH_PSYA2             AKETIDHAEQVFFDAYSKMGGSKT----VAYPNVDSGLKKLKAAGFKLALVTNKPIRFVP
GPH_PSEF5             DDVEAEYALELFNTAYED-SHELT----VVYPGARETLKWLHKQGVEMALITNKPERFVA
A1U6G7_MARHV          DEALFNDALTIFYHAYGQLNGRHS----EVFPGVQDCLDHLRQLGCRMAVVTNKPDQFVQ
GPH_NEIG1             DSELWEKGFVSYMKYYRDHLSVFT----RPYPETEAGLALLKSLGIPLVIITNKNEILAA
GPH_CHRVO             DGPLWERGYRFFVQRYREHLADHT----TVYPGVRDGLGLLRALQLPLVMITNKSERLAV
GPH_AQUAE             ---FREEYVEVFRKHYLENPVVYT----KPYPEIPYTLEALKSKGFKLAVVSNKLEELSK
                                                    :      :  :          :**      

GPH_XANCP             LILPQLGWQQRCAVLIGGDTLAERKPHPLPLLVAADRIGVAATQCV--YVGDDERDILAA
Q5GZB6_XANOR          LILPQLGWEQRCAVLIGGDTLAERKPHPLPLLAAAERIGVAPAQCV--YVGDDARDILAA
GPH_XYLFA             LILPLLGWTSRCAVLIGGDTLAERKPHPLPLLTAAERIGVMPTDCV--YVGDDVSDIQAA
GPH_XYLFT             LILPLLGWTSRCAVLIGGDTLAERKPHPLPLLTAAERIGVMPTDCV--YVGDDVRDIQAA
B1M4B6_METRJ          LILDAVGLAPLIDTVVGGDTLPERKPDPAPLREALRRLGVAPGRAV--MVGDMHHDIAAA
GPH_CERS4             QILSLFGLLELFDAIIGGDSLPQRKPDPAPLRATAAALNEEVV----LYVGDSEVDAATA
S5YB11_PARAH          AVLRKTGLDGFFRVVIGGDSLPVKKPDPAPVQAALAALGADPLRPDGIYIGDSEYDASAA
GPH_RHOCA             AAIAHVGLTDYFQLVIGGDSLPTRKPNPEMVNEARRVLRRPHA----LYIGDSEIDAQTA
A8LIZ8_DINSH          DLSARLGLGGFFPVIVGGDTLPVLKPDPAPLHHAITGLSADPART--LYVGDSETDYKTA
GPH_RHILO             ALIEALGLTRHFAAIAGQDTFAFRKPDPRHLTETIRLAGGDAHRAL--MVGDSQTDIDTA
X6FX63_9RHIZ          ALIEALGLAKHFAAICGQDTFAFRKPDPRHLTETIVLAGGDPHRAL--MVGDSQTDIDTA
GPH_AGRFC             PLLEKLGLTRYFAAITCGDTFAFRKPDARHILGTIEKAGGDVQRSI--MVGDSINDILAA
GPH_CAUVC             ALLDAVALSPFFEAVIGADLAPAAKPDGRHVAAAVAAVGGDVSRAV--MIGDSVNDALGA
A0A246KA99_BREDI      ALIEALELTRHFAFIAGPDAVSARKPSGAHIIEAVQKAGGDPARCV--MVGDSTTDTKAA
B1M274_METRJ          ELLRLLGIGHRFAAICGRDTFPQAKPDPRHLTGTIARAAGDPARAV--MVGDSRTDIDTA
D7A672_STAND          LLLDRLGLADRFAVIAGADTFPVYKPDAGHLIGTIERAGGSPQRAL--MVGDSMTDVLTA
F2J5C3_POLGS          PLLDALDLTRLFEAVVGGDTFQRAKPHAEPVLGAIARAGGAARGSV--MIGDSATDINAA
GPH_RHORT             ALLEGLGLADPIMDVVGGDTLAQRKPDPAPLRALLDSLGVEADQAL--MVGDSPTDVATA
G8AMG8_9PROT          KLLDGLGLSALFGALAGGDTLPVKKPDGRHLSWVVDALG--GGSAA--MVGDNRNDVKAA
GPH_THIDA             PLLKGTGLYDYFELILSGDTLPKRKPDPLPLLHACEVFGVAPAELL--LIGDSLNDTQAA
Q7VU63_BORPE          PLLERTGLAGFFRLVVCGDTCARRKPDPDQVLHACDRLGVAPAQAV--TIGDSVNDALAG
B1Y7K4_LEPCP          PLLAAKGIDGFFDCVFGGDAFARKKPDPLPLIETCKALGTQPARTL--MIGDSSNDAMAA
Q8Y1V8_RALSO          ALLKEKQLDGFFSVVFGGDAFPCQKPDPLPVIRTCEALGTAPSRTL--MVGDSNNDALAA
Q1LIH7_CUPMC          PLLARTGLAQYFDLVYGGDAFALRKPDPYPLLKVAEAFRVDPEAVL--AIGDSENDARAA
GPHC_CUPNH            PLLALTGLSQYLEVLVAGDSIAQMKPDPEPLRHACNLLDVDTAQGV--LVGDSAVDVAAA
GPHP_CUPNH            PLLALTGLSQYLEVLVAGDSIAQMKPDPEPLRHACNLLDVDAAQGV--LVGDSAVDVAAA
E1TES8_BURSG          PLLRMTGLWSYLEVLVAGDSIDSMKPAPQPLWHACRLLGVDPQCSV--LLGDSPVDVCAA
B2JVP0_PARP8          PLMWRFGLQAWFDMVVDGNARLPRKPDPEPLLHACEALGVDPAHTL--FVGDSVTDALAA
GPH_PECAS             PLLAGLGIGDYFSLIIGGDDVIVKKPHPAPLYLVLGKLGLRASELL--FVGDSRNDIQAA
GPH_YERPE             PLLTSLGISDYFSVIIGGDDVVVKKPHPAPLYLLLGKLGLHAREML--FVGDSRNDIMAA
GPH_ECOLI             PLLEALDIAKYFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQML--FVGDSRNDIQAA
GPH_SHIDS             PLLEALDIAKYFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQML--FVGDSRNDIQAA
C5BGQ0_EDWI9          PMLESLGIDALFGQVIGGDDVAKRKPHPAPLYLVLSRLGLRADEML--FVGDSRNDIQAG
GPH_PHOPR             HLLEQHGISEYFVDVIGGDTFPLKKPDPFALHWLMEKHQLAACEML--MIGDSRNDILAA
GPH_PASMU             PVLQAFGIDHLFSELLGGQSLPAIKPHPAPLYYLCGKFGLYPKQVL--FVGDSKNDILAA
GPH_MANSM             PVLKAFAIDHLFSETLGGQSLPAIKPHPAPLYYLCGKFGLYPHQIL--FVGDSRNDILAA
B0UV01_HISS2          PILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQIL--FVGDSQNDIFAA
A3N3I7_ACTP2          PVLSAFGIFELFSEYLGGQSLPKIKPHPDPMLHICEKFAIQPSEML--FVGDSENDVIAA
GPH_NITOC             PLLTELGIIDYFEIVISGDTLPEKKPHPAPLLHAASHFGIAPEKAL--MIGDSISDVKAA
GPH_PSYA2             KILQFFGWHDIFSEVLGGDSLPTKKPDPAPLLHVCEVLNINPAQAV--MIGDSINDILAG
GPH_PSEF5             PLLDQMKIGRYFRWIIGGDTLPQKKPDPAALFFVMKMASVPASQSL--FVGDSRSDVLAA
A1U6G7_MARHV          PLLEKTGLDQWFDLSVGGDTLPVKKPDPAPLLHAMEKLGGTRGTTV--MVGDSKADVNAA
GPH_NEIG1             ELLKQLGLADYFSLILGGDSLPEKKPSPLPLRHAAEVLGIDAANML--MVGDSRNDIIAA
GPH_CHRVO             PLAEQLGLRDHFSLIVGGDTLPEKKPSALPLLHCCQVLGIQPQELA--MVGDSANDVAAA
GPH_AQUAE             KILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKAL--IVGDTDADIEAG
                                        :     **    .                  :**   *   .

GPH_XANCP             RAAGMPSVAALWGY---RLGDDDPLSW---QADVLVEQPPQLWEPAAWPQP---------
Q5GZB6_XANOR          RAAAMPSVAVLWGY---RLDDDDPLRW---QADVLVEQPQALWNPATWPQT---------
GPH_XYLFA             RAAGMPSMVALWGY---RSHEDNPMTW---QADTLVEQPHLLSRPDVWPST---------
GPH_XYLFT             RAAGMPSMVALWGY---RSHEDNPMTW---QADTLVEQPHLLSRPDVWPST---------
B1M4B6_METRJ          RAAGTAAILARYGYG--RLEDAEDADA---VLDDIGGLRAMIGALPAGRAPVS-------
GPH_CERS4             EAAGLRFALFTEGYRH-APVHELPHHG---LFSHHDELQDLLRRLLA-------------
S5YB11_PARAH          LAAGVPFFLFTEGYRH-LPVEEMTHHT---SFSDFKNLPSLVEKLRD-------------
GPH_RHOCA             QNAGLPFVIYTEGYRK-TPLDALPHAA---KFHDFSALPGIVEGWTWS------------
A8LIZ8_DINSH          RAAQVDFAFVEGGYQS-RPIPDFAPTH---RLARPALVGDLVLSGVVTR-----------
GPH_RHILO             KAAGIPVVAVDFGYTD-RHVREFEPSA---VISHFDALTVELAERLIRAAGH--------
X6FX63_9RHIZ          KAAGIPVVAVDFGYTD-RHVREFEPSA---VISHFDALTLGLAERLIAAAGH--------
GPH_AGRFC             RNAAVPSIGVTFGYTD-VPMVELEPDV---VIDDFAALTPALFEKLVSKGAAAA------
GPH_CAUVC             RNAGVPGVLVSFGYTE-EPVETLGADL---VIHSFLDVPKACITLLTSCPAPNTGL----
A0A246KA99_BREDI      KDAGVPCIAVSFGYND-VPHAELGGDV---MIDHYDGFEEALAEVMR-------------
B1M274_METRJ          KAAGIPVVAVTFGYTD-RPVAELGPDR---VIEHFSELVEAVGALVPAA-----------
D7A672_STAND          KNARVPVIVVPFGYTE-TPAAELGGDE---LIEHYDLLPEAVERLLRLGINNG-------
F2J5C3_POLGS          RAAGLPVVAVDFGYTA-IPVRDLGPDR---IISHYDRLAEAVAAVSRGVAMGQN------
GPH_RHORT             KAAGVPVVVMSYGYSR-EPVASLGALA---VFDDFASLGDWLGFPQPGGDRLGATPALSE
G8AMG8_9PROT          RAAGVPVVAMTYGYPR-MPVQELGADI---LLDRIADLPDALR-------RLGA------
GPH_THIDA             RAAGCPVFCVPYGYNRGRPVTELDLDA---VVPSLAEAALMVTKA---------------
Q7VU63_BORPE          RRAGTAVLAVPYGYNEGMDVRSLDVDG---IVDTLVDAAHWISQRNAKPQRTTAA-----
B1Y7K4_LEPCP          RAAGCPVVLVSYGYNHGEPIRAVPAET---HLDTLSDLLRAA------------------
Q8Y1V8_RALSO          KAAGCRVVLVKYGYHHGESRSRTHVDG---VIDGLHQLRPFCRLADQDA-----------
Q1LIH7_CUPMC          RAAGMGVLLMPYGYNHGNPVQDVDADG---IVADIARVAALLAAHRATHR----------
GPHC_CUPNH            RAAGIPVCLVRYGYAGPGGPAALGADA---LLDSLEALPALLTP----ARLAPAA-----
GPHP_CUPNH            RAAGIPVCLVRYGYAGPGGPAALGADA---LVDSLEALPALLTP----ARLAPAA-----
E1TES8_BURSG          SAAGMPAFIVSYGYGGPDGAAALQCAA---SIDSFAQLPDLLAPRGEHARAKAAS-----
B2JVP0_PARP8          QAAGMPMVCVSYGYSSDHPVTELPCMR---VIDSIGELTELIGGPRKWHRPTRGDHAAAG
GPH_PECAS             QAAGCRSVGMTYGYNYGEAIELSQPDV---VLDRFADILPLIGHSSSHNQEPLV------
GPH_YERPE             QAAGCPCIGLTYGYNYGEAIATSHPDC---VLAHFADLLPAIGLPSLKDQEV--------
GPH_ECOLI             KAAGCPSVGLTYGYNYGEAIDLSQPDV---IYQSINDLLPALGLPHSENQESKND-----
GPH_SHIDS             KAAGCPSVGLTYGYNYGEAIDLSQPDV---IYQSINDLLPALGLPHSENQESKND-----
C5BGQ0_EDWI9          QSAGCPTVGLTYGYNYGEPIAASEPCC---VLDDFAGLLPLVGLAPLN------------
GPH_PHOPR             QAATCHVVGLTYGYNYGQPISASNPDV---VLDQFSQLIDVVKLAC--------------
GPH_PASMU             HTAGCAVVGLTYGYNYNIPIAESKPDW---VFDDFAQILTILE-----------------
GPH_MANSM             HSAGCTAVGLTYGYNYNMPIADSHPDW---IFEDFADLLKIV------------------
B0UV01_HISS2          HSAGCAVVGLTYGYNYNIPIAQSKPDW---IFDDFADILKITQ-----------------
A3N3I7_ACTP2          KAAGCDVVGLTYGYNYNIPIEQSNPTF---VTGEFADVLKFVG-----------------
GPH_NITOC             RAANFQIVCLSYGYNHGVDIRDSQPDS---VIDSLIEIKNLLSQAA--------------
GPH_PSYA2             QNANMDTLGLSYGYNYGQDIRQLNPTE---AFDDFSALVDYLLKAYPANN----------
GPH_PSEF5             KAAGVKCVALSYGYNHGRPIAEESPAL---VIDNLRALIPGCLEPAAEITLPDAVPSHSG
A1U6G7_MARHV          LAAGIPCVAVRYGYNFGGSVDSLGADA---VVDSLAELL---------------------
GPH_NEIG1             KAAGCLSVGVTFGYGDMTLLSQDDTTRPDRIIGALPEIYENLQPQKNKDEE---------
GPH_CHRVO             RAAGCAAIAVGYGYADASTLGADLTV------NSIAELYDLMKNG---------------
GPH_AQUAE             KRAGTKTALALWGYVKLNSQIPDFTLS------RPSDLVKLMDNHIVEF-----------
                        *         **                                              

GPH_XANCP             -------------------------
Q5GZB6_XANOR          -------------------------
GPH_XYLFA             -------------------------
GPH_XYLFT             -------------------------
B1M4B6_METRJ          -------------------------
GPH_CERS4             -------------------------
S5YB11_PARAH          -------------------------
GPH_RHOCA             -------------------------
A8LIZ8_DINSH          -------------------------
GPH_RHILO             -------------------------
X6FX63_9RHIZ          -------------------------
GPH_AGRFC             -------------------------
GPH_CAUVC             -------------------------
A0A246KA99_BREDI      -------------------------
B1M274_METRJ          -------------------------
D7A672_STAND          -------------------------
F2J5C3_POLGS          -------------------------
GPH_RHORT             NPA----------------------
G8AMG8_9PROT          -------------------------
GPH_THIDA             -------------------------
Q7VU63_BORPE          -------------------------
B1Y7K4_LEPCP          -------------------------
Q8Y1V8_RALSO          -------------------------
Q1LIH7_CUPMC          -------------------------
GPHC_CUPNH            -------------------------
GPHP_CUPNH            -------------------------
E1TES8_BURSG          -------------------------
B2JVP0_PARP8          MDMQMHSHLAN--------------
GPH_PECAS             -------------------------
GPH_YERPE             -------------------------
GPH_ECOLI             -------------------------
GPH_SHIDS             -------------------------
C5BGQ0_EDWI9          -------------------------
GPH_PHOPR             -------------------------
GPH_PASMU             -------------------------
GPH_MANSM             -------------------------
B0UV01_HISS2          -------------------------
A3N3I7_ACTP2          -------------------------
GPH_NITOC             -------------------------
GPH_PSYA2             -------------------------
GPH_PSEF5             NSIVVVTRKLWMKVIKALARWRWRA
A1U6G7_MARHV          -------------------------
GPH_NEIG1             -------------------------
GPH_CHRVO             -------------------------
GPH_AQUAE             -------------------------