CLUSTAL format seed alignment for MF_00502

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL31B_ECOLI      MKPNIHPE-YRTVVFHDTSVDEYFKIGSTIKTD-REIEL-DGVTYPYVTIDVSSKSHPFY
RL31B_YERPE      MKPNIHPP-YRTVVFHDTSADAYFTVGSTIATE-RTIER-DGQTYPYVTLDISSASHPYY
RL31B_VIBCH      MKAGIHPD-YRKVVFHDTTVDHYFVVGSTLQTD-RTIEW-EGKTYPYITIEVSSESHPFY
RL31B_PSEAE      MKPGIHPE-YRPVLFHDTSADVYFLIGSTAETD-KTHTHTDGKTYPYVTLDVSSASHPVY
RL31B_CHLMU      MKKNTHPE-YRQVLFVDSSTGYKFVCGSTYQTD-KTEVFE-GQEYPVCYVSVSSSSHPFF
RL31B_CHLTR      MKKNTHPE-YRQVLFVDSSTGYKFVCGSTYQTD-KTEVFE-GQEYPVCYVSVSSSSHPFF
RL31B_CHLPN      MKKNTHPE-YRQVLFVDSSTGYKFVCGSTYQSE-KTEVFE-GKEYPVCYVSVSSSSHPFF
RL31B_LISMO      MKTGIHPE-YRPVVFVDTSTDFKFLSGSTKSSS-ETIKWEDGNEYPLLRVEISSDSHPFY
RL31B_BACHD      MKPGIHPD-YKKVVFMDTSTGFKFLSGSTKTSN-ETIEWEDGNTYPLIKVEISSDSHPFY
RL31B_STRPN      MKKDIHPE-YRPVVFMDTTTGYQFLSGSTKRSN-ETVEFE-GETYPLIRVEISSDSHPFY
RL31B_STRP1      MRKDIHPD-YRPVVFLDTTTGYQFLSGSTKASK-ETVEFE-GETYPLIRVEISSDSHPFY
RL31B_LACLA      MKQNIHPN-YQPVVFMDTTTGFKFLTGSTKGSK-ETVEWEDGNTYPLIRVEISSDSHPFY
RL31B_BACSU      MKEGIHPK-NHKVIFQDVNSGYRFLSTSTKTSN-ETAEWEDGNTYPVIKVEVSSDTHPFY
R31B1_STRCO      MQQDKHPD-YRPVVFRDRGAGYAFLTRSTATSD-QTIVWDDGETYPVVEVEISSESHPFY
R31B2_STRCO      MRKGIHPE-YRPVVFRDRAADYAFLTRSTMTSE-RTVEWEDGRTYPVVDVEVSHVSHPFY
RL31B_BORBU      MRKDIHPK-NNLVVFKDGSNGAMFLTKSTLNSK-ETIKYIDGKEYPLVTVEITSKSHPFY
RL31B_XYLFA      MKPEIHPI-YREVVFHDVTSNFKFLTRSTMSTK-ETTLWEDGREYPLVKVEISSASHPFY
RL31B_NEIMA      MKPNIHPDNYRTVLFFDSSANEGWLIRSCAETHGKTMVWTDGKEYPLFSLDTSSASHPVY
RL31B_NEIMB      MKPNIHPDNYRTVLFFDSSANEGWLIRSCAETHGKTMVWTDGKEYPLFSLDTSSASHPVY
RL31B_PASMU      MKKGIHPENYRTVLFYDSNAKQGFLIRSCARTT-TTMKWEDGHEYPVFMCDTSSASHPYY
                 *:   **   . *:* *      :   *   :         *  **    . :  :** :

RL31B_ECOLI      TGKLRTVASEGNVARFTQRFGRFVSTKKGA-----------------------
RL31B_YERPE      TGKQKEFAKEGSTARFHQRFGSFLTKKTN------------------------
RL31B_VIBCH      TGKQRVVQKEGRVANFTRRFGQFAKESK-------------------------
RL31B_PSEAE      TGEQRKTKSEGRVAGFNKRFAGFVGGKGA------------------------
RL31B_CHLMU      TGSKKLVDAEGRVDKFLKRYSGVKQMAPKPETSVEEVLP--KGKKKAPAKKKK
RL31B_CHLTR      TGSKKLVDAEGRVDKFLKRYSGIKQSAPKPETVVEDVLP--KGKKKSPAKKKK
RL31B_CHLPN      TGSKKFVDAEGRVDKFLKRYSNVRQPAQQPQPE-EDALPAAKGKKKVVTKKKK
RL31B_LISMO      TGKQKHATADGRVDRFNKKYGLK------------------------------
RL31B_BACHD      TGKQKLADAGGRVDRFKKKYNLK------------------------------
RL31B_STRPN      TGRQKFTQADGRVDRFNKKYGLK------------------------------
RL31B_STRP1      TGRQKFTQADGRVDRFNKKYGLKDANAAK------------------------
RL31B_LACLA      TGRQKFQAADGRIARFEKKYGKQ------------------------------
RL31B_BACSU      TGRQKFNEKGGRVEQFKKRYNMGK-----------------------------
R31B1_STRCO      TGKARTVDSEGRVARFERRYGAGEGQDTGEAG---------------------
R31B2_STRCO      TGTARVLDTAGRVERFERRYGKQDGA---------------------------
RL31B_BORBU      TGQQKFVDAAGRIDKFNKRYKKS------------------------------
RL31B_XYLFA      TGKHKLVDTSGRIDKFKKRYAR-------------------------------
RL31B_NEIMA      TGKQRNVNTEGHASKFNQRFQSVMSSFRKDK----------------------
RL31B_NEIMB      TGKQRNVNTEGRASKFNQRFQSVMSSFRKDK----------------------
RL31B_PASMU      TGKTRQIANEGRASDFVNRYGKFGTLKSK------------------------
                 **  :     *    * .::