CLUSTAL format seed alignment for MF_00499

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL13A_YEAST       MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLD-LLRPVVR
RL13B_YEAST       MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLD-LLRPVVR
RL13_SACEX        MAISKNLPLLKNHFRKHWQERVKVHFNQAGKKASRRDARVAKAAKIAPRPLD-LLRPVVR
RL13_CANAL        MAISKNLPLLNNHFRKHWQERVRVHFDQAGKKASRRQSRLRKAAKIAPRPID-ALRPVVR
RL13_DICDI        MPIHNKV-LSNDHFRKHWQMRVRTWFNQPARKIRRRNNRIEKAAKVFPRPIA-TLKPVVR
RL131_BRANA       --MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVH
RL132_BRANA       --MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVH
RL131_ARATH       --MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVH
RL133_ARATH       --MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVH
RL13_TOBAC        ------MYSANGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVH
RL13_CHLSW        -MVRGNDMLPNGHFHKKWQFHVKTWFNQPARKQRRRNARAEKAKATFPRPVAGSLKPIVR
RL13_HUMAN        MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVR
RL13_BOVIN        MAPSRNGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPLRPVVR
RL13_RAT          MAPSRNGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVR
RL13_CHICK        MAPSRNGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVR
RL13_DANRE        MAPSRNGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVR
RL13_ICTPU        MAPSRNGMILNPHFHKDWQKRVRTWFNQPARKLRRRKARQAKARRIAPRPVAGPLRPIVR
RL13_SPOFR        MGKG-NNMIPNGHFHKDWQRFVKTWFNQPARRHRRKQNRIKKAKAVAPRPAAGPLRPVVR
RL13_DROME        MGKG-NNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVR
RL13_CAEEL        MAPRGNQMLGNAHFRKHWHKRIKTWFDQPARKLRRRQNRQAKAVEIAPRPVAGLLRSVVR
RL13_SCHMA        -MVHGNDVLHHNHFRKKWQFMVKTWFNQPARKERRRQARKAKAQRIAPRPASGPLRPIVN
RL13_SCHPO        MAIHVKGQLPNAHFHKDWQRYVKTWFNQPGRKLRRRQARQTKAAKIAPRPVE-AIRPAVK
RL13_TETTS        --MKHNNQLPVAQLRKHQQFRIKTFFNQAAQKKARLHARRAQAAAVFPRPTE-KLQPVVR
K0ILL4_NITGG      --------------------------------------------------------MQAA
RL13E_SULIA       ---------------------------------------------MEFPKALIKRPNY-H
RL13E_SULIL       ---------------------------------------------MEFPKALIKRPNY-H
RL13E_SACS2       ---------------------------------------------MEFPKAVIKRPNY-H
RL13E_SULTO       -----------------------------------------------MVEPIVKRP---H
E0SPJ3_IGNAA      -------------------------------------MDEGCCINIEIPGPIVKKPR--L
B1L534_KORCO      ---------------------------------------------MRPLSPLVLTS----
RL13E_AERPE       ---------------------------------------------MEPPKAIVKKPRLVK
G0EDL6_PYRF1      ------------------------------MASPPPVSGLSEERSFEPPRAIVKKPRLRK
A3DKW5_STAMF      -----------------------------------------MSKEIQPPEPIVRKPMLRK
Q8ZWS7_PYRAE      --------------------------------------------MASVPKPLVKTPAKIT
A1RV33_PYRIL      --------------------------------------------MSIVPKPLVKMPSRIN
F2L587_THEU7      -------------------------------------MAMADAIAATPPKPLVKEPATIS
F0QUW7_VULM7      ------------------------------------MSQTTQPSISPPPDPLVKKPRLIS
E1QPJ2_VULDI      --------------------MSGINTYKGGIDYVHGMSQSTQPPVLPPPDPLVKRPRLIS
A8MCL2_CALMQ      -------------------------------------------MSINPPVAMVKSP---K
                                                                              

RL13A_YEAST       APTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEY
RL13B_YEAST       APTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEY
RL13_SACEX        APTVKYNRKVRAGRGFTFGEVKAAGLTPAYARTIGIAVDHRRQNKNQEMFELNVQRLKEY
RL13_CANAL        APTVKYNRKVRAGRGFTLAELKAVGIAPKYARTIGISVDHRRQNKSQETFDANVARLQEY
RL13_DICDI        GSTIRYNMKVRAGRGFTLEELKAAGLTAQYARTIGIAVDTRRVNKTQQSLTLNTQRLKNY
RL131_BRANA       GQTLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTY
RL132_BRANA       GQTLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTY
RL131_ARATH       GQTLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTY
RL133_ARATH       GQTLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTY
RL13_TOBAC        GQTLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDL
RL13_CHLSW        CQTVKYNTKQRLGRGFTLEELKEAGIPAKFAPTVGIAVDHRRKNRSLETLQANVQRLKTY
RL13_HUMAN        CPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEY
RL13_BOVIN        CPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKCTESLQANVQRLKEY
RL13_RAT          CPTVRYHTKVRAGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQRLKEY
RL13_CHICK        CPTVRYHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEY
RL13_DANRE        CPTIRYHTKVRAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEY
RL13_ICTPU        CPTVRYNTKVRAGRGFTLEELKAAGINKRVARTIGIAVDPRRRNRSTESLHVNVQRLKVY
RL13_SPOFR        CPTIRYHTKVRAGRGFTLREIRAAGLNPAFARTIGIAVDPRRRNKSVESLQVNVQRLKEY
RL13_DROME        CPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEY
RL13_CAEEL        CPQKRYNTKTRLGRGFSLQELKAAGISQAQARTIGIAVDVRRTNKTAEGLKANADRLKEY
RL13_SCHMA        CPTFRYNMKVRSGRGFSLQEVRAAGLNPKFARTIGIAVDHRRRNVSVEGLQRNVARLKAY
RL13_SCHPO        PPTIRYNMKVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESLQRNVERIKVY
RL13_TETTS        KQTQRYNKSTKLGRGFTLQELKAAGISAAFAQSIGIKVDHRRKNRCQESLELNKKRLLAY
K0ILL4_NITGG      KPTVRNGYIVRAGRGYSLDELREAGLDLRVARKSGVPVDMWRQTKYPE----NIEQLKSI
RL13E_SULIA       FEYPHKRKDKRIGRGFSIGELEKAGLNINNARKLGIIVDIRRKS----VHEENVEVLKKF
RL13E_SULIL       FEYPHKRKDKRIGRGFSIGELEKAGLNINNARKLGIIVDIRRKS----VHEENVEVLKKF
RL13E_SACS2       FEYPHKRKYKRIGRGFSVGELEKAGLNINKARKLGIFVDIRRKS----VHEENVETLKKF
RL13E_SULTO       YRFEIRKKDTKIGKGFSLKELKESGFSVQEAKKLRVRIDKRRKT----SYPENVEVLKKL
E0SPJ3_IGNAA      IKFRGIDTGTRIGRGYSIGELKAANISLSLAKQLNIPLDPRRKS----VHEENVENLKKV
B1L534_KORCO      ---TKRFKRKRVGRGFSLGELERAGISIEEARKLGIYIDKRRKS----VHEWNVNALLRL
RL13E_AERPE       LGP--VDPGVRRGRGFSLGELAEAGLDAKKARKLGLHVDTRRRT----VHPWNVEALKKY
G0EDL6_PYRF1      YGG--IDPGVREGRGFSIPELKEVGLGVKEAMKLGLYVDKRRKT----KWPWNVEALRKY
A3DKW5_STAMF      HGG--LSPGLRVGRGFSKKELEAVGLDLKTAKKLGLRIDKRRRT----IHEWNVQALRDY
Q8ZWS7_PYRAE      HGG---VVKWKYGRGFSIGELRALGLSVDQARLLGIPVDERRET----SWPQNIEALRKW
A1RV33_PYRIL      AGG---ITKWRVGRGFSIGELKAVGLNIYQARILGIPVDERRRT----EWLHNIETLRKW
F2L587_THEU7      SGG---VARWKVGRGFSVGEVRQVGLTVEQARLLGLYVDTRRKS----IHDVNVQALREW
F0QUW7_VULM7      SGGSVLGSEWRVGRGYSIGEVRAVGLTVSEARLLGIRVDPNRDT----IWDINVQRLREW
E1QPJ2_VULDI      SGG-VLGNEWRVGRGYSVGEVRAVGLTVDEARILGIKVDTNRDT----VWDINVQRLKDW
A8MCL2_CALMQ      DG------KMKQGRGFSISEIKAINLTVNEARLLGIPVDTRRKS----TWEWNVKALQEY
                            : *:*::  *:   ..    *    : :*  * .        *   :   

RL13A_YEAST       QSKIIVFPRNGKAPEAE--QVLSAAATFPIAQPATDVEARAVQDNGE-----------SA
RL13B_YEAST       QSKIIVFPRDGKAPEAE--QVLSAAATFPIAQPATDVEARAVQDNGE-----------SA
RL13_SACEX        QSKIIVFPRNGKVPETE--QVLSTAAAFPIAQPAVETETRAVQDNGE-----------SA
RL13_CANAL        KSKLVIFDKKTKASEVASFEQVDVSATFPVEQPAPESGLRAVEVPEQ-----------TA
RL13_DICDI        QSKLVLFPRKVNAPKKGEATKEEVAKAVQTLKPFTVKSAIAVTCEQTPRKPTEAEKKFSA
RL131_BRANA       KAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKHATEL--VKLTTEMKSVKA
RL132_BRANA       KAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMEL--VKLTSEMKSVNA
RL131_ARATH       KTKLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMEL--VKLTSEMKSFKA
RL133_ARATH       KAKLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMEL--VKLTADLKAFKA
RL13_TOBAC        QGQLVVFPRRASRSRLVILPPRNCLTATQVHGAYMPIEREKHQLIL--SKVLKKMKSFNA
RL13_CHLSW        RASLVIFPRNMKKPKAFEASAADCSAASQAKGELLPLKGTKPALEL--VKITADMKEGSQ
RL13_HUMAN        RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA--RVITEEEKNFKA
RL13_BOVIN        RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKA--RVITEEEKNFKA
RL13_RAT          RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKA--RAITEEEKNFKA
RL13_CHICK        RSKLILFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKA--RVISEEEKNFKA
RL13_DANRE        RTKLIIFPRKAAKPKKGDSTEEELKMATQLTGPVMPIKKVHKKEKA--RVISEDEKNFKA
RL13_ICTPU        RSKLILFPRKVSAPKKGDSTEEEVKMATQLTGPVMPIKIVHKKEKA--RMITEEEKKFNA
RL13_SPOFR        RARLILFPKG-KKVLKGEANEEERKLATQLRGPLMPVQQPAPKSIA--RAITEEEKDFKA
RL13_DROME        RSKLILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEF-REVTKDEKKFKA
RL13_CAEEL        KAKLILFPKKASAPKKGDSSAEELKVAAQLRGDVLPLSHTITFDEP--RQVTDAERKVEI
RL13_SCHMA        KAKLILFPLNPAKPQAMDAKADEVKKATQLRRPVLPITQRAKRLKA--HKPTSSELRYSA
RL13_SCHPO        LAHLIVFPRKAGQPKKGDATDVSGAEQTDV-AAVLPITQEAVEEAK---PITEEAKNFNA
RL13_TETTS        VSKLVLFPRHQGKAKKGLVNDTADTSSAAQNALQTSVPLPSVSKREKAVSNIAELRKKKV
K0ILL4_NITGG      AKTIIIVPSKKRKKE---------------------------------------------
RL13E_SULIA       LEQLSNQKS---------------------------------------------------
RL13E_SULIL       LEQLPNQKS---------------------------------------------------
RL13E_SACS2       SEQLSNQKP---------------------------------------------------
RL13E_SULTO       KEQLQQKKQAQ-------------------------------------------------
E0SPJ3_IGNAA      LEQLSEVIRAKKTKPARLVVKAKTS-----------------------------------
B1L534_KORCO      KSSS--------------------------------------------------------
RL13E_AERPE       IERLREAGVEV-------------------------------------------------
G0EDL6_PYRF1      LEAIGYKPRGY--P----------------------------------------------
A3DKW5_STAMF      LTKIGYIAKNE--NK---------------------------------------------
Q8ZWS7_PYRAE      LIDLLEGRAQA--PDPTYPKLVKVKRKRGRAFRGLTSAGRKSRGLVSTKFRETHNYKYKK
A1RV33_PYRIL      LIDILEGKAAP--PEPTFPRTIRVKQKRGRAFRGLTSAGRRSRGLISTRFKETHNYKFKK
F2L587_THEU7      LVKVLEGQMPP--PEPKMPVSVSIKPKRGRAFRGLTSAGRRARGLLSTRYKETHARKWKK
F0QUW7_VULM7      LSKVIRGEVLP--PEPALHKTIKIKRKKGRVFRALTPAGRKMRGLMSVGLRETHVHKWRK
E1QPJ2_VULDI      LNKIIKGEALP--PEPALPKVIKIKRKRGRVFRALTPAGRKMRGLVSVGLRETHAHKWKK
A8MCL2_CALMQ      VSKVVNVTDVSQLPLPSIPKRRLVKPKRGRAFRGVTPAGRRARGLLSIGLRETHRYKWRR
                                                                              

RL13A_YEAST       FRTLRLARSEKKFRGIREKRAREKAEAEAEKKK----------
RL13B_YEAST       FRTLRLARSEKKFRGIREKRAREKAEAEAEKKK----------
RL13_SACEX        YRTLRMARSEKRYKGIREKRAREKAEAEAEKKK----------
RL13_CANAL        YRTLRLARNEKKYKGIREKRAKEKAEAEAEKAKK---------
RL13_DICDI        YATLKAADSKAKTVGIRRKAAEIKAAKAAEK------------
RL131_BRANA       FDKIRLERTNKRHAGARAKRAA-DAEKEEKK------------
RL132_BRANA       YDKIRLERTNKRHAGARAKRAA-DAEKEEKK------------
RL131_ARATH       FDKIRLERTNKRHAGARAKRAA-EAEKEEKK------------
RL133_ARATH       YDKIRLERTNARHAGARAKRAA-EAEKEEKK------------
RL13_TOBAC        YAKLRVERTNERHIGARMKRAA-EAEKEEKK------------
RL13_CHLSW        YGKLRIERVNARLKGMREKRAADEAAKKDDK------------
RL13_HUMAN        FASLRMARANARLFGIRAKRAKEAAEQDVEKKK----------
RL13_BOVIN        FASLRMARANARLFGIRAKRAKEAAEQDVEKKK----------
RL13_RAT          FASLRMARANARLFGIRAKRAKEAAEQDVEKKK----------
RL13_CHICK        FASLRMARANARLFGIRAKRAKEAAEQDVEKKK----------
RL13_DANRE        FASLRMARANARLFGIRAKRAKEAAEQDVEKKK----------
RL13_ICTPU        FANLRMARANARLFGIRAKRAKEAAEQDVEKKK----------
RL13_SPOFR        YQYLRGARSIAKLVGIRAKRLKDAAENPDDVTKAPTAVKRNKT
RL13_DROME        FATLRKARTDARLVGIRAKRAKEAAESEDAAKGDPKKAKK---
RL13_CAEEL        FRLLRKERADKKYRGKREKRAREAAEENK--------------
RL13_SCHMA        FHAIRQQ------------------------------------
RL13_SCHPO        FSTLSNERAYARYAGARAAFQKKRAEEAEAKKK----------
RL13_TETTS        YRIIRQEKTNQKWDGKRKAKAQAAAEPKA--------------
K0ILL4_NITGG      -------------------------------------------
RL13E_SULIA       -------------------------------------------
RL13E_SULIL       -------------------------------------------
RL13E_SACS2       -------------------------------------------
RL13E_SULTO       -------------------------------------------
E0SPJ3_IGNAA      -------------------------------------------
B1L534_KORCO      -------------------------------------------
RL13E_AERPE       -------------------------------------------
G0EDL6_PYRF1      -------------------------------------------
A3DKW5_STAMF      -------------------------------------------
Q8ZWS7_PYRAE      KAKERRLKKRHEATKGLGNLLRISRIINDG-SK----------
A1RV33_PYRIL      KARERRLRKRHEATRGLGNLLRISRIINENKSK----------
F2L587_THEU7      KAAERAAKRRHEATKGLGNLMRISKIIHKK-------------
F0QUW7_VULM7      KARERIEKRRHEVVRTKGGH-----------------------
E1QPJ2_VULDI      KARERAEKRRHEAIRAKGGH-----------------------
A8MCL2_CALMQ      KQRQRELKLRHEVVFRKGGA-----------------------