CLUSTAL format seed alignment for MF_00497_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

G1PDH_BACSU      MNRIAADVQRAFE--NAGEKTLPIKVEEIVLGKQAAD-SLLDYVKRKNNQHIVLVCDANT
G1PDH_BACVZ      MKRSPEDIQSEFD--KEGASRSPIQIEDIVIGANAKE-ELLRFLQKKCWNHPVIVCDRNT
G1PDH_BACLD      MNDLISYVKKTLGACECGTVHHPLTVEKIAIGDNAVEQELPAFVKSASYKKAAVIYDETT
G1PDH_ALKHC      MNHLLKQAKRVASECECGHEHQWIEMDELQLGRNAIN-YLPEYLHEKGLLHVTIVADANT
G1PDH_GEOSE      MNQTLEEVVSLARQCGCGHRHYDIPIEQMVVGREAFA-RLVAYLRHKRYERVAIVADDHT
G1PDH_GEOTN      MNQTLDNIVSLAKQCR-GHHHYDISIEQIVVSHEAFN-QLAAYLRYKQYKKVVVVADNRT
G1PDH_BACSK      --MNISALKARIRASK--EDLYPLPLEQIVVAEGALR-EAAAFIAKQAESGVVLVADSHT
                                        : ::.: :.  *       ::        .:: *  *

G1PDH_BACSU      HRIAGIDLENRLNQEGFQAECLIIPENEAGDVTADERSLIHVLIHTKQPTDVMIAVGSGT
G1PDH_BACVZ      YEAAGRLLADELRAGGIKASKVIIPEHEAGAAAADERTLVYTLINLAEETDVIIAAGAGT
G1PDH_BACLD      GRLAGKRIASLL-EETAETVPVLLEANEAGDVTADEQTLVSALIGVPIDADVLIAAGAGT
G1PDH_ALKHC      YAVAGQLVAQLLKGRGIDVENCILKEQGALTLLADEHGLGQLVIGAAKETDVFLAVGAGT
G1PDH_GEOSE      FAAVERSLCDQLENGSIRYTVCLVQPDENGDVIADERSIVQVLLETPDDVDVLIAVGAGT
G1PDH_GEOTN      FTAAGRSLCDKLKNESVLYTVCLIQSDENEDVIADERAIMQVLLETPNDVDAFIAVGAGT
G1PDH_BACSK      YKAAGRDLHDHLCQKGVKADWHLLEPNSNGDIIADEVSLISVMLKVEQSTKLLVAVGAGT
                    .   : . *          ::  .      ***  :   ::     .. ::*.*:**

G1PDH_BACSU      IHDIVRFAAFQRDLPFISYPTAPSVDGFTSAGAPIILYGTKTTIQTKAPSALFADLDLLK
G1PDH_BACVZ      IHDITRFAAYQRGLPFISFPTAPSVDGFTSAGAPLILNGIKTTIQTKAPIALFADTNVLK
G1PDH_BACLD      IHDIVRFCAYQRGIPFISVPTAPSVDGFTSAGAPLILKGKKQTVQTTAPIALFADLELLC
G1PDH_ALKHC      IHDLTRIASYKFGKPFIAIPTAPSVDGFTSMGAPVIRDGVKITFQTQAPIALFADLDFLT
G1PDH_GEOSE      IHDITRFSSYKMRIPFISVPTAPSVDGFTSMGAPLIIRGVKKTIQAQAPIAVFAHTGVLC
G1PDH_GEOTN      VHDITRFSSYKMKVPFISVPTAPSVDGFTSMGAPLIIRGVKKTIQAQAPIAVFADTDVLC
G1PDH_BACSK      IHDIVRFVSGKTNKPFVSIPTAPSVDGFTSLGAPIVVQGSKKTYQLVAPIALFADTVVLQ
                 :**:.*: : :   **:: *********** ***::  * * * *  ** *:**.  .* 

G1PDH_BACSU      AAPQSMVAAGFGDMLGKITSLADWEISRHLAGEPYSPAGAKIVQEALAACIEHTEDIAMK
G1PDH_BACVZ      EAPRSMTAAGFGDMLGKITSLADWEISRRLAGEPYSEAGAKLVKDALWQCIDHRAAIAMG
G1PDH_BACLD      QAPQNMVAAGFGDMLGKVTSLADWEISRLLAGEPYCPAASRLTREALDQCLDRKDDIAAK
G1PDH_ALKHC      QAPRSMVAAGFGDMLGKSTSLVDWQVSHMLNDEPFCPAVFHMTKSALTMCMEHADEIAAC
G1PDH_GEOSE      QSPKEMIAAGFGDMVAKYTSLADWQFAHWMADEPYCPFVHQLTEQSLQTCVDHIDDIAAG
G1PDH_GEOTN      QAPKAMIAAGFGDMVAKYTSLADWQFAHWMANEPYCPLVYQLTIQSLNACVDHMEDIAAG
G1PDH_BACSK      HAPPALIAAGFGDMVGKYTSLFDWKIGSLLKNEAYSDLVADLTEEALSTCVDKVADIGKR
                  :*  : *******:.* *** **:..  : .*.:.     :. .:*  *:::   *.  

G1PDH_BACSU      TETGIRVLMESLLVSGLVMLALDHSRPASGGEHHISHWIEMELMEKKRPQILHGAKVGCA
G1PDH_BACVZ      TEAGIQILMEALIVSGLVMLALDHSRPASGGEHHISHWIEMEMLKAKQPPILHGAKVGCA
G1PDH_BACLD      MRDGIEKLMESLILSGLVMLVLDHSRPASGGEHHLSHYLEMKALENNKRQVLHGAKVGCS
G1PDH_ALKHC      NEQGIRLLTEALIMSGLAMLIFGHSHPASGAEHHLSHYWEMAFLRSGGTQPLHGAKVGYA
G1PDH_GEOSE      GEQGIRVLMDALLQSGIAMLLMGQSYSASGAEHHLSHYWEMEFLRQKKRQVLHGAKVGVS
G1PDH_GEOTN      NEKGIHVLMDALLQSGIAMLLMGQSYSASGAEHHLSHYWEMEFLRQNKRQVLHGAKVGVS
G1PDH_BACSK      TSAGVQVLMESLLTSGLAMALFGYSHPASGAEHHLSHYWEMEALRLGKKQLLHGAKVGLS
                    *:. * ::*: **:.*  :. * .***.***:**: **  :.      ******* :

G1PDH_BACSU      AVLLTDTYRKLAQDDGLNEFSP-------------SRREAIQSAYQTLPRGEVLADWLRS
G1PDH_BACVZ      CAVLSDTYKELACHEKLAELPP-------------HFREAIQSAYEGLPDGKTIAGWLAS
G1PDH_BACLD      AIMLTDIYRSLI---GASLGDQ-------------HAEQAIRSVYEKLPDGKKMAEWMRR
G1PDH_ALKHC      TMLISALYKNEARKKIETFQGEGSPLVNS----IHKHRERLLMLIDTIPESSDIQRLLES
G1PDH_GEOSE      TPIIIEHYQRVFWPLLNELEKRPKSMDEATWERLKANTASIRELLESLPSPERIRTMLAK
G1PDH_GEOTN      TPIIVEHYQRVFWPLLSELKQRPKSMDETIWERLKIYTDSIQELLESLPSPERIRAMVEK
G1PDH_BACSK      TQIINRFYKNTVLPDVHRFLDDDE-------------AKQVIALVEALPDPDDVKALLEQ
                   ::   *:                               :    : :*  . :   :  

G1PDH_BACSU      AGGPAYFDEIGVGQDSVKNAFRHAHTLR-DRCTGLRIINEN---KTLINHGLYE-----
G1PDH_BACVZ      AGGPACFDEIGVKQDLVSDALKHAHTLR-DRYTGLTIINEN---AALFAHHLHQ-----
G1PDH_BACLD      IGGPVSFKELDVEEELVREALAYAHQLR-DRYTGLKIINQYGLLPGLLGKGPGVKGVKM
G1PDH_ALKHC      VGGAVKSADLALADSLEDEALEKAHKLR-ERCTLLYCLNEH------LKTS--------
G1PDH_GEOSE      VGGAIAPEQLGIDPQLVERSLREAHRLRLNRFTMLYFLNELIFVE--------------
G1PDH_GEOTN      VGGAVAPQQLGIDPLLVERSLKEAHRLRLNRFTMLYCLNECMLMEG-------------
G1PDH_BACSK      AGWNEA--LVPIAPELVEESLQHAYLLR-DRYTLLRLYREGTTMKKEGDAHVGRS----
                  *       : :       ::  *: ** :* * *   .: