CLUSTAL format seed alignment for MF_00503

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL9_CAMC5       -------------------MKVLLIKDVKSLGK--AGEIKEVKDGYGNNFLIGKGLAKAA
RL9_CAMC1       -------------------MKVLLIKDVKGLGK--AGEIKEVKDGYGNNFLIGKGFAKAA
RL9_CAMFF       -------------------MKVLLIKDVKGLGK--AGEVKDVKDGYGNNFLIGKGLAKSA
RL9_CAMJE       -------------------MKVLLIKDVKALGK--AGEIKEVKDGYGQNFLIAKGFAKAA
RL9_CAMJR       -------------------MKVLLIKDVKALGK--AGEIKEVKDGYGQNFLIAKGFAKAA
RL9_CAMJD       -------------------MKVLLIKDVKALGK--AGEIKEVKDGYGQNFLIAKGFAKAA
RL9_CAMJJ       -------------------MKVLLIKDVKALGK--AGEVKEVKDGYGQNFLIAKGFAKAA
RL9_CAMJ8       -------------------MKVLLIKDVKALGK--AGEIKEVKDGYGQNFLIAKGFAKAA
RL9_CAMHC       -------------------MKILLIKDVKSLGK--AGEVKEVKDGYANNFLIAKGFAKAA
RL9_SULDN       -------------------MKILLIKDVKTLGK--AGEVKEVKDGYGQNFLIAKGFAKHA
RL9_NITSB       -------------------MKVLLIKDVKNLGK--AGEVKEVKDGYGKNFLIARGFAKLA
RL9_ARCB4       -------------------MKVLLIKDVKSLGK--AGEIKEVADGYGKNFLIGKGLALHA
RL9_SULNB       -------------------MKVLLIKDVKSLGK--AGEIKEVKDGYGQNFLINKGLAKLA
RL9_HELPY       -------------------MKVLLLEDVKNLGK--AGEVCEVKDGYGNNFLIANQKAKLA
RL9_HELPJ       -------------------MKVLLLEDVKNLGK--AGEVCEVKDGYGNNFLIANQKAKLA
RL9_HELPH       -------------------MKVLLLEDVKNLGK--AGEVCEVKDGYGNNFLIANKKAKLA
RL9_HELAH       -------------------MKVLLLEDVKNLGK--AGEVCEVKDGYGNNFLIANKKAKLA
RL9_HELHP       -------------------MKVLLLENVQGLGK--KGEIVEVKDGYGQNFLIAKGKAQRA
RL9_WOLSU       -------------------MKVLLTKEVKGLGK--AGEIHEVKDGYGRNFLVGKGMAEIA
RL9_FERNB       -------------------MKVVLIQDVPKLGK--KGEVINASDGYARNFLIPRGLAREA
RL9_THEM4       -------------------MKVVLLKDVSKIGK--KGEIKNVSDGYARNYLIPKGLALEA
RL9_THEMA       -------------------MKVILLRDVPKIGK--KGEIKEVSDGYARNYLIPRGFAKEY
RL9_THEP1       -------------------MKVILLRDVPKIGK--KGEIKEVSDGYARNYLIPRGFAKEY
RL9_PSELT       -------------------MKVVLLKDIPGIGK--TGDMKEVKDGYARNFLIPRGLAKMA
RL9_PETMO       -------------------MKVLLLEDVAKLGK--KGEIKEVSDGYARNYLIPKNLAAEA
RL9_FUSNN       ----------------MAKIQVILLEDVAGQGR--KGEIVTVSDGYAHNFLLKGKKGVLA
RL9_BACHD       -------------------MKVIFQQDVKGKGK--KGEVKNVSEGYARNYLIPNGLAVEA
RL9_BACSK       -------------------MKVIFTEDVKGKGK--KGELKDVSEGYARNYLIPKNLAVAA
RL9_GEOTN       -------------------MKVIFLKDVKGKGK--KGEIKNVADGYANNFLFKQGLAIEA
RL9_GEOSE       -------------------MKVIFLKDVKGKGK--KGEIKNVADGYANNFLFKQGLAIEA
RL9_GEOKA       -------------------MKVIFLKDVKGKGK--KGEIKDVADGYANNFLFKQGLAIEA
RL9_BACCZ       -------------------MKVIFLKDVKGKGK--KGEVKNVPDGYANNFLLKQGLAAEA
RL9_BACAH       -------------------MKVIFLKDVKGKGK--KGEVKNVPDGYANNFLLKQGLAAEA
RL9_BACAN       -------------------MKVIFLKDVKGKGK--KGEVKNVPDGYANNFLLKQGLAAEA
RL9_BACHK       -------------------MKVIFLKDVKGKGK--KGEVKNVPDGYANNFLLKQGLAAEA
RL9_BACC1       -------------------MKVIFLKDVKGKGK--KGEVKNVPDGYANNFLLKQGLAAEA
RL9_BACCR       -------------------MKVIFLKDVKGKGK--KGEVKNVPDGYANNFLLKQGLAAEA
RL9_BACCN       -------------------MKVIFLKDVKGKGK--KGEIKNVPDGYANNFLLKQGLAAEA
RL9_BACVZ       -------------------MKVIFLQDVKGKGK--KGEMKNVADGYAHNFLIKKGLAVEA
RL9_BACSU       -------------------MKVIFLQDVKGKGK--KGEVKNVADGYAHNFLIKKGLAVEA
RL9_BACP2       -------------------MKVIFLKDVKGKGK--KGEVKNVADGYAHNFLIKQGLAVEA
RL9_BACLD       -------------------MKVIFLQDVKGKGK--KGEVKNVADGYAHNFLIKKGLAVEA
RL9_LISIN       -------------------MKVIFLKDVKGKGK--KGETKNVADGYANNFLIKNGYAVEA
RL9_LISW6       -------------------MKVIFLKDVKGKGK--KGETKNVADGYANNFLIKNGYAVEA
RL9_LISMO       -------------------MKVIFLKDVKGKGK--KGETKNVADGYANNFLIKNGYAVEA
RL9_LISMF       -------------------MKVIFLKDVKGKGK--KGETKNVADGYANNFLIKNGYAVEA
RL9_STAAW       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAE       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAC       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAR       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAS       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAA3       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAT       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAA1       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAM       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAA2       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAA9       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAN       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAA8       -------------------MKVIFTQDVKGKGKGKKGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAAB       -------------------MKVIFTQDVKGKGK--KGEVKEVPVGYANNFLLKKNYAVEA
RL9_STAS1       -------------------MKVIFTQDVKGKGK--KGEVKDVPVGYANNFLLKKNMAVEA
RL9_STAEQ       -------------------MKVIFTQDVKGKGK--KGEVKDVPVGYANNFLLKNKYAVEA
RL9_STAES       -------------------MKVIFTQDVKGKGK--KGEVKDVPVGYANNFLLKNKYAVEA
RL9_STAHJ       -------------------MKVIFTQDVKGKGK--KGEIKDVPVGYANNFLIKNNYAVEA
RL9_OCEIH       -------------------MKVIFLKDVKGKAK--KGDVKNVPDGYARNYLLKNNLAEEA
RL9_LACBA       -------------------MKVIFMKDVRGKGK--RGEIKNVPDGYAQNFLIKRGLAKEA
RL9_LACPL       -------------------MQVIFLNDVRGKGK--RGQIKNVPDGYAQNFLIKKGLAKEA
RL9_ENTFA       -------------------MKVIFLQDVKGKGK--KGDVKEVPTGYAQNFLIKNGYAKEA
RL9_PEDPA       -------------------MKVIFLEDVKGKGK--RGEVKNVSDGYAQNFLIKNGKAKAA
RL9_LACSS       -------------------MKVIFLEDVRGKGK--KGQVKDVPDGYAQNFLIKNGKAKPA
RL9_LACRD       -------------------MKVIFTQDVRGRGQ--RGQIKEVPDGYAQNYLIKRGLAKQA
RL9_LACS1       -------------------MKIIFTEDVRGKGR--RGEIKELPDGYA-NFLIKQNKAKQA
RL9_LACP3       -------------------MKVIFTQDVRGKGN--RGQVKEVPDGYAENFLIRKGLAKAA
RL9_LACAC       -------------------MKVIFTQDVRGRGK--RGQVKDVPDGYAQNYLIKRGLAKEA
RL9_LACH4       -------------------MKVIFTQDVRGRGK--RGQVKEVPDGYAQNYLIKRGLAKVA
RL9_LACJO       -------------------MKVIFIKDMKGKGK--RGEVKNVPDGYAQNFLIKNGYAKEA
RL9_LACDA       -------------------MKVIFMQDVKGRGK--LGQVKDVPNGYAQNYLIKQGLAKEA
RL9_LACDB       -------------------MKVIFMQDVKGRGK--RGQVKDVPNGYAQNYLIKQGLAKEA
RL9_STRT2       -------------------MKVIFLQDVKGKGK--KGEIKEVPLGYAQNFLIKKNLAKEA
RL9_STRT1       -------------------MKVIFLQDVKGKGK--KGEIKEVPLGYAQNFLIKKNLAKEA
RL9_STRTD       -------------------MKVIFLQDVKGKGK--KGEIKEVPLGYAQNFLIKKNLAKEA
RL9_STRA5       -------------------MKVIFLQDVKGKGK--KGEVKEVPTGYAQNFLLKKNLAKEA
RL9_STRA3       -------------------MKVIFLQDVKGKGK--KGEVKEVPTGYAQNFLLKKNLAKEA
RL9_STRA1       -------------------MKVIFLQDVKGKGK--KGEVKEVPTGYAQNFLLKKNLAKEA
RL9_STRPD       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRPM       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRPF       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRP3       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRPC       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRP1       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRPB       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRPG       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRP8       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRP6       -------------------MKVIFLADVKGKGK--KGEIKEVLTGYAQNFLIKKNLAKEA
RL9_STRMU       -------------------MKVIFLADVKGKGK--RGEVKEVSTGYAQNFLIKKNLAKEA
RL9_STRP2       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRR6       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRPN       -------------------MKVIFLADVKGKGK--KGEIKEVPTGYAQNFLIKKNLAKEA
RL9_STRGC       -------------------MKVIFLADVKGKGK--KGEVKEVPTGYAQNFLIKKNLAKEA
RL9_STRSV       -------------------MKVIFLADVKGKGK--KGEIKEMPTGYAQNFLIKKNLAKEA
RL9_LACLS       -------------------MKVVFLEDVKGQGK--KGQIKEVPTGYAQNFLIKKNLAKVA
RL9_LACLM       -------------------MKVVFLEDVKGQGK--KGQIKEVPTGYAQNFLIKKNLAKVA
RL9_LACLA       -------------------MKVVFLEDVKGQGK--KGQIKEVPTGYAQNFLIKKNLAKVA
RL9_LEUMM       -------------------MKVVFLEDVKGRGK--KGEIKEVPDGYANNFLIKNKKAEPA
RL9_OENOB       -------------------MKVIFLQDVKNQGK--RGQIKEVPDGYANNFLIKNKKAVYA
RL9_ALKOO       -------------------MKVILLQDVKGLGK--KGEVVNASDGYARNFLFPKKLAAEA
RL9_ALKMQ       -------------------MKVILLKDVKGLGD--KGDVVNASDGYARNFLLPKKVAKEA
RL9_CLOD6       -------------------MKVILLKDVKGTGK--KGEMKEVSDGYARNFLFPKKMAVQA
RL9_CALS4       -------------------MKVILVKDVKNVGK--AGEVVNVSDGYGRNYLIPKGLAIEA
RL9_HUNT2       -------------------MKVILKEDVKGLGK--KESLVEVSDGYARNFLIPKGLAVEA
RL9_CLOTE       -------------------MKVILLKDVKKLGK--KDDVVNVSDGYARNFLFPRKLALEA
RL9_CLOK5       -------------------MKVILLKDVKTLGK--KGEVINASDGYARNYLIPKGFAEEA
RL9_CLOAB       -------------------MKVILLKDIKSVGK--KGEVINVSDGYARNFLFPRKLAEEA
RL9_CLONN       -------------------MKVILLKDVKGKGK--KGEVINASDGYARNFLLPRGLGEEA
RL9_CLOPE       -------------------MKVILLQDVKKLGK--KGDVINASDGYARNFLFPKKLAQEA
RL9_CLOP1       -------------------MKVILLQDVKKLGK--KGDVINASDGYARNFLFPKKLAQEA
RL9_CLOPS       -------------------MKVILLQDVKKLGK--KGDVINASDGYARNFLFPKKLAQEA
RL9_CLOB8       -------------------MKVILLQDVKKIGK--KGDIIEASDGYARNFLFPRKLAQEA
RL9_CLOB1       -------------------MKVILLKDVKSLGK--KGDLVNASDGYARNYLIPKKLAEQA
RL9_CLOBH       -------------------MKVILLKDVKSLGK--KGDLVNASDGYARNYLIPKKLAEQA
RL9_CLOBL       -------------------MKVILLKDVKSLGK--KGDLVNASDGYARNYLIPKKLAEQA
RL9_CARHZ       -------------------MKVILLTEVKKLGK--KGDVVEVAEGYGRNYLIAKGLAVEA
RL9_DESHY       -------------------MKVILKADVKALGK--KGQVYEVSDGYARNFLFPKGLAVEA
RL9_LACP7       -------------------MQVILLDDVKALGK--KGEVVNVSDGYARNFILPKKLGLEA
RL9_DESRM       -------------------MQVVLLQDVVKLGK--KGDIVNVSEGYARNFLYPKNLAAPA
RL9_DEHMB       -------------------MKVVFLKDVPGRGK--TGDIKEVNDGYARNYLIPNKLAMPA
RL9_DEHMC       -------------------MKVVFLKDVPGRGK--TGDIKEVNDGYARNYLIPNKLAMPA
RL9_DEHM1       -------------------MKVAFLKDVPGRGK--TGDVKEVNDGYARNYLIPNKLAMPA
RL9_CALS8       -------------------MKVVLLQDVKGLGK--KDSIVEVNDGYARNYLIPRKLAAPL
RL9_MOOTA       -------------------MKVILTADVAKLGN--RGTLVEVSEGYARNYLLPRGLAVEA
RL9_PELTS       -------------------MKVILLKDVPGQGK--KGEVVDVAEGYARNYLFPRGLAEEA
RL9_SYMTH       ---------------------MILKADVKGTGK--KGQTVEVADGYARNYLIPRGLAVAA
RL9_STRAW       -------------------MKIILTHEVSGLGA--AGDVVDVKDGYARNYLIPRNFAIRW
RL9_STRCO       -------------------MKIILTHEVSGLGA--AGDVVDVKDGYARNYLIPRKFAIRW
RL9_ACIC1       -------------------MKLILTQEVAGLGG--PGDVVEVRDGYGRNYLLPKRLAMPA
RL9_KINRD       -------------------MKLILTHEVSGLGT--PGDVVEVKDGYGRNFLLPRNLATPW
RL9_FRACC       -------------------MKLILTQEVPGLGS--PGDIVEVANGYGRNYLVPRRYAILA
RL9_FRAAA       -------------------MKLILTQEVPGLGS--PGDIVEVANGYGRNYLVPRKYAILA
RL9_SALTO       -------------------MKIILTQEVSGLGA--PGDIVEVKNGYGRNYLLPQGFAIAW
RL9_SALAI       -------------------MKIILTQEVSGLGA--PGDIVEVKNGYGRNYLLPQGFAIAW
RL9_THEFY       -------------------MKLILTHEVDGLGS--PGDVVEVKDGYGRNYLLPRGFAIKW
RL9_NOCSJ       -------------------MKLILTQEVTGLGA--PGDVVEVKDGYGRNYLVPRGLAMRW
RL9_CLAMS       ------------------MSKVILTTEVSGLGS--PGDVVEVKNGFSRNYLVPQGFAVIW
RL9_CLAM3       ------------------MSKVILTTEVSGLGS--PGDVVEVKNGFSRNYLVPQGFAVIW
RL9_LEIXX       ------------------MSKVILTHEVTGLGS--AGDVVEVKDGYARNYLVPQGFAISW
RL9_RENSM       ------------------MAKIILTHEVTGLGA--AGDVVEVKNGYARNYLLPRGFALTW
RL9_PAEAT       ------------------MAKLILTHEVTGLGA--AGDVVEVKDGYARNFLLPRGFALTW
RL9_ARTS2       ------------------MAKLILTHEVTGLGA--AGDVVEVKDGYARNFLLPRGFALTW
RL9_MYCGI       -------------------MKLILTAEVEHLGV--AGDTVEVKDGYGRNYLLPRGLAIVA
RL9_MYCVP       -------------------MKLILTAEVEHLGV--PGDAVEVKDGYGRNYLLPRGLAIVA
RL9_MYCSK       -------------------MKLILTAEVDHLGE--PGDTVEVKDGYGRNYLLPRGLAIVA
RL9_MYCSS       -------------------MKLILTAEVDHLGE--PGDTVEVKDGYGRNYLLPRGLAIVA
RL9_MYCSJ       -------------------MKLILTAEVDHLGE--PGDTVEVKDGYGRNYLLPRGLAIVA
RL9_MYCS2       -------------------MKLILTAEVEHLGA--AGDTVEVKDGYGRNYLLPRGLAIVA
RL9_MYCA1       -------------------MKLILTADVDHLGA--VGDTVEVKDGYGRNFLLPRGLAIVA
RL9_MYCPA       -------------------MKLILTADVDHLGA--VGDTVEVKDGYGRNFLLPRGLAIVA
RL9_MYCBO       -------------------MKLILTADVDHLGS--IGDTVEVKDGYGRNFLLPRGLAIVA
RL9_MYCBP       -------------------MKLILTADVDHLGS--IGDTVEVKDGYGRNFLLPRGLAIVA
RL9_MYCTU       -------------------MKLILTADVDHLGS--IGDTVEVKDGYGRNFLLPRGLAIVA
RL9_MYCTA       -------------------MKLILTADVDHLGS--IGDTVEVKDGYGRNFLLPRGLAIVA
RL9_MYCLE       -------------------MKLILTADVDHLGS--VGDTVEVKDGYGRNFLLPHGLAIVA
RL9_MYCUA       -------------------MKLILTADVDHLGS--VGDTVEVKDGYGRNFLLPRGMAIVA
RL9_NOCFA       -------------------MKLILTADVDNLGA--PGDTVEVKDGYGRNYLLPRGLAIVA
RL9_RHOJR       -------------------MKLILTADVDNLGA--PGDTVEVKDGYGRNYLLPRGLAIVA
RL9_CORGB       -------------------MKLILTAAVENLGV--AGDIVEVKNGYGRNLLLPRGLAIVA
RL9_CORGL       -------------------MKLILTAAVENLGV--AGDIVEVKNGYGRNLLLPRGLAIVA
RL9_COREF       -------------------MKLILTAAVENLGV--AGDIVEVKDGYGRNLLLPRGLAIPA
RL9_CORDI       -------------------MKLILTADVENLGV--AGDIVEVKDGYGRNLLLPRGLAIVA
RL9_CORJK       -------------------MKLILTANVDNLGV--PGDIVEVKAGYGRNYLLPRGYAIVA
RL9_SACEN       -------------------MKIILTADVTGLGE--SGDIVEVKDGYARNLLLPRGLAIVA
RL9_CUTAK       -------------------MKLILTAPVAKLGV--PGDIVEVKDGYGRNYLLPQNYAIKW
RL9_TROW8       ------------------MTRVILVQDVNGLGS--VGDVVEVKAGYSRNYLVPKGMAVRW
RL9_TROWT       ------------------MTRVILVQDVNGLGS--VGDVVEVKAGYSRNYLVPKGMAVRW
RL9_BIFAA       ----------------MAETKVILTKSVNHLGH--PGDVVAVKSGYARNYLFPQGLAFAW
RL9_BIFLO       ----------------MAETKVILTKTVSNLGH--SGDVVDVKSGYARNYLFPQGLAFAW
RL9_BORBP       -------------------MKVILKEDFTNLGR--EGDTVEVKDGFARNYLLPKGFAVFS
RL9_BORAP       -------------------MKVILKEDFINLGR--EGDTVEVRDGFARNYLLPKGFAVFS
RL9_BORBU       -------------------MKVILKEDFINLGK--EGDTVEVRDGFARNYLLPKGFAVFS
RL9_TREDE       -------------------MKVILNEDVKYLGE--EGDIKNVAKGYARNYLFPRNLAVPC
RL9_TREPA       -------------------MKIILNQDVKILGE--EGDVKEVAAGYFRNYLYPRNLAVPH
RL9_VIBVY       -------------------MQVILLDKIGNLGS--LGDTVNVKSGYARNFLIPQGKAVMA
RL9_VIBVU       -------------------MQVILLDKIGNLGS--LGDTVNVKSGYARNFLIPQGKAVMA
RL9_VIBCB       -------------------MQVILLDKIGNLGG--LGDTVNVKSGYARNFLIPQGKAVMA
RL9_VIBPA       -------------------MQVILLDKIGNLGG--LGDTVNVKSGYARNFLIPQGKAVMA
RL9_VIBC3       -------------------MQVILLDKIGNLGS--LGDTVNVKSGYARNFLIPQGKAVMA
RL9_VIBCH       -------------------MQVILLDKIGNLGS--LGDTVNVKSGYARNFLIPQGKAVMA
RL9_PHOPR       -------------------MQVILLDKIGNLGS--LGDQVNVKSGYARNFLIPQGKVVMA
RL9_ALIF1       -------------------MQVILLDKIGNLGS--LGDQVNVKAGYARNFLIPQGKAVMA
RL9_IDILO       -------------------MNVILLDKIANLGS--LGDQVSVKSGYARNFLFPQGKAVPA
RL9_SHEB9       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHEB8       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHEB5       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHESM       -------------------MNVILLDKIANLGN--LGDQVAVKAGYARNYLLPQGKAVVA
RL9_SHESA       -------------------MNVILLDKIANLGN--LGDQVAVKAGYARNYLLPQGKAVVA
RL9_SHESR       -------------------MNVILLDKIANLGN--LGDQVAVKAGYARNYLLPQGKAVVA
RL9_SHESW       -------------------MNVILLDKIANLGN--LGDQVVVKAGYARNYLLPQGKAVVA
RL9_SHEPC       -------------------MNVILLDKIANLGN--LGDQVVVKAGYARNYLLPQGKAVVA
RL9_SHEON       -------------------MNVILLDKIANLGN--LGDQVAVKAGYARNYLLPQGKAVVA
RL9_SHEAM       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHEDO       -------------------MNVILLDKIANLGS--LGDQVSVKAGYARNFLLPFGKAVVA
RL9_SHEFN       -------------------MNVILLDKVANLGS--LGDQVSVKAGYARNFLLPYGKAVVA
RL9_SHELP       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHEHH       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHEPA       -------------------MNVILLDKIANLGN--LGDQVSVKAGYARNFLLPQGKAVVA
RL9_SHESH       -------------------MNVILLDKIANLGN--LGDQVAVKAGYARNFLLPQGKAVVA
RL9_PSEHT       -------------------MQVILLDKIANLGG--LGDQVVVKSGFARNFLFPQGKAVPA
RL9_PSEA6       -------------------MEIILLNKVANLGG--LGDNVTVKSGYARNFLFPQGQAVPA
RL9_COLP3       -------------------MEVILLDKIAKLGG--LGDKVSVKSGYARNYLLPQGKAVFA
RL9_PSYIN       -------------------MEIILQDTVANLGK--LGDKVVVKSGYARNFLFPQQKAVPA
RL9_AERS4       -------------------MQVILLDKIAKLGG--LGDQVAVKAGYARNYLIPQGKAVMA
RL9_AERHH       -------------------MQVILLDKIAKLGG--LGDQVSVKAGYARNYLIPQGKAVMA
RL9_ECOK1       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECOL6       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECO57       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECOLI       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SHIF8       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SHISS       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SHIFL       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECOHS       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECOLC       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECOL5       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECOUT       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ECO24       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SHIBS       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SHIDS       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SALTY       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPKGKAVPA
RL9_SALPB       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPKGKAVPA
RL9_SALAR       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SALPA       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SALCH       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SALTI       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_CITK8       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_CROS8       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_ENT38       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_KLEP7       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERPA       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERPN       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERPS       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERPP       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERPE       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERP3       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_YERE8       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_PECAS       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_SERP5       -------------------MQVILLDKVANLGS--LGDQVNVKAGYARNFLVPQGKAVPA
RL9_PHOLL       -------------------MQIILLDKVANLGS--LGDQVNVKPGYARNYLVPQGKAVPA
RL9_SODGM       -------------------MQVILLDKVANLGG--LGEQVNVKAGYARNYLVPQGKAVPA
RL9_BAUCH       -------------------MQIILLDNVSNLGK--LGEQVNVKAGYARNYLVPQGKAVPA
RL9_ACTP2       -------------------MQVILLDKVAHLGS--VGDQVTVKSGFARNFLIPQGKAVMA
RL9_HAEDU       -------------------MQVILLDKVAHLGT--VGDQVTVKSGYARNFLIPQGKAVMA
RL9_ACTSZ       -------------------MQVILLDKIVHLGN--VGDQVNVKSGFARNFLIPQGKAVMA
RL9_MANSM       -------------------MQVILLDKIVHLGN--VGDQVNVKSGFARNFLIPQGKAVMA
RL9_PASMU       -------------------MQVILLDKVVHLGN--IGDQVNVKSGFARNFLIPQGKAVMA
RL9_HAEIE       -------------------MQVILLDKIVHLGQ--VGDQVNVKSGFARNFLIPQGKAVMA
RL9_HAEIN       -------------------MQVILLDKIVHLGQ--VGDQVNVKSGFARNFLIPQGKAVMA
RL9_HAEIG       -------------------MQVILLDKIVHLGQ--VGDQVNVKSGFARNFLIPQGKAVMA
RL9_HAEI8       -------------------MQVILLDKIAHLGQ--VGDQVNVKSGFARNFLIPQGKAVMA
RL9_HAES1       -------------------MQVILLDKIAHLGN--VGDQVSVKAGFARNFLIPQGKAVMA
RL9_HISS2       -------------------MQVILLDKIAHLGN--VGDQVSVKAGFARNFLIPQGKAVMA
RL9_MARHV       -------------------MEVILLEKVANLGS--LGDKVKVKAGYGRNFLLPYGKAVPA
RL9_HAHCH       -------------------MEVILLEKVANLGN--LGDKVKVRAGYGRNFLVPYGKAVPA
RL9_PSEMY       -------------------MEVILLEKIANLGN--LGDKVNVKAGYGRNFLLPQGKATAA
RL9_PSEU5       -------------------MEVILLEKIANLGN--LGDKVNVKAGYGRNYLLPQGKATAA
RL9_PSESM       -------------------MQLILLEKVANLGN--LGDKVNVKAGYGRNYLLPYGKATAA
RL9_PSEU2       -------------------MQLILLEKVANLGN--LGDKVNVKAGYGRNYLLPYGKATAA
RL9_PSE14       -------------------MQLILLEKVANLGN--LGDKVNVKAGYGRNYLLPYGKATAA
RL9_PSEF5       -------------------MELILLEKIANLGN--LGDKVNVKAGYGRNYLLPFGKATAA
RL9_PSEPF       -------------------MQLILLEKIANLGN--LGDKVNVKAGYGRNYLLPFGKATAA
RL9_PSEP1       -------------------MELILLEKVANLGN--LGDKVKVKAGYGRNFLLPFGKATVA
RL9_PSEPK       -------------------MELILLEKVANLGN--LGDKVKVKAGYGRNFLLPFGKATVA
RL9_PSEPG       -------------------MELILLEKVANLGN--LGDKVKVKAGYGRNFLLPFGKATVA
RL9_PSEE4       -------------------MELILLEKVANLGN--LGDKVNVKAGYGRNFLLPFGKATVA
RL9_PSEA7       -------------------MEVILLEKVANLGN--LGDKVNIKGGYARNFLLPQGKATVA
RL9_PSEAE       -------------------MEVILLEKVANLGN--LGDKVNIKGGYARNFLLPQGKATVA
RL9_PSEAB       -------------------MEVILLEKVANLGN--LGDKVNIKGGYARNFLLPQGKATVA
RL9_CHRSD       -------------------MDVILLDKIGKLGN--LGDQVAVKAGYGRNYLVPYGLAVPA
RL9_SACD2       -------------------MEVILLEKVGKLGT--VGDVVDVKAGFGRNYLLPSGKAITA
RL9_PSYCK       -------------------MQIILLQRIVNLGK--LGETVDVKPGYGRNFLIPLGKALPA
RL9_PSYA2       -------------------MQIILLQRIVNLGK--LGETVDVKPGYGRNFLIPLGKALPA
RL9_PSYWF       -------------------MQVILLQRIVNLGK--LGETVDVKSGYGRNYLIPQGKALPA
RL9_ACIBT       -------------------MDVILLQRIKNLGK--LGDKVSVKAGYGRNFLIPQGKAVAA
RL9_ACIAD       -------------------MDVILLQRIKNLGK--LGDKVSVKAGYGRNFLIPQGKAVAA
RL9_ALCBS       -------------------MQVILLETIKNLGD--LGAVVDVRSGYGRNFLIPQGKALPA
RL9_MARMS       -------------------MEVILLDKVNKLGG--IGDVAVVKPGYARNFLIPNKKAVMA
RL9_HYDCU       -------------------MNVILLEKVQNLGS--LGEQVAVKSGFARNFLIPQGKAKPA
RL9_NITOC       -------------------MEVILLEQVVNLGK--LGDKVAVKSGYARNYLIPQGRAVSA
RL9_ALKEH       -------------------MEVILLEKVANLGD--LGDRVKVRPGYGRNYLVPQGKAKPA
RL9_HALHL       -------------------MELILLEKVSNLGN--LGDRVRVRPGYGRNYLLPYGKAKMA
RL9_XYLFA       -------------------MELILLQKVANLGA--LGDKVTVKPGYGRNFLLPKGVAVPA
RL9_XYLFT       -------------------MELILLQKVANLGA--LGDKVTVKPGYGRNFLLPNGVAVPA
RL9_XANC5       -------------------MDLILLQKVTNLGN--LGDKVSVKPGYGRNFLVPQGKAVPA
RL9_XANAC       -------------------MDLILLQKVTNLGN--LGDKVSVKPGYGRNFLVPQGKAVPA
RL9_XANC8       -------------------MDLILLQKVTNLGN--LGDKVSVKPGYGRNFLVPQGKAVPA
RL9_XANCP       -------------------MDLILLQKVTNLGN--LGDKVSVKPGYGRNFLVPQGKAVPA
RL9_XANOR       -------------------MDLILLQKVTNLGN--LGDKVSVKPGYGRNFLVPQGKAVPA
RL9_XANOM       -------------------MDLILLQKVTNLGN--LGDKVSVKPGYGRNFLVPQGKAVPA
RL9_METCA       -------------------MDVILLEKVPNLGS--LGDKVSVRPGYGRNFLIPKGKAVAA
RL9_COXBR       -------------------MKLILQEKVANLGN--IGDQVVVKPGYARNFLLPLGKAVPA
RL9_COXBU       -------------------MKLILQEKVANLGN--IGDQVVVKPGYARNFLLPLGKAVPA
RL9_COXBN       -------------------MKLILQEKVANLGN--IGDQVVVKPGYARNFLLPLGKAVPA
RL9_LEGPH       -------------------MEVILLEKVRNLGN--LGDKVHVKSGYGRNYLIPQNKAVFA
RL9_LEGPC       -------------------MEVILLEKVRNLGN--LGDKVHVKSGYGRNYLIPQNKAVFA
RL9_LEGPL       -------------------MEVILLEKVRNLGN--LGDKVHVKSGYGRNYLIPQNKAVFA
RL9_LEGPA       -------------------MEVILLEKVRNLGN--LGDKVHVKSGYGRNYLIPQNKAVFA
RL9_DICNV       -------------------MEIILLDRVHGLGS--LGDKVRVKSGYARNYLIPNGKATEA
RL9_FRATW       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_FRAT1       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_FRATT       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_FRATH       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_FRATF       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_FRATN       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_FRAP2       -------------------MQVILKEKVENLGV--LGDIVNVKPGYARNFLIPFGKAVQA
RL9_AZOSB       -------------------MQIILLEKVVNLGN--LGDVVKVKDGYARNFLIPQGKAKRA
RL9_AROAE       -------------------MQIILLEKVANLGV--LGDVVKVKDGYARNYLIPQGKAKRA
RL9_METFK       -------------------MQVILLEKVVNLGN--LGDIVKVKDGYGRNFLIPQGKAKRA
RL9_NITMU       -------------------MQIILMEKVVNLGQ--LGDVVKVKNGYARNFLIPQGKAKRA
RL9_DECAR       -------------------MQIILLEKVVNLGN--LGDIVKVKDGYARNFLIPQRMAKRA
RL9_POLAQ       -------------------MQIILLEKVTNLGN--LGDVVRVKDGFARNFLIPQRKARRA
RL9_BORBR       -------------------MQIILLEKVANLGN--LGEVVRVRDGYARNFLIPQKKARRA
RL9_BORPA       -------------------MQIILLEKVANLGN--LGEVVRVRDGYARNFLIPQKKARRA
RL9_BORPE       -------------------MQIILLEKVANLGN--LGEVVRVRDGYARNFLIPQKKARRA
RL9_BORA1       -------------------MQVILLEKVSNLGN--LGEVVRVRDGYARNFLIPQKKARRA
RL9_ACIAC       -------------------MQIILLDKVVNLGN--LGEIVKVKDGYARNFLIPSGRARRA
RL9_ACISJ       -------------------MQIILLDKVVNLGN--LGEIVKVKDGYARNFLIPTGRARRA
RL9_VEREI       -------------------MQIILLDKVVNLGN--LGQIVKVKDGYARNFLIPTGRARRA
RL9_POLNA       -------------------MQIILLDKVVNLGN--LGDVVKVKDGYARNFLIPFGRARRA
RL9_POLSJ       -------------------MQIILLDKVVNLGN--LGEVVKVKDGYARNFLIPSGRARRA
RL9_RHOFT       -------------------MQIILLDKVVNLGN--LGEVVRVKDGYARNFLIPSGRARRA
RL9_METPP       -------------------MQIILLEKVANLGN--LGEVVKVKDGYARNFLIPSGAARRA
RL9_CUPNH       -------------------MQIILLEKVINLGN--LGDIVKVKDGYARNFLIPGKKARRA
RL9_CUPMC       -------------------MQVILLEKVINLGS--LGDIVRVKDGYARNFLIPTKRARRA
RL9_CUPPJ       -------------------MQIILLEKVINLGN--LGDIVKVKDGYARNFLIPSKKARRA
RL9_RALSO       -------------------MQIILLEKVVNLGN--LGDVVRVKDGYARNFLIPNKQARRA
RL9_PARXL       -------------------MQIILLEKVVNLGN--LGDIVKVKDGYARNFLIPNKQARRA
RL9_BURP1       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURMS       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURP0       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURMA       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURM7       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURPS       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURM9       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURP6       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURTA       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURCA       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURCH       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURL3       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURVG       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_BURCM       -------------------MQIILLEKVANLGN--LGDIVKVKDGYARNFLIPNRKARRA
RL9_JANMA       -------------------MQVILLEKVVNLGN--LGEVVKVKDGYARNFLIPQRKARRA
RL9_HERAR       -------------------MQVILLEKVVNLGN--LGEIVKVKDGYARNFLIPQRKARRA
RL9_THIDA       -------------------MQVILMDKVVNLGN--LGDVVKVKDGYARNFLIPTGRARRA
RL9_NEIMB       -------------------MQIILLEKIGGLGN--LGDIVTVKNGYARNFLIPAGKAKRA
RL9_NEIMF       -------------------MQIILLEKIGGLGN--LGDIVTVKNGYARNFLIPAGKAKRA
RL9_NEIMA       -------------------MQIILLEKIGGLGN--LGDIVTVKNGYARNFLIPAGKAKRA
RL9_NEIM0       -------------------MQIILLEKIGGLGN--LGDIVTVKNGYARNFLIPAGKAKRA
RL9_NEIG1       -------------------MQIILLEKIGGLGN--LGDIVTVKNGYARNFLIPAGKAKRA
RL9_NEIGO       -------------------MQIILLEKIGGLGN--LGDIVTVKNGYARNFLIPAGKAKRA
RL9_CHRVO       -------------------MQIILLEKVANLGQ--LGDVVNVKNGFARNFLIPQGKAKRA
RL9_NITEU       -------------------MQVILLEKIAKLGS--LGSIVNVKPGYARNYLIPQGKARRV
RL9_NITEC       -------------------MQVILLEKIVKLGS--LGSIVNVKPGYARNYLIPQGKAKRA
RL9_VESOH       -------------------MQVILLENIQKLGN--LGDIINVKAGYTRNFLIPKGKAKLA
RL9_RUTMC       -------------------MQVILLEKIQKLGD--LGDLANVKAGYARNFLIPRSKVKPA
RL9_BUCAI       -------------------MEVILLSKIKKLGD--SGAVINVKSGYARNFLIPKGKAILA
RL9_BUCAP       -------------------MEVILLSKIKKLGD--SGAIVHVKSGYARNFLIPKGKAILA
RL9_BUCBP       -------------------MQIILLEKLDNLGN--KGDILFVKSGYARNFLIPYGKAIFA
RL9_BUCCC       -------------------MKVILLHALEKLGK--KGQLITVKNGYARNYLIPLEKALLA
RL9_WIGBR       -------------------MQIILLKKIINKGN--IGDKIKVKAGYARNFLFPKKIAIIA
RL9_BLOPB       -------------------MKIILLDNIDKLGN--KGSEVVVRSGYARNFLIPKSKAMLA
RL9_BLOFL       -------------------MKVILLDSIDKVGK--IGSEIIVKSGYARNFLFPKSKAVLS
RL9_PELUB       -------------------MKVILLENLRRIGS--IGEIIDVKRGFARNFLISNKKALYA
RL9_WOLPM       -------------------MLIILKENIRTLGK--LGEVVKVKPGYARNFLFPQRKAVKA
RL9_WOLTR       -------------------MLVILKENIRTLGK--LGEIVKVKPGYARNFLFPQRKAVKA
RL9_ANAPZ       ------------------MLSVILKSSIRGLGK--AGEVAKVRPGYAR-YLLADGKAMRA
RL9_ANAMM       ------------------MLSVILKSSVRGLGK--AGEIAKVRPGYAR-YLLADGKAVRA
RL9_EHRCR       ------------------MLSVILKESVRNLGK--AGMVLKVKPGYAR-YLLTQKKAVRA
RL9_EHRCJ       ------------------MLSIILKESVRNLGK--AGVVTKVKPGYAR-YLLTQKKAVRA
RL9_EHRRW       ------------------MLSVILKESVRNLGK--AGVVTKVKPGYAR-YLLAQKKAVRA
RL9_EHRRG       ------------------MLSVILKESVRNLGK--AGVVTKVKPGYAR-YLLAQKKAVRA
RL9_NEOSM       -------------------MLVILKETARKLGN--VGDVLKVKKGFARNYLIPSGKAVRA
RL9_RICPR       -------------------MEVILIKPVRKLGK--IGDILKVADGFGRNYLLPQKLAIRA
RL9_RICTY       -------------------MEIILIKPVRKLGK--IGDILKVANGFGRNYLLPQKLAIRA
RL9_RICRS       -------------------MEIILIKPVRKLGK--IGDILKVADGFGRNYLLPQKLAIRA
RL9_RICRO       -------------------MEIILIKPVRKLGK--IGDILKVADGFGRNYLLPQKLAIRA
RL9_RICCN       -------------------MEIILIKPVRKLGK--IGDILKVADGFGRNYLLPQKLAIRA
RL9_RICM5       -------------------MEIILIKPVRKLGK--IGDILKVADGFGRNYLLPQKLAIRA
RL9_RICFE       -------------------MEIILIKPVRKLGK--IGDMLKVADGFGRNYLLPQKLAIRA
RL9_RICAH       -------------------MEIILIKPVRKLGK--IGDMLKVADGFGRNYLLPQKLAIRA
RL9_RICCK       -------------------MEIILIKPVRKLGK--IGDILKVADGFGRNYLLPQKLAIRA
RL9_RICBR       -------------------MEVILIKPVRKLGK--IGEIHKVADGFGRNYLLPQKLAIRA
RL9_RICB8       -------------------MEVILIKPVRKLGK--IGEIHKVADGFGRNYLLPQKLAIRA
RL9_ORITB       -------------------MKLILIKPVKKLGK--IMDIVDVANGFGRNYLLPRNYAIRA
RL9_RUBXD       -------------------MQVILTQDVEKVGR--RGDIVDVSRGYVRNYLVPRGLAEVA
RL9_RHOBA       MSKSATSHFKRLPKGQNGGIELLLIHNVEHLGR--QGDLVEVKAGYALNYLLPQGLATIA
RL9_DESPS       -------------------MKLILKETISTLGR--EGDLIDVKAGYGRNYLLPQGKAVLA
RL9_RHOS1       -------------------MQVILLQRVAKLGQ--MGEVVNVKDGYARNFLLPQGKALRA
RL9_RHOS4       -------------------MQVILLQRVAKLGQ--MGEVVNVKDGYARNFLLPQGKALRA
RL9_RHOS5       -------------------MQVILLQRVAKLGQ--MGEVVNVKDGYARNYLLPQGKALRA
RL9_DINSH       -------------------MQVILLERVAKLGQ--MGEVVDVKPGYARNYLLPQGKALNA
RL9_ROSDO       -------------------MQVILLERVAKLGQ--MGEVVDVKPGYARNFLLPQGKALSA
RL9_RUEPO       -------------------MQVILLERVAKLGQ--MGDVVDVKSGYARNFLLPQSKALVA
RL9_RUEST       -------------------MQVILLERVAKLGQ--MGDVVDVKPGFARNYLLPQGKAQTA
RL9_PARDP       -------------------MQVILLERVAKLGQ--MGEVVKVKDGFARNFLLPQGKALRA
RL9_JANSC       -------------------MDVILLERVAKLGQ--MGEVVSVKEGYARNFLLPQKKALRA
RL9_RHOCB       -------------------MQVILLERVAKLGQ--MGDVVKVRDGYARNFLLPQGKALRA
RL9_RHILO       -------------------MEVILLERVSRLGQ--MGDTVKVKDGFARNFLLPQGKALRA
RL9_CHESB       -------------------MEVILLERIPRLGQ--MGDVVRVKDGFARNFLLRQGKALRA
RL9_SINMW       -------------------MEVILLERIAKLGQ--MGETVKVRDGFARNYLLPLGKALRA
RL9_RHIME       -------------------MEVILLERIAKLGQ--MGETVKVRDGFARNYLLPLGKALRA
RL9_RHILT       -------------------MEVILLERISKLGQ--MGETVKVRDGFARNYLLPLGKALRA
RL9_RHIL3       -------------------MQVILLERISKLGQ--MGETVKVRDGFARNYLLPLGKALRA
RL9_RHIEC       -------------------MEVILLERISKLGQ--MGETVKVRDGFARNYLLPLGKALRA
RL9_AGRFC       -------------------MDVILLERINKLGQ--MGETVKVRDGYARNFLLPQGKALRA
RL9_BRUAB       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_BRUA2       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_BRUME       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_BRUO2       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_BRUC2       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_BRUSI       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_BRUSU       -------------------MEVILLERIGRLGQ--MGDTVKVKDGYARNFLLPQGKALRA
RL9_OCHA4       -------------------MEVILLERIGRLGQ--MGETVKVKDGYARNFLLPQGKALRA
RL9_BARHE       -------------------MDIILLERIPRLGQ--MGDIVSVKDGYARNFLLPQGKALRA
RL9_BARQU       -------------------MDIILLERIPRLGQ--MGDIVSVKDGYARNFLLPQGKALRA
RL9_BART1       -------------------MDIILLERIPRLGQ--MGDIVSVKDGYARNFLLPQGKALRA
RL9_BARBK       -------------------MDIILLERINRLGQ--IGDIVSVKDGYARNFLLPKGKALRA
RL9_PARL1       -------------------MQVVLLERVEKLGQ--MGDVVKVKDGFARNFLLPRKKALRA
RL9_MAGSA       -------------------MEVILLERIEKLGQ--MGDVVNVKPGFARNFLLPQKKALRA
RL9_RHORT       -------------------MEVILLERIENLGF--MGDIVKVKDGYARNFLLPQKKALRK
RL9_GLUDA       ----------------MSAVELILLQRVENLGQ--MGDVVKVKPGYARNFLLPQGKAIRA
RL9_GLUOX       ----------------MSQTALILLQRVEHLGQ--MGDLVHVKPGYARNFLLPQAKAMRA
RL9_GRABC       ----------------MAAVELILLQRVEKLGQ--MGDLVRVKPGYARNFLLPGGRAIRA
RL9_ACICJ       ----------------MAQVELILLQRVEHLGQ--MGEVVKVKPGYARNFLLPQAKAVRA
RL9_RHOP2       -------------------MEVILLERVAKLGQ--MGELVRVKDGYARNFLLPRGKALRA
RL9_RHOPS       -------------------MEVILLERVAKLGQ--MGELVRVKDGFARNFLLPRGKALRA
RL9_RHOPA       -------------------MEVILLERVAKLGQ--MGELVRVKDGFARNFLLPRGKALRA
RL9_RHOP5       -------------------MEVILLERVAKLGQ--MGEVVKVKDGYARNFLLPRGKALRA
RL9_RHOPB       -------------------MEVILLERVAKLGQ--MGEVVKVKHGFARNFLLPRGKALRA
RL9_BRASO       -------------------MEVILLERVAKLGQ--MGEIVKVKDGFARNFLLKRKKALRA
RL9_BRASB       -------------------MEVILLERVAKLGQ--MGEIVKVKDGFARNFLLKRKKALRA
RL9_NITWN       -------------------MEIILLERVAKLGQ--MGEVVKVKDGFARNFLLRRGKALRA
RL9_NITHX       -------------------MEVILLERVAKLGQ--MGDVVKVKHGFARNFLLKRGKALRA
RL9_BRADU       -------------------MEVILLERVNKLGQ--MGEVVKVRDGYARNFLLKRGKALRA
RL9_CAUVC       -------------------MKVILLERVEGTGV--LGDEVTVKDGFARNYLLPRGKALRA
RL9_CAUSK       -------------------MKVILLERVEGTGV--LGDVVTVKDGFARNFLLPRHKALRA
RL9_MARMM       -------------------MKLVLLERVENLGV--IGDVVSVRPGFARNFLLPQGKALRA
RL9_HYPNA       -------------------MQVILLERIDRLGK--IGDEVRVKNGFARNFLIPQGKALIA
RL9_NOVAD       -------------------MQIILLERIEKLGA--IGDEVTVKDGYARNFLLPNKKALRA
RL9_SPHWW       -------------------MDVILLERVEKLGQ--IGDVVSVKAGFARNYLLPRKKALRA
RL9_ZYMMO       -------------------MDVILLERIEKLGH--IGDVVAVKNGYARNFLLPRKKALRA
RL9_SPHAL       -------------------MEIILLERIEKLGG--IGDVVTVKNGFARNYLLPNNKALRA
RL9_MAGMM       -------------------MEVILLEKIGKIGN--LGEVVKVRSGYGRNFLIPQGKALPA
RL9_DESVH       -------------------MKIILRADVENLGR--LGDVVTVKPGFGRNYLLPQGLGMLA
RL9_DESVV       -------------------MKIILRADVENLGR--LGDVVTVKPGFGRNYLLPQGLGMLA
RL9_LAWIP       -------------------MKVILRSDVENLGR--LGDIVTVKSGYGRNYLLPQGLAMLV
RL9_DESAG       -------------------MKVILRADVENLGK--LGDIVEVRPGYGRNFLLPQGMAMAA
RL9_ANADE       -------------------MKLILREDVENLGK--GGDLVDVKPGYGRNYLLPRGLAVSA
RL9_ANADF       -------------------MKLILREDVENLGK--GGELVDVKPGYGRNFLLPRGLAVLA
RL9_MYXXD       -------------------MKVILREDIENLGK--SGELVTVKDGFGRNFLLPRKKAVLA
RL9_SOLUE       -------------------MEVILREDIENLGT--RGQLVKVAPGYARNFLLPKRMAVAA
RL9_KORVE       -------------------MEVILKQDVEKLGH--QGDVVKVAEGYGRNYLLPKKLAIEA
RL9_GEOMG       -------------------MKVILKENLENLGH--IGDIVKVAPGYARNYLLPRGYATEA
RL9_GEOSL       -------------------MKVILKENVENLGH--IGDIVKVAPGYARNYLIPRNFAIEA
RL9_GEOUR       -------------------MKVILKENIENLGH--IGDIVKVAPGYARNYLLPKGFALEA
RL9_PELPD       -------------------MKVILKENIDTLGH--IGDIVKVAPGYARNYLLPKGLAVEA
RL9_PELCD       -------------------MDIILMENVDGLGQ--IGDLVKVKPGYARNFLIPQKFAVEA
RL9_SYNAS       -------------------MKIILKENFETLGK--AGEIVKVADGYARNFLIPKGIAAEA
RL9_SYNFM       -------------------MKVILTENLSSLGQ--IGQVVNVAPGYARNYLFPQGLALEA
RL9_LEPBL       -------------------MRVILQKDVINLGD--AGDLREVADGYARNFLFPKRLAVRA
RL9_LEPBJ       -------------------MRVILQKDVINLGD--AGDLREVADGYARNFLFPKRLAVRA
RL9_LEPIC       -------------------MRVILQKDVINLGD--AGDLKEVADGYARNFLFPKRLAVRA
RL9_LEPIN       -------------------MRVILQKDVINLGD--AGDLKEVADGYARNFLFPKRLAVRA
RL9_BDEBA       -------------------MKVILQKDVKDVGR--VGELVNVSEGFARNFLFPRKLAAEA
RL9_THET8       -------------------MKVILLEPLENLGD--VGQVVDVKPGYARNYLLPRGLAVLA
RL9_THETH       -------------------MKVILLEPLENLGD--VGQVVDVKPGYARNYLLPRGLAVLA
RL9_THET2       -------------------MKVILLEPLENLGD--VGQVVDVKPGYARNYLLPRGLAVLA
RL9_DEIRA       -------------------MQVILLEP-SRLGK--TGEVVSVKDGYARNWLIPQGLAVSA
RL9_DEIGD       -------------------MQVILLEP-GRLGK--TGDVVNVKPGYARNWLIPQGIAAPA
RL9_CHLCV       -----------------MKQQLLLLEDVDGLGR--SGDIVTARPGYVRNYLMPQKKAVIA
RL9_CHLAB       -----------------MKQQLLLLEDVEGLGR--SGDIVTARPGYVRNYLLPKQKAVIA
RL9_CHLFF       -----------------MKQQLLLLEDVDGLGR--SGDIVTARPGYVRNYLLPQKKAIIA
RL9_CHLPN       -----------------MKQQLLLLEDVDGLGR--SGDLITARPGYVRNYLIPKKKAVIA
RL9_CHLTR       -----------------MKPQLLLLEDVDGLGR--SGDLVVAKPGYVRNYLLPKGKAVVA
RL9_CHLTA       -----------------MKPQLLLLEDVDGLGR--SGDLVVAKPGYVRNYLLPKGKAVVA
RL9_CHLMU       -----------------MKPQLLLLEDVDGLGR--SGDLVVAKPGYVRNYLLPKGKAVVA
RL9_PARUW       ------------------MAQLLLIKDVEALGR--SGEIVNVKPGFARNFLLPQSLAVIA
RL9_CHLAA       -------------------MKVLLLQDVEHLGK--AGEIKDVSGGFGRNYLLPKGFAVLA
RL9_CHLPM       -------------------MKVILRKDVAALGD--AGEVVAVKNGYANNFLIPQGMATRA
RL9_PELLD       -------------------MKVILRKDVAALGD--AGEVVAVKNGYANNYLIPQGMATRA
RL9_CHLPD       -------------------MKVILRKDVAALGD--AGEVVAVKNGYANNYLIPQGMAIRA
RL9_CHLTE       -------------------MKIILRKDVATLGD--AGEVVTVKNGYANNYLIPQGYAIRA
RL9_CHLCH       -------------------MKVILRKDVATLGD--AGDVVIVKNGYANNYLIPQSIAIRA
RL9_AQUAE       -------------------MKVVLVKDVEGLGF--FGDVVNVKDGYAMNYLIPRGLALPA
RL9_PORGI       -------------------MQVILKEDVVNLGY--KDDIVTVKDGYGRNFLIPQGKAVIA
RL9_PARD8       -------------------MQVILKEDVVNLGY--KDDIVTVKDGYGRNFLIPTGKAVIA
RL9_BACFN       -------------------MEIILKEDVVNLGY--KNDIVTVKSGYGRNYLIPTGKAVIA
RL9_BACFR       -------------------MEIILKEDVVNLGY--KNDIVTVKSGYGRNYLIPTGKAVIA
RL9_BACTN       -------------------MEIILKEDIVNLGY--KNDIVNVKSGYGRNYLIPTGKAIIA
RL9_BACV8       -------------------MEIILKEDVVNLGY--KNDIVTVKSGYGRNYLIPTGKAVIA
RL9_CYTH3       -------------------MEVILKEDIKGLGY--KNDLVQVKAGYGNNFLIPRGYAINA
RL9_FLAJ1       -------------------MEIILKQDVQNLGF--KDDVVSVKPGYGRNFLIPQGFATLA
RL9_FLAPJ       -------------------MELILKQDVQNLGF--KDDIVSVKAGYGRNYLIPQGFAHMA
RL9_GRAFK       -------------------MEVILKKDVDNLGF--KDDLVAVKNGYGRNYLIPHGFAELA
RL9_THEEB       ---------------MAKRVQVVLNETVNKLGR--MGQVVEVAPGYARNYLFPRGIAEPA
RL9_SYNEL       ---------------MAKRVQVVLNETVNKLGR--MGQVVEVAPGYARNYLFPRGIAEPA
RL9_ACAM1       ---------------MGKRVQLVLNEDVRKLGY--SGDLVEVAPGYARNYLIPKGIAYRA
RL9_SYNP6       ---------------MAKRVQVVLSQDVYKLGR--DGDLVEVAPGYARNFLLPQGLAQPV
RL9_SYNE7       ---------------MAKRVQVVLSQDVYKLGR--DGDLVEVAPGYARNFLLPQGLAQPV
RL9_SYNY3       ---------------MAKRVKVVLNETINKLGF--TGDLVEVAPGYARNYLIPKGLGVVA
RL9_TRIV2       ---------------MVKRVQLVLTKDVSKLGR--SGDLVDVAPGYARNYLIPQSLATHA
RL9_NOSS1       ---------------MVKRVQLVLTKDVSKLGR--SGDLVDVAPGYARNYLIPQSLATHA
RL9_TRIEI       ---------------MAKKLQVVLNKDVNKLGK--SGDVVDVAPGYARNYLIPNKIAFRT
RL9_MICAN       ---------------MAKRMQVILNQKVSKLGE--NGDVVEVAPGYARNYLIPQGVAVLA
RL9_SYNPW       ---------------MAKRVQVVLNEDVLSLGR--DGDMVEVAPGYARNFLLPYGKAVPV
RL9_SYNS3       ---------------MAKRVQVVLNEDILSLGR--NGDLVDVAPGYARNFLLPFGKAVPV
RL9_SYNPX       ---------------MPKRVQVVLNEDVLSLGK--DGDLVEVAPGYARNFLLPFGKAVPV
RL9_SYNSC       ---------------MPKRVQIVLNEDILSLGM--DGDLVEVAPGYARNFLLPFGKAVPL
RL9_SYNS9       ---------------MPKRVQVVLNEDILSLGK--DGDLVDVAPGYARNFLLPFGKAVPV
RL9_PROMM       ---------------MAKRVQVVLNEDVLSLGK--DGDLVEVAPGYARNFLLPFGKAVPV
RL9_PROM3       ---------------MAKRVQVVLNEDVLSLGK--DGDLVEVAPGYARNFLLPFGKAVPV
RL9_SYNR3       ---------------MAKRVQVVLSEDILSLGK--DGDLVEVAPGYARNFLLPHGKALPV
RL9_PROMT       ---------------MAKRVQVVLNEDIKSLGN--DGDLVEVAPGFARNFLLPNKKALPV
RL9_PROM1       ---------------MAKRVQVVLNEDIKSLGN--DGDLVEVAPGFARNFLLPNKKALPV
RL9_PROMA       ---------------MAKRVKVVLKEDILSLGK--DGDVVEVAPGYARNFLLSQQKALAV
RL9_PROM0       ---------------MAKRVQVALTESIASLGK--EGDLVEVAPGYARNFLLPYGKAMNV
RL9_PROM2       ---------------MAKRVQLALTESIASLGK--EGDLVEVAPGYARNFLLPYGKAMNV
RL9_PROM9       ---------------MAKRVKVALTESIASLGK--EGDLVEVAPGYARNFLLPYGKAMNV
RL9_PROMS       ---------------MAKRVQVALTESIASLGK--EGDLVDVAPGYARNFLLPYGKAMNV
RL9_PROMP       ---------------MAKRVKVVLTESVATLGR--DGDVVEVAPGYARNFLLPFGKAANV
RL9_PROM5       ---------------MAKRVKVVLTESIATLGR--DGDVVEVAPGYARNYLLPFGKASNV
RL9_SYNJB       -------------------MQVVLRQAIPGLGK--PGEIVNVKPGYARNYLFPRQMAVRV
RL9_SYNJA       ---------------MAKDVQVMLRQAVPGLGK--PGEVVSVRPGYARNYLFPRQMAVRL
RL9_GLOVI       -----------------MGTKIVLKKDVDTLGK--AGTLVEVAPGYARNYLIPQGLAVKA
RL9_SALRD       -------------------MQIILLNDVDHLGE--KGEVHEVADGYGRNYLIPQGLARVA
RK9_PYRYE       --------------MSKKVINVVLKENIQKLGK--SNDVIKVASGYARNFLIPNKMAAVA
RK9_PORPU       --------------MSKKIIQVVLKENIQKLGK--SNDVVKVATGYARNFLIPNKMASVA
RK9_GRATL       ---------------MKNKITVILKKNLANLGS--IGTVVKVSSGYAFNYLIPRDFAQLA
RL9_UREPA       -------------------MKVILLEDIASLGK--KNEIIDVSDGYAKNFLIRQKKAVAL
RL9_UREP2       -------------------MKVILLEDIASLGK--KNEIIDVSDGYAKNFLIRQKKAVAL
RL9_MYCGE       -------------------MKIILKQDVAKLGK--RFDVVEVKDGFAIHFLFPKKLAAPL
RL9_MYCPN       -------------------MKVILKQDVSNLGK--RFDVVDVKDGYAIHFLFPKKLAAPL
RL9_MYCGA       -------------------MKVILLKDVPSLGK--ADSVVNVANGYAKNFLFKNKLAEPY
RL9_MYCPU       -------------------MKLILIKD-CPSGK--ANTIVEVSDGYAKNFLIPRKFAIAY
RL9_MYCMO       -------------------MKVILIKD-SNAGK--KNQIVEVSAGYATNFLFRQNLAIPY
RL9_MYCS5       -------------------MKVILTKD-SKYGK--ENAIIEVADGYAKNFLIPKGFAMAY
RL9_MYCH7       -------------------MKVILIKD-TKDGK--ANTIIDVSPGYATNFLFKNKLAEPL
RL9_MYCH2       -------------------MKVILIKD-TKDGK--ANTIIDVSPGYATNFLFKNKLAEPL
RL9_MYCHJ       -------------------MKVILIKD-TKDGK--ANTIIDVSPGYATNFLFKNKLAEPL
RL9_MYCCT       -------------------MKVIFLKDVPGQGK--KNEIKEVSDGYARNYLLPNQLVKIA
RL9_MYCMS       -------------------MKVIFLKDVPNQGK--KNEIKEVSDGYARNYLLPNQLVKIA
RL9_MESFL       -------------------MKVIFLQDVKGQGK--KDEIKEISDGYARNFLIPKGLVKLA
                                     : :       .            *:    :         

RL9_CAMC5       TPDV--IRQYEAAQKRKEEELKYEISNLEKLKDELSKI-----TLVIKKTLGAN----GS
RL9_CAMC1       TPDV--LRQYEAAQKRKAEELKYEIANLEKLKEELAKV-----TVVVKKTLGAN----GS
RL9_CAMFF       TDAV--LKQYEAAKKRAQEEINYEINQNEKLKAELENI-----KIIIKTKLGAN----GA
RL9_CAMJE       TNEV--LRKYESDKKKEAENLRFEIANLEKLKEELSKI-----TLEISKPVGAN----GS
RL9_CAMJR       TNEV--LRKYESDKKKEAENLRFEIANLEKLKEELSKI-----TLEISKPVGAN----GS
RL9_CAMJD       TNEV--LRKYESDKKKEAENLRFEIANLEKLKEELSKI-----TLEISKPVGAN----GS
RL9_CAMJJ       TNEV--LKKYESDKKKEAENLRFEIANLEKLKEELSKI-----TLEISKPVGAN----GS
RL9_CAMJ8       TNEV--LRKYESDKKKEAENLRFEIANLEKLKEELSKI-----TLEISKPVGAN----GS
RL9_CAMHC       TTEV--LRRYESQKQKEAEDERYEIESLKTLSNTLKGV-----RVKIAKQVGSN----NA
RL9_SULDN       TAEI--LAQHKEDERIAAENLAKEIVSLKDLATKLDKA-----EIVITKKLGQN----GH
RL9_NITSB       TPDV--IEAWKKEQAKKAQEEAAEIEKLKQLKEKIEST-----KLVIKHKAGAN----GA
RL9_ARCB4       TTDV--LNKHKAEQKKLALKEEQEIAQAKELAEKLNAT-----KLTIKHKVGAN----GH
RL9_SULNB       TPDV--VENWKAEQARQEKELKEEIERFEAEKKMLEAH-----TIRIEKQS-AP----VG
RL9_HELPY       TNEV--INKYKAEVKKKAEKEALEKAQKLQMVETLQTI-----TLTIHKKVGAN----GS
RL9_HELPJ       TNEV--INKYKAEVKKKAEKEALEKAQKLQMVETLQTI-----TLTIHKKVGAN----GS
RL9_HELPH       TNEV--INKYKAEAKKKAEKEALEKAQKLQMVETLQTI-----TLTIHKKVGAN----GS
RL9_HELAH       TNEV--INKYKAEVKKKAETEALEKAQKLQMAETLQTV-----TLTIHKKVGAN----GS
RL9_HELHP       TNEV--INKYKAQQRKAEELAALEKAEMQQMKKTIESL-----TLTLHKKVGAN----DT
RL9_WOLSU       TNEV--INRWKAEQKRRAEKEAQELERLKNVAKELASV-----TLKIVQKVGAN----GS
RL9_FERNB       TPEV--LKQLEKEKEEEKKRLEALKRESENLLSELHKH-----VFKIKAKAGDG----GK
RL9_THEM4       TPRV--LKRLEAEKRKKEEEKIQIKTQNEELLKMLKKF-----LYKIPVKAGES----GK
RL9_THEMA       TEGL--ERAIKHEKEIEKRKKEREREESEKILKELKKR-----THVVKVKAGEG----GK
RL9_THEP1       TEGL--ERAIKHEKEIEKRKKEREREESEKILKELKKR-----THVVKVKAGEG----GK
RL9_PSELT       TEGE--IKRIRNEKILKEHKEDLTKKKSEEILKTLQKQ-----IHKVPAKVGGG----GK
RL9_PETMO       TGGY--IKHIEESKKIEDKKKENLRKRSEEILEKLKGT-----KIEIKAKAGEK----GK
RL9_FUSNN       TPEE--LQKIENRKKKEAKKQEEERNKSLELKKLLESK-----VLDIPVKAGEN----GK
RL9_BACHD       TSAN--MKNLNAKKKSEEKKKEEELQEAKAYQTELE-----ALTLELKAKSGEG----GR
RL9_BACSK       TSGN--IKDLEAQEKSKQKKAEAELQKAKAMKEELE-----ALKIEIPAKAGEG----GR
RL9_GEOTN       TPAN--LKALEAQKQKEQRQAAEELANAKKLKEQLE-----KLTVEIAAKAGEG----GR
RL9_GEOSE       TPAN--LKALEAQKQKEQRQAAEELANAKKLKEQLE-----KLTVTIPAKAGEG----GR
RL9_GEOKA       TPAN--IKALEAQKQKEQRQAAEELANAKKLKEELE-----KLTVEIPAKAGEG----GR
RL9_BACCZ       TNSS--MKTLEAQKRKEEKDAAAELESAKQLKETLE-----KLTVELKAKSGEG----GR
RL9_BACAH       TNSS--MKTLEAQKRKEEKDAAAELESAKQLKETLE-----KLTVELKAKSGEG----GR
RL9_BACAN       TNSS--MKTLEAQKRKEEKDAAAELESAKQLKETLE-----KLTVELKAKSGEG----GR
RL9_BACHK       TNSS--MKTLEAQKRKEEKDAAAELESAKQLKETLE-----KLTVELKAKSGEG----GR
RL9_BACC1       TNSS--MKTLEAQKRKEEKDAAAELENAKQLKETLE-----KLTVELKAKSGEG----GR
RL9_BACCR       TNSS--MKTLEAQKRKEEKDAAAELENAKELKETLE-----KLTVELKAKSGEG----GR
RL9_BACCN       NNSN--MKTLEAQKRKEEKEAAAELENAKKLKETLE-----KLTVELKAKSGEG----GR
RL9_BACVZ       NATN--ISALKGQKEKEKKEAIAELERAKDLKETLE-----QLTVELSAKSGEG----GR
RL9_BACSU       NASN--ISALNGQKQKEKKEAIAELEQAKSLKETLE-----KLTVELSAKSGEG----GR
RL9_BACP2       NPTN--LSALEGQKNKEKKNAVQELEQAKQLKETLE-----ALTVELTAKSGEG----GR
RL9_BACLD       TSAN--ISALEGQKKKEKKEAAEELKSAKELKKQLE-----EITVELSAKSGEG----GR
RL9_LISIN       SNAA--LSTLSAQKKKEDKLAAEELAEAKALKEKME-----KLTVELKAKSGEG----GR
RL9_LISW6       SNAA--LSTLSAQKKKEDKLAAEELAEAKALKEKME-----KLTVELKAKSGEG----GR
RL9_LISMO       NNAA--LSTLSAQKKKEDKLAAEELAEAKALKEKME-----NLTVELKAKSGEG----GR
RL9_LISMF       NNAA--LSTLSAQKKKEDKLAAEELAEAKALKEKME-----NLTVELKAKSGEG----GR
RL9_STAAW       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAE       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAC       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAR       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAS       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAA3       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAT       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAA1       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAM       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAA2       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAA9       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAN       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAA8       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAAB       TPGN--LKQLELQKKRAKQERQQEIEDAKALKETLS-----NIEVEVSAKTGEG----GK
RL9_STAS1       TPGN--LRQLEQKNKAAEAERQQEIEDAKKLKEQLS-----EIEVEVSAKTGEG----GK
RL9_STAEQ       TPGN--LKQLEQQNKRAEADRQQEIDDAKALKEQLK-----DIEVEVSAKTGEG----GK
RL9_STAES       TPGN--LKQLEQQNKRAEADRQQEIDDAKALKEQLK-----DIEVEVSAKTGEG----GK
RL9_STAHJ       TPGN--LKQLEQQNKRAEADRQKEIDDAKALKSKLE-----EIEVEVSAKTGEG----GK
RL9_OCEIH       TSGN--MKALEAKKQKADQLEQKEKEDAINLKDKLA-----EIAVELEAKSGDN----GR
RL9_LACBA       NQSA--MSQLNAERKAEQRREAEELAEAKDLQKRLEDD---KTVVEIVAKAGED----SR
RL9_LACPL       TKAA--INTLKAEQKSEAARAAEELAEAKQVKTVLEAD---ETVVELKAKAGTD----GR
RL9_ENTFA       NKGS--MSALAGQKKAQEKHEAEVLAQAKEMQAFLEDE---KTVVEIKAKAGED----SR
RL9_PEDPA       TSAA--VSELKGQKKAEAKHEAEILADAEKLKTVLEND---KTVVEIKAKAGKD----GR
RL9_LACSS       TTAA--VSALKGQQHAEAKNAAAELAEAKVLKTKIEDD---KTIVEVKSKAGED----SR
RL9_LACRD       TKAA--MSQLKGQQRAEEKHAAEELADAKRMKKILEDD---NTVVELSGKAGTD----GR
RL9_LACS1       NAQA--MSQLKGQKRAEARKEAEELEEAKKFKELLESG---ERVVEMKAKAGTD----GR
RL9_LACP3       TPQA--MSALRGQQRLEEKKEAEKKTEAEAMKAKIEDD---KTVVQIQSKAGED----SR
RL9_LACAC       TKGN--MNTLKRVEANEKAAYEAEKAEAERIKAELEKD---DTIVEFKSKAGND----SR
RL9_LACH4       TKGN--MNTLKRVEANEKAAYEAEKAEAEKIKAELEKD---DTIVNFKSKAGTD----SR
RL9_LACJO       TSSN--LNTLKRVQKAEKDAYEAEKAAAEDIKKKLEDD---KTIVNFKSKAGTD----SR
RL9_LACDA       NKGN--LNTLKRVEANEKAEYEAQKAAAQEIKKQLEAD---ETVVELKAKAGSD----SR
RL9_LACDB       NKCN--LNTLKRVEANEKAEYEAQKAAAQEIKKQLEAD---ETVVELKAKAGSD----SR
RL9_STRT2       TKQA--IGELKGKQKSEEKHAAELLAEAKRVKEQLEKE---ENRLQFTEKVGPD----GR
RL9_STRT1       TKQA--IGELKGKQKSEEKHAAELLAEAKRVKEQLEKE---ENRLQFTEKVGPD----GR
RL9_STRTD       TKQA--IGELKGKQKSEEKHAAELLAEAKRVKEQLEKE---ENRLQFTEKVGPD----GR
RL9_STRA5       TTQA--IGELKGKQKSEEKAQAEILAQAKELKTQLESE---TTRVQFIEKVGPD----GR
RL9_STRA3       TTQA--IGELKGKQKSEEKAQAEILAQAKELKTQLESE---TTRVQFIEKVGPD----GR
RL9_STRA1       TTQA--IGELKGKQKSEEKAQAEILAQAQELKTQLESE---TTRVQFIEKVGPD----GR
RL9_STRPD       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRPM       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRPF       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRP3       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRPC       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRP1       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRPB       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRPG       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRP8       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRP6       TSQS--IGELKGKQKAEEKAQAEILAEAQAVKAVLDED---KTRVQFQEKVGPD----GR
RL9_STRMU       TKQA--INELKGKQKSEEKAQAELLAEAKAVKVKLEQE---STLVQFSEKVGPD----GR
RL9_STRP2       TAQA--VGELRGKQKSEEKAHAEMIAEGKAIKAQLEAE---ETVVEFVEKVGPD----GR
RL9_STRR6       TAQA--VGELRGKQKSEEKAHAEMIAEGKAIKAQLEAE---ETVVEFVEKVGPD----GR
RL9_STRPN       TAQA--VGELRGKQKSEEKAHAEMIAEGKAIKAQLEAE---ETVVEFVEKVGPD----GR
RL9_STRGC       TAQA--IGELRGKQKSEEKAHAELVAEAQAIQAKLAEE---ATLVEFTEKVGPD----GR
RL9_STRSV       TAQA--IGELRGKQKSEEKAHAELVAEAQSIKAKLAEE---ATLVEFTEKVGPD----GR
RL9_LACLS       TAAA--LSEVKGQAKAKEKEEAELLAEAKALKEVLEKD---ETVVEIKMKVGQT----GH
RL9_LACLM       TAAA--LSEVKGQAKAKEKEEAEFLAEAKALKEVLEKD---ETVVEIKMKVGQT----GH
RL9_LACLA       TAAA--LSEVKGQAKAKEKEEAELLAEAKALKEVLEKE---DTVVEIKMKVGQT----GH
RL9_LEUMM       TGKN--LGAVKGRQKAEEKAAAEELAEARKLADFFANE---KTVVELTGKSGTD----GR
RL9_OENOB       SPEN--ISKLNGQQNLEAKKAAEILEEAKQLKNKLAST---KTIVQFSEHVGPD----GR
RL9_ALKOO       TQGN--VKTLNEQKTSQELKKQQEVEEAKELAKKIE-----NSPIEIIAKAGDG----GR
RL9_ALKMQ       TEGS--LQTLKEQKTAQKMKKDQEVDKAKELAERLS-----KVDVNIKAKAGEG----GR
RL9_CLOD6       DSVA--IKELNEKNKSKEIKAQKEYEEAVLLGKQME-----EINIEIYSKAGEG----GR
RL9_CALS4       TESN--LKMLNEKKKAEERKRQQELEQAKELAQKLS-----KVGVTLKVKAGEN----GK
RL9_HUNT2       TAAN--INIMQTKKEAEKNRKERELAQAKELAEKLK-----GIVVTLKAKAGEN----GK
RL9_CLOTE       KESN--LNLLNNKKEAERKQKLAELEEAQKLAEELK-----NQELILKVKSGDN----GK
RL9_CLOK5       NKTN--LHIWNNKKEAERKQKLAEIEAAQKLAAELK-----GKEINLTVKSGEN----GR
RL9_CLOAB       NNSN--MRVLNLKKDAERKQKLQETEEAQKLANELK-----GKVLKLSAKAGEN----GR
RL9_CLONN       TDSN--MHILNRQKEAERKKKLEETEAAQALAESLR-----NKELKMIGKAGEN----GR
RL9_CLOPE       TDNN--LHILNNKKENERRQKLAELEAAQALAADLK-----DKVIKIDGKAGDN----GK
RL9_CLOP1       TDNN--LHILNNKKENERRQKLAELEAAQALAADLK-----DKVIKIDGKAGDN----GK
RL9_CLOPS       TDNN--LHILNNKKENERRQKLAELEAAQALAADLK-----DKVIKIDGKAGDN----GK
RL9_CLOB8       SDAN--MHILNNKKENERKQKLAELEAAQKLAEELK-----GKEIKIKAKTGEN----GK
RL9_CLOB1       TENN--VHILNNKKEAERRQKLKELEEAQKLAKSLM-----GKEIKFKVKIGEN----GR
RL9_CLOBH       TENN--VHILNNKKEAERRQKLKELEEAQKLAKSLM-----GKEIKFKVKIGEN----GR
RL9_CLOBL       TENN--VHILNNKKEAERRQKLKELEEAQKLAKSLM-----GKEIKFKVKIGEN----GR
RL9_CARHZ       TEGK--LKELQQQKEAANRRKEKELQEARSLAEKLK-----NIELVLYGKGGEN----GK
RL9_DESHY       TSGN--LNDLASKKANEEKKKEQEKQEAQTLAAKLS-----SLSIEIHTKSGEG----GR
RL9_LACP7       TPKN--LNDLKLQKAAEAKLAQEILEQAQALAKEIE-----SKSILLKIKSGEG----GR
RL9_DESRM       TESK--LKELKTQKQTQAAKKQKEEAEAKALAAKIN-----GLTVALKVKVGDA----GR
RL9_DEHMB       SAAV--KSEIAAKQAAEERRKAKAEAEMVELAKNLD-----GAKVNLKAKTGAK----DK
RL9_DEHMC       SAAV--KSEIAAKQAAEERRKAKAEAEMVELAKNLD-----GAKVNLKAKTGAK----DK
RL9_DEHM1       SASV--TSEIAAKQAAEDRRKAKAEAEMAQLAKELD-----GTNVSIKAKTGAK----DK
RL9_CALS8       TEGL--EKHIKEKKEAEQKKKEKELMLAKDLADKLE-----KSQVIIKAKAGEN----GK
RL9_MOOTA       TAGR--LKELDLEKKRREKKENQELENARRQAARLD-----GAVVKITTRAGET----GK
RL9_PELTS       TKGR--MKALGDRQKVLAMKEKKAEEEARALAARLK-----GVTVVVRAKTGEG----GR
RL9_SYMTH       SEGA--LRSIEAERKAQQEKQQRQVAELSALRDRLD-----GQTIQLRAKCGEG----GR
RL9_STRAW       TKGG--EKDVEQIRRARKIHEIQTIEQANEIKARLEGV----KVRLAVRSGD-A----GR
RL9_STRCO       TKGG--EKDVEQIRRARKIHEIQTIEQANQVKAQLEGV----KVRLAVRSGD-A----GR
RL9_ACIC1       SPGA--VKQVALIKRAREVREIRDLDQARALRDQLEAL----PVTLPARAGS-G----GR
RL9_KINRD       TKGG--EKQVETISKARKARAIASLDEAKAVKQSLEAR----TVAFAARAGR-G----GR
RL9_FRACC       TKGA--ERQVEQIKRARSARAVRDLGHAQEIAGQLGGL----KVELTSRAGK-E----GR
RL9_FRAAA       TKGA--ERQVEQIKRARSARAVRDLGHAQEIAGQLGGL----KVELISRAGK-E----GR
RL9_SALTO       TKGA--EKQVTVIKRARSAREIRDLGHANEVKGQLEGL----KVALKARAGE-G----GR
RL9_SALAI       TKGA--EKQVTLIKRARSAREIRDLGHANEVKGQLEGL----KVTLKARAGD-G----GR
RL9_THEFY       TRGA--QKQIDSIRRARAAREIRSLDEAKQIAEQLGSL----KVRLNQRAGD-N----GR
RL9_NOCSJ       TRGG--EKTVDSIKAARASRAVRDHDHAEQIKTKLEAQ----PVAVKVRAGA-G----GR
RL9_CLAMS       SRGG--EKQIEQIKAARAAREHATIEEAQDLKSRLEAK----IVKLTVKAGQ-G----GR
RL9_CLAM3       SRGG--EKQIEQIKAARAAREHATIEEAQDLKSRLEAK----IVKLTVKAGQ-G----GR
RL9_LEIXX       TRGG--KKQVEQIKAARAARELHSMEAAQELKAKLEAT----RVKLVVKAGR-E----GR
RL9_RENSM       TKGG--EKQVESIKAARAAREHASVEAAQAQAAKLSST----PVRLEVKAGD-S----GR
RL9_PAEAT       TKGG--EKQVESIKAARAARAHASVEAAQAQAQALSSK----KVKLEVKAGE-S----GR
RL9_ARTS2       SKGG--EKQVESIKAARVAREHASLEDAQKQAAALSAK----PVKLVVKAGE-T----GR
RL9_MYCGI       TRGA--QRQADDIRRAQELKGVKGLEHARELKTAIEALE---SVELSVKTAGDS----GK
RL9_MYCVP       TRGA--QRQADDIRRAQELKSVKGLEHANELKQAIEGLE---SVELAVKTAADS----GK
RL9_MYCSK       SRGA--QRQADDIRRARELKTVKGLEHANEIKTALEALD---TVELAVNASADT----GK
RL9_MYCSS       SRGA--QRQADDIRRARELKTVKGLEHANEIKTALEALD---TVELAVNASADT----GK
RL9_MYCSJ       SRGA--QRQADDIRRARELKTVKGLEHANEIKTALEALD---TVELAVNASADT----GK
RL9_MYCS2       SRGA--ERQAEEIRRARESKVIRDIEHANELKTALEGLG---DVTLSVNAAGDT----GK
RL9_MYCA1       SRGA--QKQADDIRRARETKAVRDLDHANELKTAIEALG---PVTLPVKTAGDS----GK
RL9_MYCPA       SRGA--QKQADDIRRARETKAVRDLDHANEFKTAIEALG---PVTLPVKTAGDS----GK
RL9_MYCBO       SRGA--QKQADEIRRARETKSVRDLEHANEIKAAIEALG---PIALPVKTSADS----GK
RL9_MYCBP       SRGA--QKQADEIRRARETKSVRDLEHANEIKAAIEALG---PIALPVKTSADS----GK
RL9_MYCTU       SRGA--QKQADEIRRARETKSVRDLEHANEIKAAIEALG---PIALPVKTSADS----GK
RL9_MYCTA       SRGA--QKQADEIRRARETKSVRDLEHANEIKAAIEALG---PIALPVKTSADS----GK
RL9_MYCLE       SRGA--QRQADEIRRARETKAMRDREHANEIKVAIEALG---SVSLPMKTVADS----GK
RL9_MYCUA       SRGA--QKQADEIRRSRETKAVRDREHANEIKTAIQALG---SVALPVKTAADS----GK
RL9_NOCFA       SRGA--QKQVEGIRRAQEARRVRDLDHANELKQAIEGLS---AVSLSVKTAG-T----GK
RL9_RHOJR       TRGA--EKQVEGIRRAQEARAVRGLDHAKELKDAIEGLE---NISLSVKTAGDS----GK
RL9_CORGB       TPGA--EKQIEGIKRAQEAREIRDLDHAREVKAALEALE---GVTIAVRTSE-S----GK
RL9_CORGL       TPGA--EKQIEGIKRAQEAREIRDLDHAREVKVALEALE---GVTIAVRTSE-S----GK
RL9_COREF       TPGA--EKQIEGIKRAQEARAIRDLDHAREVKAQLEALE---GVKVAVRTSE-S----GK
RL9_CORDI       TRGA--EKQIEGIKRAQEAREIRDLDHAREVKAQLEALE---GVSVAVRTSE-K----GK
RL9_CORJK       TRGA--EKQIEGIKRAQEARQIRDLDHAREVKEELENLS---GVTISVRTAE-S----GK
RL9_SACEN       TKGA--QKQVETIRRTQEAKRVRNLEHAQELKQQLQGLG---AVTLTAKVSK-Q----GK
RL9_CUTAK       TRGA--EAQIKDITRARKAKEIKSKEEAEQIRSQLEHL----VVQVTVQVGE-N----GR
RL9_TROW8       TEGA--QKHIGDISAARRAREAAALQEARDIANTLTKEAVTRELRLAANAGE-D----GR
RL9_TROWT       TEGA--QKHIGDISAARRAREAAALQEARDIANTLAKEAVTRELRLAANAGE-D----GR
RL9_BIFAA       SKGA--AAQIEAMKRARLAKAVATREEAVAAKEIIEGS----TVEIAAKVSE-S----GK
RL9_BIFLO       TKGA--EAQIVAMKRARLAKAVATREDAVAAKAAIEGT----TVEIAAKVSE-S----GK
RL9_BORBP       NKHN--VEIFNQKKRSILKKQETKKQIANDLKSKLDLVK----LEFFMKSND-S----GK
RL9_BORAP       NKHN--VEIFNQKRRSILKKQETKKQIANDLKSKLDLVK----LEFFMKSND-S----GK
RL9_BORBU       NKHN--IEIFNQKRRSILKKQEAKKQMANDLKSKLDLVK----LEFFMKSND-S----GK
RL9_TREDE       NEFT--LAHFESRKEEIEAKKAAKRQDAAGLKEKLEALS----IKILMPAGP-N----GK
RL9_TREPA       NRFT--VARFKQRQQDIEMRKSLKRQDAANLKARLEAQP----VVIAMPAGT-N----GK
RL9_VIBVY       TKGN--VEMFEARRAELEAKVAEQLASAEARAEKVNALE----AVVIASKAGDE----GK
RL9_VIBVU       TKGN--VEMFEARRAELEAKVAEQLASAEARAEKVNALE----AVVIASKAGDE----GK
RL9_VIBCB       TKGN--VEMFEARRAELEAKVAEQLAAAEARAEKVNALE----AVVLASKAGDE----GK
RL9_VIBPA       TKGN--VEMFEARRAELEAKVAEQLAAAEARAEKVNALE----AVVIASKAGDE----GK
RL9_VIBC3       TKAN--VAMFESRRAELEAKVAEQLAAAQTRADQVNALE----AVVIASKAGDE----GK
RL9_VIBCH       TKAN--VAMFESRRAELEAKVAEQLAAAQTRADQVNALE----AVVIASKAGDE----GK
RL9_PHOPR       TKAN--VEMFETRRAELEAKVAEQRAASEARAEKLSALD----AVVIASKAGDE----GK
RL9_ALIF1       TKAN--VEMFETRRAELEANVAKQLAAAEARAEKVNALE-----VTIASKSGDE----GK
RL9_IDILO       TKSN--VDLFEQRRAEYEAKLADQLAAAQARAEKVNALD----AVTIASKAGDE----GK
RL9_SHEB9       NESN--VKVFEARRAELEAKLAAELAAANLRAEKITALE----AVVIASKAGDE----GK
RL9_SHEB8       NESN--VKVFEARRAELEAKLAAELAAANLRAEKITALE----AVVIASKAGDE----GK
RL9_SHEB5       NESN--VKVFEARRAELEAKLAAELAAANLRAEKITALE----AVVIASKAGDE----GK
RL9_SHESM       NESN--VKVFEARRAELEAKLAADLAAANQRAEKIAALE----AVVIASKAGDE----GK
RL9_SHESA       NESN--VKVFEARRAELEAKLAADLAAANQRAEKIAALE----AVVIASKAGDE----GK
RL9_SHESR       NESN--VKVFEARRAELEAKLAADLAAANQRAEKIAALE----AVVIASKAGDE----GK
RL9_SHESW       NESN--VKVFEARRAELEAKLAAELAAANQRAEKITALE----AVVIASKAGDE----GK
RL9_SHEPC       NESN--VKVFEARRAELEAKLAAELAAANQRAEKITALE----AVVIASKAGDE----GK
RL9_SHEON       NESN--VKVFEARRAELEAKLAADLAAANQRAEKIAALE----AVVIASKAGDE----GK
RL9_SHEAM       NAEN--VKVFEARRAELEAKLAADLAAAADRAEKIAALE----AVVIASKAGDE----GK
RL9_SHEDO       NAAN--VEVFEARRAELEAKLAAELATATARAEKLAALE----AVVIASKAGDE----GK
RL9_SHEFN       NAAN--TEVFEARRAELEAKLAAELATATARADKLTALE----AVVIASKAGDE----GK
RL9_SHELP       NAAN--TEVFEARRAELEAKLAAELATATERAEKLAALE----AVVIASKAGDE----GK
RL9_SHEHH       NAAN--TEVFEARRADLEAKLAADLAAATQRAEKISALE----SVVIASKAGDE----GK
RL9_SHEPA       NTAN--TEVFEARRADLEAKLAADLAAATQRAEKISALE----SVVIASKAGDE----GK
RL9_SHESH       NTAN--TEVFEARRAELEAKLVADLTAANERAEKINALE----SIVIASKAGDE----GK
RL9_PSEHT       TKAN--IETFDARRAELEAKIADQLVAAQARADKLEALA----EVTLVSKAGDE----GK
RL9_PSEA6       TKAN--VEKFEARRAELEAKIAEQLAAAEARAAKVAELA----EVTIASPAGDE----GK
RL9_COLP3       SEAN--VEHFEARRADIEAKLADVLATAEARAAKVVALA----EVTIASKSGDE----GK
RL9_PSYIN       NKAN--LEAFETRRVELEAKQAANLAAAEKRGAALAALE----AVVIASKAGDV----GK
RL9_AERS4       TKAN--IETFDARRAELEAKLAAGKAAAEERAAKLGELA----AVVIASKAGDE----GK
RL9_AERHH       TKAN--IETFDARRAELEAKLAAGKAAAEERAAKLGELA----AVVIASKSGDE----GK
RL9_ECOK1       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECOL6       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECO57       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECOLI       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SHIF8       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SHISS       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SHIFL       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECOHS       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECOLC       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECOL5       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECOUT       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_ECO24       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SHIBS       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SHIDS       TKKN--IEFFEARRAELEAKLAEVLAAANARAEKIDALE----TVTIASKAGDE----GK
RL9_SALTY       TKKN--VEYFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SALPB       TKKN--VEYFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SALAR       TKKN--VEYFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SALPA       TKKN--VEYFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SALCH       TKKN--VEYFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_SALTI       TKKN--VEYFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_CITK8       TKKN--VEFFEARRAELEAKLADVLAAANARAEKINALE----TVTIASKAGDE----GK
RL9_CROS8       TKKN--VEFFEARRAELEAKLADVLAAAEARAEKINALG----SVTIASKAGDE----GK
RL9_ENT38       TKKN--VEFFEARRAELEAKLADVLAAANARAEAINALG----TVTIASKSGDE----GK
RL9_KLEP7       TKKN--VEFFEARRAELEAKLADVLAAAEARAEQINALE----SVTIASKAGDE----GK
RL9_YERPA       TKKN--VEFFEARRAELEAKLADVLAAAEARATKINELV----SVTISSKAGDE----GK
RL9_YERPN       TKKN--VEFFEARRAELEAKLADVLAAAEARATKINELV----SVTISSKAGDE----GK
RL9_YERPS       TKKN--VEFFEARRAELEAKLADVLAAAEARATKINELV----SVTISSKAGDE----GK
RL9_YERPP       TKKN--VEFFEARRAELEAKLADVLAAAEARATKINELV----SVTISSKAGDE----GK
RL9_YERPE       TKKN--VEFFEARRAELEAKLADVLAAAEARATKINELV----SVTISSKAGDE----GK
RL9_YERP3       TKKN--VEFFEARRAELEAKLADVLAAAEARATKINELV----SVTISSKAGDE----GK
RL9_YERE8       TKKN--VEFFEARRAELEAKLAGVLAAAEARATKINELV----SVTIASKAGDE----GK
RL9_PECAS       TKKN--VEFFEARRAELEAKLADVLTAAEARATKIKELG----SVTIASKAGDE----GK
RL9_SERP5       TKKN--VEFFEVRRAELEAKLAEILTAAEARATKINELG----SVTIASKSGDE----GK
RL9_PHOLL       TKKN--IEFFEARRAELEANLANVLATAEARAEKINALG----SVTIASKAGDE----GK
RL9_SODGM       TKKN--VEYFEERRAELEAKLAETQAAAEARAAKINELG----IVTIPSKAGDE----GK
RL9_BAUCH       TRKN--VEYFEKCRVELVAKLANIKSAAEARANKINELG----SITILSKAGEE----GK
RL9_ACTP2       TAAN--IAHFEARRAELEAKAAEALAAAQARAAKIAEIA----VVSVSATAGDD----GR
RL9_HAEDU       TAAN--IAHFEARRAELEAKAAAVLSAAKERAAKIAAIG----AVSVSATAGDD----GR
RL9_ACTSZ       TKAN--IEFFEARRAEFEAKAATELAEAQARAEKIAALE----SVTIVSKAGEE----GR
RL9_MANSM       TKAN--IEHFEARRAEIEAKVAAELAAAQARAAQIAALE----AVTISSKAGDE----GR
RL9_PASMU       TKAN--IEYFEARRAELEAKAAEVLAAAQARAAKLAELG----SVTIASKAGDE----GR
RL9_HAEIE       TKAN--IEHFEARRAELEATAAANLAAAQARAAEVTALG----SVTIASKAGDE----GR
RL9_HAEIN       TKAN--IEHFEARRAELEATAAANLAAAQARAAEVTALG----SVTIASKAGDE----GR
RL9_HAEIG       TKAN--IEHFEARRAELEATAAANLAAAQARAAEVTALG----SVTIASKAGDE----GR
RL9_HAEI8       TKAN--IEHFEARRAELEATAAANLAAAQARAAEVTALG----SVTIASKAGDE----GR
RL9_HAES1       TQAN--IEYFESRRAELERKAAEVLATAQARANQLAELA----TVTITSKAGDE----GR
RL9_HISS2       TQAN--IEYFESRRAELERKAAEVLATAQARANQLAELA----TVTITSKAGDE----GR
RL9_MARHV       TEAN--VKAFEERRAELEKAAAEKLAAAQARAEALEGA-----SFTITSKAGEE----GK
RL9_HAHCH       TKAN--VEQFEARRAELEKSAAEKLSAAQARAEAINGK-----EVTIVAKSGDE----GK
RL9_PSEMY       TAEN--VAAFEARRAELEKLAAEKKASAEARAAQLAEL-----EVTITATAGDE----GK
RL9_PSEU5       TPAN--IAEFEARRAELEKAAAEKKASAETRAAQLAEL-----EVTITATAGDE----GK
RL9_PSESM       TAAN--VAAFEERRAELEKLAADKKASAETRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEU2       TAAN--VAAFEERRAELEKLAADKKASAETRAAQLAEL-----EVTITATAGDE----GK
RL9_PSE14       TAAN--VAAFEERRAELEKLAADKKASAETRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEF5       TAAN--LAAFEARRAELEKLAAEKKASAETRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEPF       TAAN--LAAFEERRAELEKAAADRKASAESRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEP1       NAAN--LAAFEERRAELEKAAADKKASAESRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEPK       NAAN--LAAFEERRAELEKAAADKKASAESRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEPG       NAAN--LAAFEERRAELEKAAADKKSSAESRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEE4       NAAN--LAAFEERRAELEKAAADKKASAESRAAQLAEL-----EVTITATAGDE----GK
RL9_PSEA7       TAEN--VAAFEARRAELEKAAAEKKAAAEARAAQLSEL-----VVTLGAHAGDE----GK
RL9_PSEAE       TAEN--VAAFEARRAELEKAAAEKKAAAEARAAQLSEL-----VVTLGAHAGDE----GK
RL9_PSEAB       TAEN--VAAFEARRAELEKAAAEKKAAAEARAAQLSEL-----VVTLGAHAGDE----GK
RL9_CHRSD       TKEN--VAAFEAQRAELEAQAAERKAEAEARAAQLSEI-----ELSLVAKAGDE----GK
RL9_SACD2       TKAS--IADFETRRAELEAAAAEKKTSAEGRAKLIDNLG----AITIGANAGDE----GK
RL9_PSYCK       TKAN--IEKFEARRAELEAEEAKEVAVAQERADALTDV-----NVIMRAKSGDE----GK
RL9_PSYA2       TKAN--IEKFEARRAELEAEEAKEVAVAQERADALADV-----NVIMRAKSGDE----GK
RL9_PSYWF       TPAN--VEKFEARRAELEAIEAEELAAANKRAEALTDV-----NVIMRAKSGED----GK
RL9_ACIBT       TEAN--TAAFEARRAELEKQEAEVLAAAQARAEQLNEV-----NIVITAKAGDE----GK
RL9_ACIAD       TEAN--TAAFEARRAELEKQESEVLSSAQARADQLNEV-----NIVITAKAGDE----GK
RL9_ALCBS       TKAN--LAEVEQRRAELEKHAAQQLGAAQERAEKLNET-----TVSIAAKAGDE----GK
RL9_MARMS       TKAN--LASFEERRVELEAQAAERKAAAEARALTLEGK-----TFTIAANAGDE----GK
RL9_HYDCU       TKEN--IAEFEARRAELEKLAAEALASAQAVYEKMNGT-----VVTIESVAGDE----GK
RL9_NITOC       TKEN--EAHFESRKAELEKAAGDKVAVAERCKQALADLG----SVTIPAKAGTE----GK
RL9_ALKEH       TKEN--IRYFEERRAELERQAQEALAAAEARKEQLEGL-----TVTISAKSGEE----GK
RL9_HALHL       TEEN--IRYFEERRAELEKAAREAEQAAQARLEQLQEL-----TLTIKAKVGEQ----GK
RL9_XYLFA       TEAN--LAAFQAKRAEYEAKAKSELDQAQARAAKFEGA-----SVTVSAHASTE----GK
RL9_XYLFT       TEAN--LAAFQAKRAEYEAKAKSELDQAQARAAKFEGA-----SVTVSAHASTE----GK
RL9_XANC5       TAAN--VEAFETKRAEYEAKANSILAEAQSRATKFEGA-----SVTIGAHASTE----GK
RL9_XANAC       TAAN--VEAFETKRAEYEAKANSILAEAQSRATKFEGA-----SVTIGAHASTE----GK
RL9_XANC8       TAAN--VEAFETKRAEYEAKANTILADAQSRATKFEGA-----SVTIGAHASTE----GK
RL9_XANCP       TAAN--VEAFETKRAEYEAKANTILADAQSRATKFEGA-----SVTIGAHASTE----GK
RL9_XANOR       TAAN--VEAFETKRAEYEAKASSILADAQSRATKFEGA-----SVTICAHASTE----GK
RL9_XANOM       TAAN--VEAFETKRAEYEAKASSILADAQSRATKFEGA-----SVTICAHASTE----GK
RL9_METCA       TAAK--LAEFEQRRAELEKKASEELAAAQARAEAVARL-----NVSIAQKAGEE----GK
RL9_COXBR       TPEH--IAEFEKQRAELEKAAAELLAKAKARAKKLEDK-----SFKITANASDE----GR
RL9_COXBU       TPEH--IAEFEKQRAELEKAAAELLAKAKARAKKLEDK-----SFKITANASDE----GR
RL9_COXBN       TPEH--IAEFEKRRAELEKAAAELLAKAKARAKKLEDK-----TFKITANASDE----GR
RL9_LEGPH       TEQN--IELFEKRRAELEKKAQQALANAEQRAAKLNDT-----TIVISAMASDE----GK
RL9_LEGPC       TEQN--IELFEKRRAELEKKAQQALANAEQRAAKLNDT-----TIVISAMASDE----GK
RL9_LEGPL       TEQN--IELFEKRRAELEKKAQQNLANAEQRAAKLNDT-----TIVISAMASDE----GK
RL9_LEGPA       TEQN--IELFQKRRAELEKKAQQALANAEQRAAKLNDT-----TIVISAMASDE----GK
RL9_DICNV       IPSK--IAEFEARRKELEEKQAQRLAASAQRAESLNGK-----ILTVFAKAGDE----GK
RL9_FRATW       TQAN--IKAFEAQKAELEKAEKARFEAAVAVADAIKDK-----VYTIAAQAGEG----GK
RL9_FRAT1       TQAN--IKAFEAQKAELEKAEKARFEAAVAVADAIKDK-----VYTIAAQAGEG----GK
RL9_FRATT       TQAN--IKAFEAQKAELEKAEKARFEAAVAVADAIKDK-----VYTIAAQAGEG----GK
RL9_FRATH       TQAN--IKAFEAQKAELEKAEKARFEAAVAVADAIKDK-----VYTIAAQAGEG----GK
RL9_FRATF       TQAN--IKAFEAQKAELEKAEKARFEAAVAVADAIKDK-----VYTIAAQAGEG----GK
RL9_FRATN       TQAN--IKAFEAQKAELEKAEKARFEAAVAVADAIKDK-----VYTIAAQAGEG----GK
RL9_FRAP2       TKAN--IETFEAQKAELEKAEKARFDAAVATAEAIKDK-----VYTIAAQAGEG----GK
RL9_AZOSB       NQAN--LAEFEARRAELERQQAEKLAAAQEVGAKLEGL-----MVQIARKAGMD----GR
RL9_AROAE       TQSN--MAQFEALRAELERAHAEKLAEAQAIATKLEGL-----MVQISRKAGMD----GR
RL9_METFK       TEAN--KAEFEARRAELEKQQAEQLAAAQKRGEKLAGF-----MLQVTQKAGVD----GR
RL9_NITMU       TQAA--VAEFESKRAELEKTQADILAAAQARAAKLEGL-----MLQVTQKAGVD----GK
RL9_DECAR       TPAA--MAEFEARRAELEKLAAEKLAAAQAVADKMNGT-----VVTVARKAGMD----GR
RL9_POLAQ       TEAA--IADFAVRRAELEKLAAEKLAAAEAVGTKLKDL-----VLEIGQKAGVD----GR
RL9_BORBR       TDAA--LKEFEARRAELEKVQAEKLAAAQALAERLNGF-----QLKISQKAGVD----GR
RL9_BORPA       TDAA--LKEFEARRAELEKVQAEKLAAAQALAERLNGF-----QLKISQKAGVD----GR
RL9_BORPE       TDAA--LKEFEARRAELEKVQAEKLAAAQALAERLNGF-----QLKISQKAGVD----GR
RL9_BORA1       TDAA--LKEFEARRVELEKIQAEKLAAAQALGERLNGY-----QLKVAQKAGVD----GR
RL9_ACIAC       TEAN--KAEFEAKRAELEKAAAAKLAEAQAQGEKLGGT-----TVKLTQKAGVD----GR
RL9_ACISJ       TEAA--KAEFEAKRAELEKAAAEKLAAAQAQGEKLAGT-----TVKLTQKAGVD----GR
RL9_VEREI       TEAA--KAEFEAKRAELEKTAATNLAQAQAQGEKLAGT-----AIKLTQKAGVD----GR
RL9_POLNA       TAAA--IKEFEVKRAELEKAAAAKLAEMQVQGEKLGGT-----TVKLTQKAGVD----GR
RL9_POLSJ       TEAN--KAEFEAKRVELEKAAAAKLAEMQAQGEKLGGT-----TVKLTQKAGVD----GR
RL9_RHOFT       TASA--KQEFEAKRAELEKAAAAKLAESQTVGEKLAGT-----TCKLTQKAGVD----GR
RL9_METPP       TETA--VKEFEAKRIELEKAAAAKLAASQAEGEKLNGK-----TISITQKAGVD----GR
RL9_CUPNH       TQTA--IAEFEVKRAELEKAAAEKLAAAQAEGEKLSGL-----SVQISQKSGVD----GR
RL9_CUPMC       TQSA--IAEFEVKRAELEKVAAEKLAAAQAEGEKLNGL-----TVQITQKSGVD----GR
RL9_CUPPJ       TQTA--IQEFEVKRAELEKAAAEKLAAAQAEGEKLNGQ-----TVQISQKSGVD----GR
RL9_RALSO       TASA--IQEFEARRAELEKLAAERLAAAQAEGEKLNGL-----TLQLSQKAGVD----GR
RL9_PARXL       TKEA--LAEFEVRRAELEKVAAEKLAAAQAQGEKLAGS-----TVQINQKAGVD----GR
RL9_BURP1       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURMS       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURP0       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURMA       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURM7       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURPS       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURM9       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURP6       TKDA--IAEFEVRRAELEKVAAEKLAAAQAVGEKLNGQ-----TFEITQKSGVD----GR
RL9_BURTA       TKDA--IAEFEVRRAELEKIAAEKLAAAQAVGEKLSGQ-----AFEITQKSGVD----GR
RL9_BURCA       TKEA--IAEFEVRRAELEKIAAEKLAASQAVGEKLNGQ-----SFEITQKSGVD----GR
RL9_BURCH       TKEA--IAEFEVRRAELEKIAAEKLAASQAVGEKLNGQ-----SFEITQKSGVD----GR
RL9_BURL3       TKEA--IAEFEVRRAELEKIAAEKLAASQAVGEKLNGQ-----SFEITQKSGVD----GR
RL9_BURVG       TKEA--IAEFEVRRAELEKIAAEKLAASQAVGEKLNGQ-----AFEVTQKSGVD----GR
RL9_BURCM       TKEA--IAEFEVRRAELEKVAAEKLAASQAVGEKLNGQ-----SFEITQKSGVD----GR
RL9_JANMA       TAAA--VAEFEVKRAELEKIAAEKLAASQAQGEKLTGQ-----TVQITQKSGVD----GR
RL9_HERAR       TTAA--VAEFEVKRAELEKIAAEKLAASQAQGEKLTGQ-----TVQISQKSGVD----GR
RL9_THIDA       TQAN--MEAFAAQKAELERIAADKLADAQRRSEKLEGA-----SVTISQKAGVD----GR
RL9_NEIMB       TEAN--MKEFEARRAELEAKQAEILADARVRQEKLDGQ-----TVTVAQKAGVD----GR
RL9_NEIMF       TEAN--MKEFEVRRAELEAKQAEILADARVRQEKLDGQ-----TVTVAQKAGVD----GR
RL9_NEIMA       TEAN--MKEFEARRAELEAKQAEILADARVRQEKLDGQ-----TITVAQKAGVD----GR
RL9_NEIM0       TEAN--MKEFEARRAELEAKQAEILADARARQEKLDGQ-----TVTVAQKAGVD----GR
RL9_NEIG1       TEAN--MKEFEARRAELEAKQAEILADARARQEKLDGQ-----TVTVAQKAGVD----GR
RL9_NEIGO       TEAN--MKEFEARRAELEAKQAEILADARARQEKLDGQ-----TVTVAQKAGVD----GR
RL9_CHRVO       TEAN--LKEFDARRAELEAKQAEILADAKVRAEKLNEA-----VITIAQKAGVD----GR
RL9_NITEU       TEKV--IAEFEAQRAELEKKQSEILAAASAQAARLDGL-----LVQISQKAGVD----GK
RL9_NITEC       TERV--IAEFETQRAELEKKQADILDAAGAQAAKLDGL-----LIQISQKAGVD----GK
RL9_VESOH       TKTN--LVEFELIRAKLQIAEAKTLKNAKAIETKMTNT-----ICIIQANASEE----GK
RL9_RUTMC       TKTN--LAKFKLIKAELQASEAKILKNAQVIESKMTGT-----VCTIQANAGEE----GK
RL9_BUCAI       NKKN--IESFEAQRIALEKEKINELLIAQSRAEKLKKIN----SITILSKVGKE----GK
RL9_BUCAP       SKKN--IESFEAQRVELEKENISKLLIAQSRAEKIKTIK----SITIPSKVGKE----GK
RL9_BUCBP       TKDN--IKFEINKKEELERELIKKISIAKTKCEKIKNIK----SIVIPAQVGIE----GK
RL9_BUCCC       TSEN--IKIFEKKRLFEEQQEAKKIDYANSRIKAIKLIG----AIIFFMKSSKK----RK
RL9_WIGBR       SEKN--LKFFEKKRKILEEQSKYENFKLKERFRNIKSLK----EIEIYCKAGSK----GK
RL9_BLOPB       TKKN--IEIFKAQQLELQSKAIEAQTQAEFCAKTINRLG----SITIKAKSGVE----GK
RL9_BLOFL       TKKN--LAIFKKQQHILKSNLDSKRLKAEFRAKAINDLG----SITITVKSSIH----GK
RL9_PELUB       SKEN--IAEVEKIKSELSKKDTEKKKEAQKISEQINN-K----EYEIKKLSTEN----KE
RL9_WOLPM       TKEN--LTKLEEQRLLLEEENIKRLNVAKELALSLHDKF----VVLIKQ-ASED----GK
RL9_WOLTR       TKES--IAKLEEQRSFLEEENIRKLNLASELAASFAGKF----VILVKQ-ASED----GK
RL9_ANAPZ       TKRN--MELLAEKLAVMEEESNQKLREAEKVAEALAGEC----FVMIRQ-ASDD----GK
RL9_ANAMM       TKDN--VALLEQKLALIEEENSKKLAEAEGVAKSLGAER----LIIVRQ-SSDD----GK
RL9_EHRCR       TKEN--LKSLEEQYLFIEKENLEKLEAAKVLKASLEDEF----LIITRQ-AADD----GK
RL9_EHRCJ       TKEN--LKNLEEQYLVIERENLEKLEAAKALKLSLEDEF----LIITRQ-AADD----GK
RL9_EHRRW       TKEN--LKILEEQHISIQQENLEKLEAAKALQVSLKDEF----LIIIRQ-AADD----GK
RL9_EHRRG       TKEN--LKILEEQHISIQQENLEKLEAAKALQVSLKDEF----LIIIRQ-AADD----GK
RL9_NEOSM       TRAN--LAILENSKEKLAAQQAAELETASELAKSFTEID----VLPIYA-QAER----GV
RL9_RICPR       TKSN--KELIVKQKYEFEEKDKQVREEVEKINTIIKDQ-----QLVFIRQTSDD----CK
RL9_RICTY       TKSN--KELIVKQKHEFEAKDKQIRAEVEKINTLIKDQ-----QLVFIRQTSDD----CK
RL9_RICRS       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKDQ-----QLVFIRQTSND----GK
RL9_RICRO       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKDQ-----QLVFIRQTSND----GK
RL9_RICCN       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKDQ-----QLVFIRQTSND----GK
RL9_RICM5       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKDQ-----KLVFIRQTSDD----GK
RL9_RICFE       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKDQ-----KLVFIRQTSDD----GK
RL9_RICAH       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKDQ-----KLVFIRQASDD----GK
RL9_RICCK       TEPN--KELIVKQKHEFEAKDKQIREEVEKINALIKEQ-----KLVFIRQTSDD----GK
RL9_RICBR       TELN--KELIVKQKHELEEKDKQIKSEITKINDLIKDQ-----KLIFVRQTSDD----GK
RL9_RICB8       TELN--KELIVKQKHELEEKDKQIKSEITKINDLIKDQ-----KLIFVRQTSDD----GK
RL9_ORITB       TNAN--LEIVKSTVQQLNEKNQKGIAAAQAVMQKIDRS-----FITFICQTSDD----GK
RL9_RUBXD       TPAK--LEEARRRMEEAAERERRLAERAEEIAETLNKS-----VITIEARTGED----ER
RL9_RHOBA       TDHH--KRMVEKHREKLRAIELEKLKSYREQADELAKQ-----SITIEANANDE----GH
RL9_DESPS       TATN--VAELEKNQAEIQAKIAKETAIAEKVAEKLQAI-----NLVIEQLAGDD----GR
RL9_RHOS1       NESN--IKSFEARKAQLEAQNLETKKEAAAVAEKLDGQ-----SFVVIRSASDS----GA
RL9_RHOS4       NESN--IKSFEARKAQLEAQNLETKKEAAAVAEKLDGQ-----SFVVIRSASDS----GA
RL9_RHOS5       NESN--IKSFEARKAQLEAQNLETKKEAAAVAEKLDGQ-----SFVVIRSASDA----GA
RL9_DINSH       SEAN--IAQFEAQKAQLEARNLETRKEAEAMAEKLDGQ-----QFIVIRSASDA----GA
RL9_ROSDO       SKAN--IEAFEQQKAQLEARNLETRKEAEALAAKLDGQ-----QFIVIRSASDS----GA
RL9_RUEPO       SDAN--IAQFEAQKAQLEARNLETKQEAEALAVKLDGQ-----QFVVIRSASDA----GA
RL9_RUEST       SDAN--IAAFEAQKAQLEARNLETKKEAEALGEKLGGQ-----QFVVIRSASDG----GN
RL9_PARDP       SDAN--IQAFEARKAELASRNDETRAEAEKIAEKLDGQ-----TFVIIRSASDA----GA
RL9_JANSC       NEMN--LAAFENQKAQLEATNLETRKEAEAMGEKLAGQ-----QFVIIRSASDS----GA
RL9_RHOCB       NDAN--IKSFEARKAQLEARNLETKKEAEAAAAKLEGQ-----KFVVIRSASDA----GA
RL9_RHILO       NEAN--KKKFEGQRAQLEARNLERKSEASQVAEKLDGK-----SFIAVRSAGET----GQ
RL9_CHESB       NDAN--RKKFESQRVELEARNLERKSEAQAVAEKLDGK-----SFVVIRSAAET----GQ
RL9_SINMW       NASN--KARFEAERSTLEARNLERKSEAQKVAESLDGK-----SFIIVRSAGET----GQ
RL9_RHIME       NAAN--KARFESERSTLEARNLERKSEAQKVADSLDGK-----SFIIVRSAGET----GQ
RL9_RHILT       NAAN--KTRFEAERATLEARNLERKSEAQKVADVLDGK-----SFIVVRSAGET----GQ
RL9_RHIL3       NAAN--KTRFEAERATLEARNLERKSEAQTVADVLDGK-----SFIVVRSAGET----GQ
RL9_RHIEC       NAAN--KARFESERATLEARNLERKSEAQKVADVLDGK-----SFIVVRSAGET----GQ
RL9_AGRFC       NAAN--KTRFETERATLEARNLERKSEAQTVAEALAGK-----SFIVVRSAGET----GQ
RL9_BRUAB       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_BRUA2       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_BRUME       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_BRUO2       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_BRUC2       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_BRUSI       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_BRUSU       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVADKLNGE-----SFIVVRSAGET----GQ
RL9_OCHA4       NEAN--KKKFEGQRAQLEAQNLERKNEAQAVAEKLNGE-----SFIVVRSAGET----GQ
RL9_BARHE       NEAN--KKHFEIQRAQLEARNLERKSEAEKIAEKLDGK-----SFIVVRSAGET----GQ
RL9_BARQU       NDAN--KKHFEKQRAQLKARNLERKSEAQKIAEKLDGK-----SFIVVRSAGET----GQ
RL9_BART1       NEAN--KKHFETQRAQLEARNLERKSEAQKIAEKLDGQ-----SFIAVRSAGET----GQ
RL9_BARBK       NEAN--KKFFETQRIKLEARNLECKNEAQKIAERLNGK-----SFIVVRSAGET----GQ
RL9_PARL1       TKAN--IERFEGQRAQLEARNLELKKEAEQVHTKVHGQ-----SFIILRQAGET----GI
RL9_MAGSA       SKAN--LAFFEKQRVQLEALNLKRRDEAQAVADKMTGL-----SVLMVRQAGES----GM
RL9_RHORT       SKSN--LEYFNAQKVELEALNLKRKGEAEAVAVKLDGL-----NLVMVRQAGES----GQ
RL9_GLUDA       NALN--RERFERERVQLEALNLKRREEAERLSERMHGL-----SVVLIRQAGDS----GS
RL9_GLUOX       TAAN--KKRFETERAQLEAQNLKKREEAERLAERMHEL-----SVVIIRQAGDS----GS
RL9_GRABC       TKAN--TERFEQQRAQLEAQNLKRREEAERIAERVSGL-----SVVIIRQAGES----GG
RL9_ACICJ       TKQN--RERFERERAHLEAQNLKRREEAERVAERVAGL-----TVTLIRQASDA----GS
RL9_RHOP2       TAAN--RDKYEHMKADLEARNIAAKAEAAKVAEKIDGH-----NVIVIRQASET----GQ
RL9_RHOPS       TAAN--RDKYEHMKADLEARNIEAKAEAAKVAEKIDGK-----NVIVIRQASET----GQ
RL9_RHOPA       TAAN--REKYEHMKADLEARNIAAKAEATKVAEKIDGQ-----NVVVIRQASEG----GQ
RL9_RHOP5       TADN--KGKFEHMKADLEARNLAAKEEATKVAEKIDGR-----NVVVLRQASES----GQ
RL9_RHOPB       TTDN--RAKYEHMKADLEARNIEAKAEAIKVAEKIDGR-----NVVVLRQASET----GQ
RL9_BRASO       TAEN--KAKYEGMKAELEANNIKAKGEAAKVAEKIDGR-----DIVVIRQASES----GQ
RL9_BRASB       TAEN--KAKYEGMKAELEANNIKAKGEAAKVAEKIDGR-----DIVIIRQASES----GQ
RL9_NITWN       TAEN--RAKYDGMKAELEANNIKAKGEAATVAEKINGR-----DIVVIRQASET----GQ
RL9_NITHX       TAEN--RTKYDGMKAELEINNIKAKGEAAKVAEKIDGR-----DIVIIRQASET----GQ
RL9_BRADU       TADN--RAKYDGMKADLEARNLASKAEASKVAEKIQGK-----NIIVIRQASEA----GQ
RL9_CAUVC       TKAN--LATFEAQRAEIEARNVKNRESAAKNGEALDGT-----QYILIRQAGES----GQ
RL9_CAUSK       NSAN--LKSFEVQRAEIEARNVKNREAAGKSGEGLDGK-----QYVMIRQAGES----GQ
RL9_MARMM       TEAN--MARFEVERELLEKRNAERAAEAAESGKTIDGE-----SFVMIRQAGES----GQ
RL9_HYPNA       NDKN--RKRFEIERDAIEARNAAARDAAQTEADNLEGA-----IFVLIRQAGET----GQ
RL9_NOVAD       NEAN--RKVFEANRARIEAENAARRDEAQNESGNVEGK-----EVVLIRASSNA----GQ
RL9_SPHWW       NEAN--KKVFEANRAQIEADNANRRGNAETEAKALDDK-----SVTLIRQASNT----GQ
RL9_ZYMMO       NEAN--RKIFEANRAQIEADNAARRTDAEKESEVVNGL-----TVTLIRQASNT----GH
RL9_SPHAL       NEAN--RKLFEANRAKIEADNAERRSEAEGRAKDIDGK-----QIVLIRQASNT----GQ
RL9_MAGMM       TSEN--KSVFEAQRADYEARQAEILADAETLAAKVDEV-----SVVMKRPAGAM----DK
RL9_DESVH       SQAN--LKAFELERKKLQARMDALRNAAADIAAKLEGL-----VLAIPMRVGEN----DK
RL9_DESVV       SQAN--LKAFELERKKLQARMDALRNAAADIAAKLEGL-----VLAIPMRVGEN----DK
RL9_LAWIP       TPGN--MKVFELEFKKLQERMNDIRSKADELAKRISGL-----IVTVLMRAGDN----DK
RL9_DESAG       TASN--MKVFEMERRKLQAEMDAVRATATTLAEKIAAA-----DVSIAVRVGEN----DK
RL9_ANADE       NPKN--VKELEHQKAVAAAKAAKLKASAQAVAKRLSET-----PVTLKRKVGEQ----DK
RL9_ANADF       NPKN--VRELEHQKAIATAKAAKMKASAQAVAKRLAET-----PITLSRKVGEQ----DK
RL9_MYXXD       SEQN--LRQLEHEKAVIAARNAKLKGAAEEQAKKIGAI-----KVSIKRRVGDQ----DK
RL9_SOLUE       TEAN--RKIVEQERQAHLRKETKIKGEAEELAKIMTGV-----TVRISQKAGEN----DQ
RL9_KORVE       TAAN--KAVIEQMKAAAVRRIAREKTDAESLAKQFDGV-----TVTFTRRAGES----NQ
RL9_GEOMG       TEKN--AKALEHAKRQLEYKRNKVLEQAKGLAAKIEGL-----TIAITHQAGEE----GK
RL9_GEOSL       TEKN--AKALEHAKRQLEYKRNKVLEQARLLVAKIEGL-----SLSISHQAGEE----GK
RL9_GEOUR       TTKN--AKALDHAKKHLEYKKNKVLEQARVLAAKIEGL-----ALNLSHQAGEE----GK
RL9_PELPD       TEKN--AKALEHVKRQMAYRKDKVTQAAKLLLAKLEGI-----TVELVHQAGVE----GK
RL9_PELCD       NTRN--IKELEHQKRQLEHKAQKVLQASEVVKAQIEKV-----TCEFALRAGDD----GK
RL9_SYNAS       NLRN--IKALEHDKQNIVRKAEKERKRHESLAASLSGV-----TCTIARRVGEQ----DK
RL9_SYNFM       TGKN--VKELDHRKRVLAAKREKIRQEMLSVAEKINQV-----KLVLRRKVADE----DK
RL9_LEPBL       NEGN--TKAAFHQKKLGELKKEKRKKAMEAVATNLNGK-----EYDILVKTGGG----EK
RL9_LEPBJ       NEGN--TKAAFHQKKLGELKKEKRKKAMEAVATNLNGK-----EYDILVKTGGG----EK
RL9_LEPIC       NEGN--TKAALHQKKLGELKREKRKKAMEDVGGNLNGK-----EYEILVKTGGG----EK
RL9_LEPIN       NEGN--TKAALHQKKLGELKREKRKKAMEDVGGNLNGK-----EYEILVKTGGG----EK
RL9_BDEBA       TEKR--VKEYEHLQRVAEAKKKKALAERQELLNKINGT-----TVTFKLAAGDT----DK
RL9_THET8       TESN--LKALEARIRAQAKRLAERKAEAERLKEILENL-----TLTIPVRAG-E----TK
RL9_THETH       TESN--LKALEARIRAQAKRLAERKAEAERLKKILENL-----TLTIPVRAG-E----TK
RL9_THET2       TESN--LKALEARIRAQAKRLAERKAEAERLKEILENL-----TLTIPVRAG-E----TK
RL9_DEIRA       TRTN--MKTLEAQLRSIEKRQAQEKAVAEDLASRLNGV-----AVELSVRAG-E----GK
RL9_DEIGD       TASN--MKTLEAQVRARKKQQEREKAQAEDLASRLNGV-----AVELSVRAG-E----GK
RL9_CHLCV       GAGT--LRLQAKLKEERLLRAAEDRAESEKLAEALRDV-----ILEFQVRVDPD----NN
RL9_CHLAB       GAGT--LRLQAKLKEERLLRAAADREESEKLAQILKDI-----VLEFQVRVDPD----NN
RL9_CHLFF       GAGT--LRLQAKLKEERLLRAAEDRAESEKLAELLKDL-----VLEFQVRVDPD----NN
RL9_CHLPN       GAGT--LRLQAKLKEQRLIQAAADKADSERIAQALKDI-----VLEFQVRVDPD----NN
RL9_CHLTR       SAGT--LRLQAKLQEQRLLQAAADKEESLRLAEMLRSI-----VLDFQVRVDSE----NN
RL9_CHLTA       SAGT--LRLQAKLQEQRLLQAAADKEESLRLAEMLRSI-----VLDFQVRVDSE----NN
RL9_CHLMU       SAGT--LRLQAKLQEQRLLQAAADKEESLRLAETLRSL-----VLDFQVRVDSE----NN
RL9_PARUW       DKNT--LRMQERLKAEREKRAIADKKESEAVAMQIEGM-----TLVQVVKVDQE----GH
RL9_CHLAA       TKSQ--VKQAEERLAAQRRKAEAARKEAEALAARLAEL-----TLTFTVKVGEQ----DR
RL9_CHLPM       TEGT--LRALETEKKQQAKKMELKRKSARDLAARIEQM-----ALKVQAKAGES----GK
RL9_PELLD       TEGT--LKALETEKKQQARKVELQRTSARELAQKIEQM-----VLKVQAKAGES----GK
RL9_CHLPD       TEGT--LKALETERKQQVKKVEMLRKTARELAAKIEQM-----TLKVFAKAGES----GK
RL9_CHLTE       TEGT--LKALETEKKQQARKIELQRTNARELAAKIEQM-----TLKVLAKAGES----GK
RL9_CHLCH       TEGT--LKALETERKQQARKVEMQRKHAREQAQKIEQL-----ALKVFARAGES----GK
RL9_AQUAE       TEGN--IKHIQTILAQKERKLLREKKKAEELAKKLEGM-----VIGIKKPAGEG----GK
RL9_PORGI       SESA--KKVLAENLRQRAHKIAQIKKEAEEKAASMQGI-----SLTIKAKTSST----GT
RL9_PARD8       SESA--KKVLAENLKQRAHKLAKIKEDAQTLAAKLEGV-----ALTIGAKTSST----GT
RL9_BACFN       SPSA--KKMLAEELKQRAHKLEKIKKDAEALAAKLEGV-----SLTIATKVSST----GT
RL9_BACFR       SPSA--KKMLAEELKQRAHKLEKIKKDAEAVAAKLEGV-----SLTIATKVSST----GT
RL9_BACTN       SPSA--KKMLAEDLKQRAHKLEKIKKDAEALAAKLEGV-----SLTIATKVSST----GT
RL9_BACV8       SPSA--KKMLAEELKQRAHKLEKIKKDAEAMAEQLKDV-----TLTIATKVSAT----GT
RL9_CYTH3       TVSA--KKVVAENIKQAAHKAEKLKKDAVATSEKIAGL-----ALEIAAKVGDT----GK
RL9_FLAJ1       TPSA--KKVLAENLKQRAHKEAKIVADAKALAETLKAL-----EIKLTAKAG-G----EK
RL9_FLAPJ       TSSA--KKVLAENLKQRAHKEAKVVADAKTLGDALKAI-----EIKISAKAG-G----EK
RL9_GRAFK       TPSA--RKVLSETLKQRAYKEQKHIDEAKKQAEKLNNL-----EIKITAKAGAG----DK
RL9_THEEB       TPSA--LRRVERLQEKERQRLAALKSIAEKQKATLEKLA---TITISMPVGEK-----DM
RL9_SYNEL       TPSA--LRRVERLQEKERQRLAALKSIAEKQKATLEKLA---TITISMPVGEK-----DM
RL9_ACAM1       TPGV--LKQIEHRKAEELKRLEGIKDEAAKQKVALQTIG---TFRIEQKAGEE-----DM
RL9_SYNP6       TRGV--LKQVEFRRAREAARLVAEKEAAVARKTALETIG---RFVIKKQAGEG-----ES
RL9_SYNE7       TRGV--LKQVEFRRAREAARLVAEKEAAVARKTALETIG---RFVIKKQAGEG-----ES
RL9_SYNY3       TPGI--LRQVEQRRLKELERLKAEKDAAEARKVALETIG---RFVIKKQVGEA-----EA
RL9_TRIV2       TPGI--LKQVERRREQERQRQLELRQQALEQKEALEKVG---SLKIAKQVGEN-----EA
RL9_NOSS1       TPGI--LKQVERRREQERQRQLELRQQALEQKESLEKVG---SLKIAKQVGEN-----EA
RL9_TRIEI       TPGV--LKQVERRQEQERQRQIELKQGALAQKTALETVG---RFKIAKQVGEN-----DA
RL9_MICAN       TKGA--IKQAEFRKEKERQRLLAEKQEAETRKTAIEKLS---PYSIPKQVGEN-----EA
RL9_SYNPW       TPAV--MKQVEHRRAKEAERQAALKQEALAFRTALDTIG---RFTVKKQTGDD-----DV
RL9_SYNS3       TPAV--MKQVEHRRAKEAERQATLKQDAVAFRTALDTIG---RFTVKKQTGGD-----DV
RL9_SYNPX       TPAV--MKQVEHRRAKEAERQAALKQAALDFRTALDTIG---RFTVKKQTGED-----NV
RL9_SYNSC       TPAV--MKQVEHRRAKEAERQAALKQEAVDFKTALSTIG---RFTVKKQTGED-----NV
RL9_SYNS9       TPAV--MKQVEHRRAKEVERQAALKQEALNFKTALDTIG---RFTVKKQVGED-----NV
RL9_PROMM       TPAV--MKQVGHRRAKQAEHQAAIKQEALDFQTALVTIG---RFTVKKQTGED-----DV
RL9_PROM3       TPAV--MKQVGHRRAKQAEHQAAIKQEALDFQTALVTIG---RFTVKKQTGED-----DV
RL9_SYNR3       TPAV--LKQVEHRRAKEAERLAALKADAVAFRTALDTIG---RFTVKKQTGGD-----DV
RL9_PROMT       TPTV--LKQVEHRRAKQAEKEAAKKQEAIDFQTALTTIG---RFTVKKQVGED-----GV
RL9_PROM1       TPTV--LKQVEHRRAKQAEKEAAKKQEAIDFQTALTTIG---RFTVKKQVGED-----GV
RL9_PROMA       TPSV--LKQVEYRLAKKAELEAAKKQEAIDFETALKTIG---RFSIKKQTGED-----GV
RL9_PROM0       TPAV--LKQIERKKEKEKIAADKLKQEALDFQTALSTIG---RFTIKKQVGED-----GV
RL9_PROM2       TPAV--LKQIERKKEKEKIAADKLKQEALDFQTALSTIG---RFTIKKQVGED-----GV
RL9_PROM9       TPAV--LKQIERKKEKEKIAADKLKQEALDFQTALSTIG---RFTIKKQVGED-----GV
RL9_PROMS       TPAV--LKQIERKKEKEKIAAGKLKQEALDFQTALSTIG---RFTIKKQVGED-----GV
RL9_PROMP       TPSI--LKQIERKRAKEKIAAEKVKQEAIDFKTALATIG---RFTIKKQVGED-----GV
RL9_PROM5       TPSI--LKQIERKRAKEKIAAEKLKQEAIDFKTALTTIG---RFTIKKQVGED-----GV
RL9_SYNJB       TPGI--LKEQQVRLEQEAARKLAERQQAENYKTALETIG---RFVIRKKVGEH-----DL
RL9_SYNJA       TPGL--LKEQQMRREQEAARKLAEKQQAENYKKALETIG---RFVIRKKVGEK-----DL
RL9_GLOVI       TPGL--VKEAEFRQAKRREIEAKHRADALETKKTLEALG---FYEVFAPVGEDG----NQ
RL9_SALRD       TDGA--IRQLRDEQQQQARKEAAKKEQVEELKDELEDM----QVVFTAKVGED-----NR
RK9_PYRYE       TNGI--LKQQKFYAAIREEKLKTAKENAKKVKQLLEEIQ---RFSVSKKTGDG-----HN
RK9_PORPU       TVGM--LNQQKLYAAIKEKKIIFAKENARKTQQLLEEIQ---KFSISKKTGDG-----ET
RK9_GRATL       TQGS--LKHHKMFLDMKQQKLDEIQDKLQASAQKFNKIS---KISVKKKVGNN-----NQ
RL9_UREPA       TNKSQEVLNKDLAILEAQE--QQAILDATLLKDKLEQKP-----LQFFLKTNN-----LQ
RL9_UREP2       TNKSQEVLNKDLAILEAQE--QQAILDATLLKDKLEQKP-----LQFFLKTNN-----LQ
RL9_MYCGE       TKKA--IANRDLFLKQQQEQYQKNRALAEKLKLVIEQTP-----LTFQLKQHD-----GK
RL9_MYCPN       TKKS--LQDRDLFLKKQQEHYEINKALSHKLKEVIEQTE-----LHFSLKEHN-----GR
RL9_MYCGA       TERG--QKRLDLKVIKRNEQHDLLALEAKNLAKQLEGVV-----LEYDIRTNEE----DK
RL9_MYCPU       TEEN--AKKLKQKLEQEKLDFSLKTKEFLELKEKLEKLK-----LTFKLKASLDKNHKLE
RL9_MYCMO       NKDN--EKFLKDVLEKEREIENEKRFEANELKTKLEKIN-----LSFKLKASLRKDGIIS
RL9_MYCS5       SQDN--LKIREQKLSDLSALEHEKRSKARELQKQIEELS-----LMFTLDAAIDKAQNLH
RL9_MYCH7       NSRT--EKLLVKRKQQIEIEKQEKQEQIAKLKIEIEKLV-----LWFKLKGNKE-----S
RL9_MYCH2       NSRT--EKLLVKRKQQIEIEKQEKQEQIAKLKIEIERLV-----LWFKLKGNKE-----S
RL9_MYCHJ       NART--EKLLVKRKQQIEIEKQEKQEQIAKLKIEIEKLV-----LWFKLKGNKE-----S
RL9_MYCCT       TNNS--VKTLKEHLKADQEEKELAKAQTKQIKKTLEELT-----LHFKLQTNDD-----K
RL9_MYCMS       TNNS--IQTLKDHLKADQEEKELAKAQTKQIKKTLEELT-----LHFKLQTNDD-----K
RL9_MESFL       TEGS--VKTVKNRKIVQEQEKDLAIAETKQLKTLLEEII-----LKFKLQINEG-----K
                                                  .                         

RL9_CAMC5       LFGSVSKEEIAEELEKA-HHLIVDKKAIEIDK-NHLKAVGLYDVQVKLGHAISATLKVDV
RL9_CAMC1       LFGSVSKEEIAAELEKT-HHLVVEKKAIDLD--THLKAVGLYDVSIKLGHSINATLKVDV
RL9_CAMFF       LFGSITKDEIANALKEQ-KGYEVDKKALECD---HIKATGIYDVALKLKHGISAKFKVEV
RL9_CAMJE       LFGGVTKDEIAHALKEQ-SHIEIDKKSLECD---TLKSLGIHEVSVKLGHAIHAKFNINI
RL9_CAMJR       LFGGVTKDEIAHALKEQ-SHIEIDKKSLECD---TLKSLGIHEVSVKLGHAIHAKFNINI
RL9_CAMJD       LFGGVTKDEIAHALKEQ-SHIEIDKKSLECD---TLKSLGIHEVSVKLGHAIHAKFNISI
RL9_CAMJJ       LFGGVTKDEIAHALKEQ-SHIEIDKKSLECD---TFKSLGLHEVSVKLGHAIHAKFNINI
RL9_CAMJ8       LFGGVTKDEIAHALKEQ-SHIEIDKKSLECD---TFKSLGLHEVSVKLGHAIHAKFNINI
RL9_CAMHC       LFGSVTKDDVANALKEQ-KNIEIDKKLIELP---QTKTIGIYDVNLKLKFGVTAKFEIEV
RL9_SULDN       LFGSITKDEVAHALLEQ-HNVEIDKKHITDK--LSIKTAGKHDLDLRLGHGIHATLHVDV
RL9_NITSB       LFGAITNKEVAEELKKQ--GIEIDKKHIDIH--PPIKQAGEYEIDVKLGHGIHAKLNLVV
RL9_ARCB4       LIGSVTNKEVSDALEQQ-FSIMIDKKNIALD--NKIKTIGIYEVDCKLGHSIHAKLKIDV
RL9_SULNB       IKGSVGNADISAAIKEQ-LDIDLDKKHINLK--KALKSTGIHEVDAKLGHGIHATLKVEV
RL9_HELPY       LFGAITKEEITERLKEQHASLNLDKKDIELK--HPIKSTGIYEIEVKLGSGVVGVFKIDV
RL9_HELPJ       LFGAITKEEITERLKEQHASLNLDKKDIELK--HPIKSTGIYEIEVKLGSGIAGVFKIDV
RL9_HELPH       LFGAITKEEITERLKEQHASLNLDKKDIELK--HPIKSTGIYEIEVKLGSGVVGAFKIDV
RL9_HELAH       LFGAITKEEITERLKEHHANLNLDKKDIELK--HPIKSTGIYEIEVKLGSGIVGVFKIDV
RL9_HELHP       LFGSITKEEIALALEEHKVSL--DKKHIEIA--QAIKHTGNFEVQVKLGQGINATLKLEI
RL9_WOLSU       LYGAITKEDLSAALMAQ-KGIEVDKKSFELK--TPIKSTGIYEIEVKLGHGIHAELKIDV
RL9_FERNB       LFGSLTSANISDVISKTLSKEFDKKWIVLDNP---IKALGTYDVTVKLPGGVSGKIKVEV
RL9_THEM4       LFGALTNSDIAKAVEKIADVNIDKKFIVLEKP---IKEIGMYDVLVRLPEGVSGKIKVEV
RL9_THEMA       IFGAVTAATVAEEISKTTGLKLDKRWFKLDKP---IKELGEYSLEVSLPGGVKDTIKIRV
RL9_THEP1       IFGAVTAATLAEEISKTTGLKLDKRWFKLDKP---IKELGEYSLEVNLPGGVKDTIKIKV
RL9_PSELT       LFGALTSTNLSEILSKNSGVEIDKKWINMDKP---LKETGLYDIEMRLPGGVRGTIKVEI
RL9_PETMO       LFGAVTAQDISEKIEELLDEKFDRTWFDEKVN---IKELGTHTLKVKLPQGVRGEIKVEI
RL9_FUSNN       LFGAITSKEIASQIKEELGLDIDKK--KIEAN---IKNLGPDEVHIKLFTDVKAVIKVNV
RL9_BACHD       LFGAISTKQIAEALSRE-GKKVDKRK---ILLNDPIRSLGYTNVPIKIHPEVTATVKVHV
RL9_BACSK       LFGAVSTKQIAEALGKQ-GKKVDKRK---IQLDEPIRSLGYTKVPIKIHPEVVATATVHV
RL9_GEOTN       LFGSITSKQIAEALQAQHGLKLDKRK---IELNDAIRALGYTNVPVKLHPEVSATLKVHV
RL9_GEOSE       LFGSITSKQIAESLQAQHGLKLDKRK---IELADAIRALGYTNVPVKLHPEVTATLKVHV
RL9_GEOKA       LFGSITSKQIAEALQAQHGLKLDKRK---IELADAIRSLGYTNVPVKLHPEVTATLKVHV
RL9_BACCZ       LFGSITSKQIVDAMQKSHKIKLDKRK---FEMDDAIRALGYTNVTVKLHPQVTATVKVHV
RL9_BACAH       LFGSITSKQIVDAMQKSHKIKLDKRK---FEMDDAIRALGYTNVTVKLHPQVTATVKVHV
RL9_BACAN       LFGSITSKQIVDAMQKSHKIKLDKRK---FEMDDAIRALGYTNVTVKLHPQVTATVKVHV
RL9_BACHK       LFGSITSKQIVDAMQKSHKIKLDKRK---FEMDDAIRALGYTNVTVKLHPQVTATVKVHV
RL9_BACC1       LFGSITSKQIVDAMQKSHNIKLDKRK---FEMDDAIRALGYTNVTVKLHPQVTATVKVHV
RL9_BACCR       LFGSITSKQIVDAMQKSHKIKLDKRK---FEMDDAIRALGYTNVTVKLHPQVTATVKVHV
RL9_BACCN       LFGSITSKQIVDELQKTHKIKLDKRK---FEMEDAIRSLGYTNVTVKLHPQVTATVKVHV
RL9_BACVZ       LFGSVTSKQIAEALQKTHKIKVDKRK---LELQDGIRTLGYTNVPVKLHPEVQAVLKVHV
RL9_BACSU       LFGSVTSKQITEQLQKDHNIKVDKRK---LELPDGIRALGYTNVPVKLHPEVQAVLKVHV
RL9_BACP2       LFGSITSKQIADKLQKDHQIKVDKRK---IELNDAIRALGYTNVPVKLHPEVQATLKVHV
RL9_BACLD       LFGSVTSKQIADALQKGHQLKVDKRK---IELNDAIRSLGYTNVPVKLHPEVQATLKVHV
RL9_LISIN       LFGSITSKQIAQTLEKTHGIKVDKRK---MDLPEAIRALGHTKVPVKLHHEVTATLDVHV
RL9_LISW6       LFGSITSKQIAQTLEKTHGIKIDKRK---MDLPEAIRALGHTKVPVKLHHEVTATLDVHV
RL9_LISMO       LFGSITSKQIAQTLEKTHGIKIDKRK---MDLPEAIRALGHTKVPVKLHHEVTATLDVHV
RL9_LISMF       LFGSITSKQIAQTLEKTHGIKIDKRK---MDLPEAIRALGHTKVPVKLHHEVTATLDVHV
RL9_STAAW       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAE       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAC       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAR       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAS       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAA3       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAT       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAA1       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAM       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAA2       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAA9       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAN       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAA8       LFGSVSTKQIAEALKAQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAAB       LFGSVSTKQIAEALKTQHDIKIDKRK---MDLPNGIHSLGYTNVPVKLDKEVEGTIRVHT
RL9_STAS1       LFGSVSTKQITQALQQQHDIKIDKRK---MDLPNGIHALGYTNVPVKLDKEVEGTIRVHT
RL9_STAEQ       LFGSISTKQIAEALKKQHDIKIDKRK---MDLPHGIHALGYTNVPVKLDKEVEGTIRVHT
RL9_STAES       LFGSISTKQIAEALKKQHDIKIDKRK---MDLPHGIHALGYTNVPVKLDKEVEGTIRVHT
RL9_STAHJ       LFGSVSTKQIAEALKTQHDIKIDKRK---MDLPQGIHALGYTNVPVKLDKEVEGTIRVHT
RL9_OCEIH       LFGSITSKQISEALQKQFGHKIDKRK---IELDEPIRALGYTTVPVKLHPEVSGSIKVHV
RL9_LACBA       LFGSIPSKQIVQALDKQYNLKLDKRK---VELPEPIRSLGFTNVPVKLHADVTAKIRVHV
RL9_LACPL       LFGSIPSKQIATALADQYQVKLDKRK---IELPEPIRVLGYTNVPVKLHPEVTAKIRVHV
RL9_ENTFA       LFGSIPSKQIAEALNKQYNVKLDKRK---IELANPIRSLGYTNVPVKLHHEVTAKIKVHV
RL9_PEDPA       LFGSIPNKQIATALEKQYKIKIDKRK---IELSNPIRSMGYTNVPVKLHQKVTATIRVHV
RL9_LACSS       LFGSIPSKQIAQALEQQYKIKVDKRK---IDLPEPIKALGYRNVDVRIHPDVTATIRVHI
RL9_LACRD       MFGSISTKQIATALQKQFDLKIDKRK---IELAAPIKALGYVNVPIKLHPEVEAQIRVHI
RL9_LACS1       LFGSITSKQISQELEKQYGMKIDKRK---MELREPIRTMGYVNVPVKLHNEVTAKIRVHI
RL9_LACP3       LFGSIPSKQIAQALDKQYQIKVDKRK---IDLKQPIRSLGFTNVTVNLFPGIDARIRVHV
RL9_LACAC       LFGSISSKKIVEGLEKQYGIKVDKRK---LNLPEPIKTLGYTNVHAKLFKGVEATVRVHV
RL9_LACH4       LFGSISSKKIVEGLEKQYGIKVDKRK---LNLPEPIKTLGYTNVHAKLFKGVEATIRVHV
RL9_LACJO       LFGSISSKKIVEGLEKQYGIKVDKRK---LELPEPIKSLGYTNVPVKLFKGVEAVIRVHI
RL9_LACDA       LFGSISSKKIIEGLDKQFGIKLDKHK---LELREPIKVLGYTNVPVKLFKGVESKVRVHV
RL9_LACDB       LFGSISSKKIIEGLDKQFGIKLDKHK---LELREPIKVLGYTNVPVKLFKGVESKVRVHV
RL9_STRT2       TFGSITAKKIAEELQKQFGIKIDKRH---IELEHPIRAIGLIEVPVKLHKEVNAQIKLNI
RL9_STRT1       TFGSITAKKIAEELQKQFGIKIDKRH---IELEHPIRAIGLIEVPVKLHKEVNAQIKLNI
RL9_STRTD       TFGSITAKKIAEGLQKQFGIKIDKRH---IELEHPIRAIGLIEVPVKLHKEVNAQIKLNI
RL9_STRA5       TFGSITAKKIAEELQKQYGIKIDKRH---IDLDHTIRAIGKVEVPVKLHKQVSSQIKLDI
RL9_STRA3       TFGSITAKKIAEELQKQYGIKIDKRH---IDLDHTIRAIGKVEVPVKLHKQVSSQIKLDI
RL9_STRA1       TFGSITAKKIAEELQKQYGIKIDKRH---IDLDHTIRAIGKVEVPVKLHKQVSSQIKLDI
RL9_STRPD       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLTI
RL9_STRPM       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLTI
RL9_STRPF       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLAI
RL9_STRP3       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLAI
RL9_STRPC       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLAI
RL9_STRP1       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLAI
RL9_STRPB       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLAI
RL9_STRPG       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLFEVPVKLHKELTAEIKLAI
RL9_STRP8       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKELTAEIKLAI
RL9_STRP6       TFGSITAKKISEELQKQFGVKVDKRH---IVLDHPIRAIGLIEVPVKLHKEVTAEIKLAI
RL9_STRMU       TFGSITSKKISEELNKQFGIKLDKRY---IKLDHPIRTIGLIEIPVKLHKDIDGIIKLQI
RL9_STRP2       TFGSITNKKIAEELQKQFGIKIDKRH---IQVQAPIRAVGLIDVPVKIYQDITSVINLRV
RL9_STRR6       TFGSITNKKIAEELQKQFGIKIDKRH---IQVQAPIRAVGLIDVPVKIYQDITSVINLRV
RL9_STRPN       TFGSITNKKIAEELQKQFGIKIDKRH---IQVQAPIRAVGLIDVPVKIYQDITSVINLRV
RL9_STRGC       TFGSITSKKIAEELEKQFGIKLDKRN---IKVDSPIRSVGLIDVPVKIYQDITGVINLRV
RL9_STRSV       TFGSITSKKIAEELQKQFGIKIDKRH---IKVDSPIRSIGLIDVPVKIYQDIAGVIRLRV
RL9_LACLS       TFGAVDKADIAKALKSQFGLKLDKRK---IQLINKIQALGTKDVPVKLHRDVTAMVKVKI
RL9_LACLM       TFGAVDKADIAKALKSQFGLKLDKRK---IQLINKIQALGTKDVPVKLHRDVTAVVKVKI
RL9_LACLA       TFGAVDKADIAKALKSQFNLKLDKRK---IQLINKIQALGTKDVPVKLHRDVTAVVKVKI
RL9_LEUMM       LFGAVSTKQIAAALEKQYQIKIDKRK---MELNQPIHALGYTDVPVKLHREVTAQLRVHV
RL9_OENOB       LNGSVTAKEIADQLAKQFNLTVDKRK---LQLPQPIKTIGLHEVPAKLHTQVSAMIKVNV
RL9_ALKOO       LFGSVTSKDLAETLEKQHHIKIDKRK---ITLPEPIRELGVRHVEIKLHVGVVGKLTVNI
RL9_ALKMQ       LFGSVTSKDVIEKLQKQEGIKLDKRK---LLLDEPIRELGSKWIDIKLHSGVVGKIKVTV
RL9_CLOD6       LFGSITSKEIAEQLKKQKDIDVDKRK---ILLDEPIRSLGSTFVEIKIHQKVTTKIRVDV
RL9_CALS4       LFGSVTSKDVEEALKEK-GFEIDKKK---IVLPENIKTTGTYYAEIKLYQGVTAKVQVDV
RL9_HUNT2       LFGSMTSKDVSDYLKKQHNLDIDKKK---ISLPESMKSLGTYEAEVKLYPGVSAKLTVKI
RL9_CLOTE       LFGSITGKDISDELKKKFKLDIDRRK---INV-ENIRQLGVYDVEIKLYPEVSTKIKVKI
RL9_CLOK5       IFGSITGKDISDELNKKFKINIDKKK---IVI-NNIRQLGTYDVEVKLYPEISTKIKVII
RL9_CLOAB       LFGAITSKDIAAEIKKQFNVDIDKKK---VNS-ETIRKLGNYEIELKLYPEISTKINVLI
RL9_CLONN       LFGAITNKDIATELKKQFKVDIDKKK---VVT-ETIKQLGEYEVELKLYPEISTKIKVII
RL9_CLOPE       LFGAITSKDVAGLIKKQFNVEVDKKK---IVM-DTIKIAGTYNIEVKLYPEVSTKMKVMV
RL9_CLOP1       LFGAITSKDVAGLIKKQFNVEVDKKK---IVM-DTIKIAGTYNIEVKLYPEVSTKMKVMV
RL9_CLOPS       LFGAITSKDVAGLIKKQFNVEVDKKK---IVM-DTIKIAGTYNIEVKLYPEVSTKMKVMV
RL9_CLOB8       LFGAITSKDVAELIREQYKIEIDKKK---IVM-DTIKLAGGYEIDIKLYPEVSTKMKVII
RL9_CLOB1       LFGSITSKDISEKLKEQYNMNIDKKK---IVA-ETIRQTGVYEAEIKIYPEVSTKVKVSV
RL9_CLOBH       LFGSITSKDISEKLKEQYNMNIDKKK---IVA-ETIRQTGVYEAEIKIYPEVSTKVKVSV
RL9_CLOBL       LFGSITSKDISEKLKEQYNMDIDKKK---IVA-ETIRQTGVYEAEIKIYPEVSTKVKVSV
RL9_CARHZ       LFGAITSKDIAEALEKNYQIKIDKRK---LDLKENIKALGVYTVEVKLHPEVTAKLKVAV
RL9_DESHY       LFGSVTNKEIAEALKASHGINLDRRK---LELKEPIKALGTFNVQAKLHPEVTAQFQVHV
RL9_LACP7       TFGSVSTKEIAIALKEQLGHDIDKKK---LVLNDPIKNMGTYTVPVKLHPKVTAELKVKV
RL9_DESRM       LFGAISNKDIADGLKSQHGYSIDKKK---IVLKEPIKNLGTYKITLKIHPVAQADINVEV
RL9_DEHMB       LYGQITTTVIAAEIEKQTGKTIDKRK---LELAEPIRQLGNYEVVIRFNKDLSSKINLAV
RL9_DEHMC       LYGQITTTVIAAEIEKQTGKTIDKRK---LELAEPIRQLGNYEVVIRFNKDLSSKINLAV
RL9_DEHM1       LYGQVTTTVIAAEIEKQTGKAIDKRK---LELSEPIRQLGSYEVVIRFNKDLSSKINLII
RL9_CALS8       LFGSITNKEIADEIKRQLGIDMDKKK---IELEDPIKQIGSYEVSIRLYQGIVAKLKVHV
RL9_MOOTA       LFGSVTNKEIAEAIKNTFQISLDRRK---IDLKEPIKALGSYEVTLKLHPTVQAHLRVQV
RL9_PELTS       LFGSVNNKDIAEALASQYNIVLDKKK---LLLKEPIKQLGMYSVAARLHPNIQAEVRVEV
RL9_SYMTH       LFGSVTNKDVADAIARHIGKPFDRKM---VELDAPIKTLGVHLVTLRFGHNITGKVNVEV
RL9_STRAW       LFGSVTPADVASAIK-ASGGPEVDKRRIELGS-P-IKTLGAHETSVRLHPEVAAKVNIEV
RL9_STRCO       LFGSVTPADVASAIK-AAGGPEVDKRRIELGS-P-IKTLGAHETSVRLHPEVDAKVSIEV
RL9_ACIC1       LFGSVTPDDIAAAVH-AAGGPKLDKRRIEISG-P-IKTIGSHQVTVRLHPEVSATVSVEV
RL9_KINRD       LFGAVTPADVALAVS-AAGGPTVDKRKVEILQ-P-IKTTGTHKALVRLHPDVSATVTIDV
RL9_FRACC       LFGSVTAADVVEAVT-AAGGPELDRRRVELTT-P-IKSLGAYTVAVHLHPEVTATVKLQV
RL9_FRAAA       LFGSVTAADVVEAVT-AAGGPELDRRRVELTT-P-IKSLGAYTVAVHLHPEVTASVKLQV
RL9_SALTO       LFGSVTAAEIVAAVK-AAGGPTLDRRRLELPG-H-IKSLGSYPVRIKLHPEVTAAFDLSV
RL9_SALAI       LFGSVTAAEIVAAVK-AAGGPTLDRRRLELPS-H-IKSIGSYPVRIKLHPEVTAAFDLSV
RL9_THEFY       LFGSVTSTDVAEAVK-AAGGPEVDKRRIQIRN-P-IKSVGDYTVEIRLHPEVNVSLPIEV
RL9_NOCSJ       LFGAVTVTEIAGALA-DASGEQVDKRTIVVTN-P-IKSLGAHEVSVKLHDEVSAVVALNV
RL9_CLAMS       LFGSVKTSDIAKAVE-ESGIGQVDKRKIEIPN-P-IKGTGNHEATIRLRDDIVATISLQV
RL9_CLAM3       LFGSVKTSDIAKAVE-ESGIGQVDKRKIEIPN-A-IKATGNHEATIRLRDDIVATISLQV
RL9_LEIXX       LFGSVKTADVAEAVK-AAGIGELDKRKIELPN-A-IKAVGDHEATVRLHEDLSAMITLQV
RL9_RENSM       LFGTVKAEDVAKAVE-AAGLGSIDKRKVEIPA-H-IKSVGKYQANVRLHEDVSAVIDLNV
RL9_PAEAT       LFGTVKPADVAAAVE-AAGLGAIDKRNVELPN-H-IKSVGSYTANVRLHEDVSAVIDLEV
RL9_ARTS2       LFGTVKQGDVADAVE-AAGLGRIDKRKVELPA-H-IKSVGSYQANVRLHDDVAAVIELDV
RL9_MYCGI       LFGSVTAADVVSAIK-KAGGPNLEKRTVDLPK-AHIKSTGTHPITVRLHPDVNAALSLNV
RL9_MYCVP       LFGSVTAADVVAAIK-KAGGPNLDKRTIGLPK-AHIKTTGAHDIAVRLHPEVTAALSLNV
RL9_MYCSK       LFGSVTATDVVAAIK-KAGGPNLDKRTVALPK-AHIKSLGTHSVSVRLHPGVEASVSLNV
RL9_MYCSS       LFGSVTATDVVAAIK-KAGGPNLDKRTVALPK-AHIKSLGTHSVSVRLHPGVEASVSLNV
RL9_MYCSJ       LFGSVTATDVVAAIK-KAGGPNLDKRTVALPK-AHIKSLGTHSVSVRLHPGVEASVSLNV
RL9_MYCS2       LFGSVTAADVVNAIK-KAGGPNLDKRTVQLAK-AHIKSVGTHPVTVKLHTGVEAKVSLNV
RL9_MYCA1       LFGSVTAGDVVAAIK-KAGGPNLDKRIVRLPK-AHIKALGTHPVAVHLHPEVDVEVALEV
RL9_MYCPA       LFGSVTAGDVVAAIK-KAGGPNLDKRIVRLPK-AHIKALGTHPVAVHLHPEVDVEVPLEV
RL9_MYCBO       LFGSVTAADVVAAIK-KAGGPNLDKRIVRLPK-THIKAVGTHFVSVHLHPEIDVEVSLDV
RL9_MYCBP       LFGSVTAADVVAAIK-KAGGPNLDKRIVRLPK-THIKAVGTHFVSVHLHPEIDVEVSLDV
RL9_MYCTU       LFGSVTAADVVAAIK-KAGGPNLDKRIVRLPK-THIKAVGTHFVSVHLHPEIDVEVSLDV
RL9_MYCTA       LFGSVTAADVVAAIK-KAGGPNLDKRIVRLPK-THIKAVGTHFVSVHLHPEIDVEVSLDV
RL9_MYCLE       LFGSVTAGDVVAAIK-KAGGPNLDKRIVRLPK-THIKAVGTHPVSVHLHPEVDVVVLLDV
RL9_MYCUA       LFGSVTAGDVVAAIK-KAGGPNLDKRIVRLAK-AHIKAVGTHPVVMHLHPEIEVELSVDV
RL9_NOCFA       LFGSVTQSDVAAAIK-AAGGPVIDKRSIELPK-SHIKSTGKHTIAVHLHPDVTAKFDLQV
RL9_RHOJR       LFGSVTAADVAGAIK-AAGGPVVDKRNLELPK-AHIKATGKHAIVVNLHPDVVAKFHLNV
RL9_CORGB       LFGSVKTDDIVDAVK-AAGGPNLDKRAIVLPK-NLVKTTGKYQVEAKLTDGIVSRVKFEV
RL9_CORGL       LFGSVKTDDIVDAVK-AAGGPNLDKRAIVLPK-NLVKTTGKYQVEAKLTDGIVSRVKFEV
RL9_COREF       LFGSVKADDIVDAVK-AAGGPNLDKRAIVLPK-NLVKTTGKYQVEAKIHEGIVSRVKFEV
RL9_CORDI       LFGSVKAEDVAAAVK-KAGGPNLDKRSIELPK-SLVKATGAYKVNVKLHSDIAATVNFEV
RL9_CORJK       MFGSVTADNIVDAVK-KANGRSLDKHSIKLRK-GDVKATGVYSVDVQLHEGIVASLSFEV
RL9_SACEN       LFGSITAADIVSAVR-KAGGPNLDKRSVDT-R-GHIKSLGKHAVDVRLHPDVKASVSVQI
RL9_CUTAK       LFGAVTPGDIALAVR-KAGGPALEKRSIEITK-P-IKTIGKHTVGVKLHDAIKGHVTVET
RL9_TROW8       LFGSVTAANIAKVLS-SASGHKIDRGKIEIDS-P-IKTLGEHTVKVKLHPNVKVDINVVV
RL9_TROWT       LFGSVTAANIAKVLS-SASGHKIDRGKIEIDS-P-IKTLGEHTVKVKLHPNVKVDINVVV
RL9_BIFAA       LFGGISAEKIAIALS-SKVEVNPK----NITV-EPIKTTGDFPATVALHPEITANFFVKV
RL9_BIFLO       LFGGISNEAIAVALS-DKAAVNPK----AIEV-ETIKTTGDFPAKVALHPEITASFFVKV
RL9_BORBP       LFHSINSLNIAEELL-KLG-FDIERKKIDIHH-GTLKAFGTYDVTVKLYEGISAIIKVEI
RL9_BORAP       LFHSINSLNIAEELF-KLG-FDIERKKIDIHH-GTLKTFGTYDVTIKLYEGISSIIKVEI
RL9_BORBU       LFHSINSLNIADELL-KLG-FDIERKKIDIHH-GTLKTFGTYDVTIKLYEGISSIIKVEI
RL9_TREDE       LYGAVTTQTLFDELQ-KLN-FDIERKRIEILG-QTVKSTGVHKAIVKLYENTSAEISFTV
RL9_TREPA       LYGAVTSHTVAEQLA-CMG-FEVERKRVEVPG-LTLKCVGNYHVTIRLYEEICAVVPVTI
RL9_VIBVY       LFGSIGTRDIADAIT-AAGVE-VVKSEVRLPE-GALRTTGEFEISVQLHSEVFATVKLQV
RL9_VIBVU       LFGSIGTRDIADAIT-AAGVE-VVKSEVRLPE-GALRTTGEFEISVQLHSEVFATVKLQV
RL9_VIBCB       LFGSIGTRDIAEAIT-AAGVE-VAKSEVRLPE-GALRNTGEFEISVQLHSEVFATINLQV
RL9_VIBPA       LFGSIGTRDIAEAIT-AAGVE-VAKSEVRLPE-GALRTTGEFEISVQLHSEVFATAKVQV
RL9_VIBC3       LFGSIGTRDIADAIT-AAGVK-VSKSEVRLPE-GALRNVGAYEVSVQLHSEVFATAKVQV
RL9_VIBCH       LFGSIGTRDIADAIT-AAGVK-VSKSEVRLPE-GALRNVGAYEVSVQLHSEVFATAKVQV
RL9_PHOPR       LFGSIGTRDIADAIT-AAGEA-VVKSEVRLPE-GALRNIGEYEVSIQLNSDVFAKVNLTI
RL9_ALIF1       LFGSIGTRDIAEAAT-AAGVE-IAKSEVRLPE-GALRTTGSFEVSIQLHSEVFATLKLEV
RL9_IDILO       LFGSIGTRDIADAVT-AAGVE-VKKSEVLMPH-GTLREVGEFDIELHLHADVFANITLKV
RL9_SHEB9       LFGSVGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSV
RL9_SHEB8       LFGSVGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSV
RL9_SHEB5       LFGSVGNRDIADAVT-AAGVE-LAKAEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSV
RL9_SHESM       LFGSVGTRDIADAVT-AAGVE-LAKAEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSV
RL9_SHESA       LFGSVGTRDIADAVT-AAGVE-LAKAEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSV
RL9_SHESR       LFGSVGTRDIADAVT-AAGVE-LAKAEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSV
RL9_SHESW       LFGSVGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSI
RL9_SHEPC       LFGSVGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSI
RL9_SHEON       LFGSVGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGDFEVEVQLHTEVKAVVKVSI
RL9_SHEAM       LFGSVGTRDIADAVT-AAGVE-LAKAEVRLPL-GALRTTGDFEVEVQLHTEVKSVVKVTV
RL9_SHEDO       LFGSIGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGNFEVEVQVHTEVKAVVKVTV
RL9_SHEFN       LFGSIGNRDIADAVT-AAGVA-LAKSEVRLPL-GALRTTGSFEIEVQVHAEVKAVVKIAI
RL9_SHELP       LFGSIGNRDIADAVT-AAGVE-LAKSEVRLPL-GAIRATGEFEIDVQLHAEVKAVVKLSV
RL9_SHEHH       LFGSIGNRDIADAVT-AAGVE-LAKSEVRLPL-GAIRTTGEFEVEVQVHTEVKAIVKLSV
RL9_SHEPA       LFGSIGNRDIADAVT-AAGVE-LAKSEVRLPL-GAIRTTGEFEVEVQVHTEVKAIVKLSV
RL9_SHESH       LFGSIGNRDIADAVT-AAGVE-LAKSEVRLPL-GALRTTGEFEVEVQVHTEVKAIVKLSV
RL9_PSEHT       LFGSIGTRDIADAIS-AVGVE-VAKSEVRLPL-GTIRETGEFDVSIAVHSEVTATIKVIV
RL9_PSEA6       LFGSVGTRDIALAIT-AAGVE-IAKSEVKLPT-GTLRETGEFEIDLQLHSEVTATIKLVI
RL9_COLP3       LFGSIGTRDIADAIT-EAGVE-ITKAEVRLPL-GAIRETGEFEIAIHLHHDVDTSIKVVV
RL9_PSYIN       LFGSIGTRDIATAIT-AAGVP-VVKSEVRLPE-GALRNTGLFEIAVVVHSEVSTIVKIEV
RL9_AERS4       LFGSIGTRDVADAIT-AAGVA-VAKSEVRMG--NVLRNTGEYEVVVQLHADVKATVQVQV
RL9_AERHH       LFGSIGTRDVAEAIT-AAGVA-VAKSEVRMG--NVLRNTGDYEVVVQLHADVKATVQIQV
RL9_ECOK1       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECOL6       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECO57       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECOLI       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_SHIF8       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_SHISS       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_SHIFL       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECOHS       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECOLC       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECOL5       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECOUT       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_ECO24       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_SHIBS       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_SHIDS       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVSFQVHSEVFAKVIVNV
RL9_SALTY       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKVIINV
RL9_SALPB       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKVIINV
RL9_SALAR       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKVIINV
RL9_SALPA       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKVIINV
RL9_SALCH       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKVIINV
RL9_SALTI       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKVIINV
RL9_CITK8       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVNFQVHSEVFAKLTVNV
RL9_CROS8       LFGSIGTRDIADAVT-AAGVD-VAKSEVRLPN-GVLRTTGEHEVDFQVHSEVFAKLTVNV
RL9_ENT38       LFGSIGTRDIADAVT-AAGVD-VAKSEVRMPN-GVLRTTGEHEVDFQVHSEVFAKLVVNV
RL9_KLEP7       LFGSIGTRDIADAVT-AAGVK-VAKSEVRLPN-GVLRNVGEHEVNFQVHSEVFAKVIINV
RL9_YERPA       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTAGEHEVHFQVHSDVFAKLNVVV
RL9_YERPN       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTAGEHEVHFQVHSDVFAKLNVVV
RL9_YERPS       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTAGEHEVHFQVHSDVFAKLNVVV
RL9_YERPP       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTAGEHEVHFQVHSDVFAKLNVVV
RL9_YERPE       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTAGEHEVHFQVHSDVFAKLNVVV
RL9_YERP3       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTAGEHEVHFQVHSDVFAKLNVVV
RL9_YERE8       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGDHEVHFQVHSDVFAKLNVIV
RL9_PECAS       LFGSIGTRDIADAVT-AAGVD-IAKSEVRLPN-GVLRTIGEHVVSFQVHSDVFAELNVVV
RL9_SERP5       LFGSIGTRDIADAVT-AAGVE-VAKSEVRLPN-GVLRTTGEHEVQFQVHSDVFAQLNVVV
RL9_PHOLL       LFGSVGTRDIADAVT-AAGVE-VSKSEVRLPN-GVLRTIGEHEVNFQVHSDVFAKLNVNI
RL9_SODGM       LFGSIGTRDIADAIT-AAGIN-VSKSEVRLPN-GVLRTTGDHDVSIQVHSEVFASLNVVI
RL9_BAUCH       LFGSIGTRDIANAIS-MAGIN-TKKSEVRLPN-GVLRTTGNHIVSIRIHSDISVAINVLV
RL9_ACTP2       LFGSISAKDIADALT-AAGVA-VAKSEVRLGE-GPLRTTGEHEVKVHLHPEVNAAVTVNV
RL9_HAEDU       LFGSISAKDIADALV-AAGIE-VTKSEVRLGE-GPLRTTGEHEVKVHLHAEVNAMVTVNV
RL9_ACTSZ       LFGSITTRDIADAVT-AAGVE-VSKSEVRLST-GPLRTTGDHEVRFQLHGEVFTTLNVVV
RL9_MANSM       LFGSITTREIAEAVT-AAGVE-VAKSEVRLST-GPIRTLGDHEVKFQLHGEVFTALNVIV
RL9_PASMU       LFGSITTRDVADAVT-AAGVE-VAKSEVRLST-GPIRTLGDHEVKFQLHGEVFATINVIV
RL9_HAEIE       LFGAITTRDVAEAVT-AAGVK-IAKSEVRLPN-GPIRTLGDHDVRFQLHGEVFAALDVIV
RL9_HAEIN       LFGAITTRDVAEAVT-AAGVK-IAKSEVRLPN-GPIRTLGDHDVRFQLHGEVFAALDVIV
RL9_HAEIG       LFGAITTRDVAEAVT-AAGVK-IAKSEVRLPN-GPIRTLGDHDVRFQLHGEVFATLDVIV
RL9_HAEI8       LFGAITTRDVAEAVT-AAGVK-IAKSEVRLPN-GPIRTLGDHDVRFQLHGEVFATLDVIV
RL9_HAES1       LFGSITARDVAEAVT-AAGVE-IAKSEVRLST-GPLRTTGEHQVRFQLHGEVFATLNVVI
RL9_HISS2       LFGSITARDVAEAVT-AAGVE-IAKSEVRLST-GPLRTTGEHQVRFQLHGEVFATLNVVI
RL9_MARHV       LFGSIGVRDIADAVS-TGGTE-VEKSEVRLPE-GPIRVTGEYDIELQLHTDVEVTIKLAV
RL9_HAHCH       LFGSVGTKDIADAVT-ALGVE-VEKSEVRLPE-GALRNTGEYEVDVQMHTDVTATVKVIV
RL9_PSEMY       LFGSIGTHDIADALT-ASGVE-VAKAEVRLPN-GTIRQVGEYDVALHLHTDVEATVKVIV
RL9_PSEU5       LFGSIGTADIADALT-ASGVE-VAKSEVRLPN-GTIRQTGEYDVAVHLHTDVEATVKLIV
RL9_PSESM       LFGSIGTHDIADALT-ASGVE-VAKSEVRLPN-GTIRNVGEFDVAVHLHSDVEATVRVVV
RL9_PSEU2       LFGSIGTHDIADALT-ASGVE-VAKSEVRLPN-GTIRNVGEFDVAVHLHSDVEATVRVVV
RL9_PSE14       LFGSIGTHDIADALT-ASGVE-VAKSEVRLPN-GTIRNVGEYDVAVHLHSDVEATVRVVV
RL9_PSEF5       LFGSIGTHDIADALT-ASGVE-VAKSEVRLPN-GTIRNVGEFDVAVHLHAEVEATVRVVV
RL9_PSEPF       LFGSIGTHDIADALT-ASGVE-VAKSEVRLPN-GTIRNVGEFDVAVHLHAEVEATVRVVV
RL9_PSEP1       LFGSIGTHDIADALT-ASGVE-VAKAEVRLPN-GTIRQVGEYDVAVHLHSDVEATVRVVV
RL9_PSEPK       LFGSIGTHDIADALT-ASGVE-VAKAEVRLPN-GTIRQVGEYDVAVHLHSDVEATVRVVV
RL9_PSEPG       LFGSIGTHDIADALT-ASGVE-VAKAEVRLPN-GTIRQVGEYDVAVHLHSDVEATVRVVV
RL9_PSEE4       LFGSIGTHDIADALT-ASGVE-VAKAEVRLPN-GTIRQVGEYDVAVHLHSDVEATVRVVV
RL9_PSEA7       LFGSIGTRDIAEAVS-AAGYP-LEKAEVRLPN-GALRNTGEFDVAVHLHTDVETTLKLII
RL9_PSEAE       LFGSIGTRDIAEAVS-AAGYP-LEKAEVRLPN-GALRNTGEFDVAVHLHTDVETTLKLII
RL9_PSEAB       LFGSIGTRDIAEAVS-AAGYP-LEKAEVRLPN-GALRNTGEFDVAVHLHTDVETTLKLII
RL9_CHRSD       LFGSIGPRDLADALT-QAGLD-VVKSEVRMPE-GPIRKTGEYDITLQLHAEVTSSVRIVV
RL9_SACD2       LFGSVGARDIANAIT-AAGVN-VTKAEVKLPE-GTLREVGEYEIDLQLHVDVTHVVKVVI
RL9_PSYCK       LFGSIGTRDIAEALT-NSGLE-VDRAEIKLPE-GTLRQIGEYNVDIQLHHDVTATILVTI
RL9_PSYA2       LFGSIGTRDIAEALT-NSGLE-VDRAEIKLPE-GTLRQIGEYNVDIQLHHDVTATILVTI
RL9_PSYWF       LFGSIGTRDIADALT-KSGLE-VDRAEVKLPE-GTLRQVGEYNVDIQLHHDIFASILVTI
RL9_ACIBT       LFGSIGTRDIADALT-NAGLT-VDRAEVRLPN-GALRHTGEFNIAIQLHHDVVAEVLVTI
RL9_ACIAD       LFGSIGTRDIADALT-NAGLA-VDRAEVRLPN-GALRHTGEFNIAIQLHHDVVAEVLVTI
RL9_ALCBS       LFGSVGTRDIAEAISSSTGVD-VEKAEVKLPH-GALRTTGEFEIDLALHAEVTVAIKLAV
RL9_MARMS       LFGSIGTRDIADAI--STQVA-VEKAEIRLPE-GAIRHTGSFEVDVQLHSEVIVTVTLEV
RL9_HYDCU       LFGSIGTADIADALS-KAGFD-VERKNIRMPE-GALRYVGTFEFDVELHSDVVASITVEV
RL9_NITOC       LFGSVGAADIAEALT-KAGVE-IGKKEVRLPE-GALRQVGEYELVIHLHPTVEAPIKVVV
RL9_ALKEH       LFGSVGTQDVADAIT-AAGVE-VARREVRMPE-GPIRVTGEYELELGLHTDVTALVKVVV
RL9_HALHL       LFGSVGPADIAEAAE-QAGVE-LARREVRMPE-GPIRVAGEYDVQVSLYTDVEGTVKVVV
RL9_XYLFA       LYGSVGARDIAEAFT-AVGLP-LEKKEVILGE-GPFRLIGEYDVLLHLHADVESTVKVIV
RL9_XYLFT       LYGSVGARDIAEAFT-AVGLP-LEKKEVILGE-GAFRLIGEYDVLLHLHADVESTVKVIV
RL9_XANC5       LYGSVGPRDIAEAFT-AAGLP-LEKSEVILGE-GAFRNVGEYDVVLHLHADVETTVKVIV
RL9_XANAC       LYGSVGPRDIAEAFT-AAGLP-LEKSEVILGE-GAFRNVGEYDVVLHLHADVETTVKVIV
RL9_XANC8       LYGSVGPRDIAEAFT-AAGLP-LEKSEVILGE-GAFRNVGEYDVVLHLHADVETTVKVIV
RL9_XANCP       LYGSVGPRDIAEAFT-AAGLP-LEKSEVILGE-GAFRNVGEYDVVLHLHADVETTVKVIV
RL9_XANOR       LYGSVGPRDIAEAFT-AAGLP-LEKSEVILGE-GAFRNVGEYDVVLHLHADVETTVKVIV
RL9_XANOM       LYGSVGPRDIAEAFT-AAGLP-LEKSEVILGE-GAFRNVGEYDVVLHLHADVETTVKVIV
RL9_METCA       LYGSVGTKDIAEAVT-AAGVP-VERHEVRLPH-GPIRLAGDYEITLHLHSDVNATLNLKV
RL9_COXBR       LFGSIGPREIAQAIT-EAGIE-IEKREVDLSQ-GPIRQVGEYEVPLRLHTDVSVNVKIEV
RL9_COXBU       LFGSIGPREIAQAIT-EAGIE-IEKREVDLSQ-GPIRQVGEYEVPLRLHTDVSVNVKIEV
RL9_COXBN       LFGSIGPREIAQAIT-EAGIE-IEKREVDLSQ-GPIRQVGEYEVPLRLHTDVSVNVKIEV
RL9_LEGPH       LYGSVGVNEIKDALI-EKQIE-ISKREIVMPE-GPLHSIGNYVVEVHVHSDVVANLQVEI
RL9_LEGPC       LYGSVGVNEIKDALI-EKQIE-ISKREIVMPE-GPLHSIGNYVVEVHVHSDVVANLQVEI
RL9_LEGPL       LYGSVGVNEIKDALI-EKQIE-ISKREIVMPE-GPLHSIGNYVVEVHVHSDVVANLQVEI
RL9_LEGPA       LYGSVGVNEIKDALI-EKQIE-ISKREIVMPE-GPLHSIGNYVVEVHVHSDVVANLQVEI
RL9_DICNV       LFGSVGTQQIVAAAE-QQGLQ-LERQEVMMPH-GTIRELGEYVVDLKLYGDIEAQVTVRV
RL9_FRATW       LFGSVGTAEVAEAVSNQSGKK-IEKSQVRMPE-GVIRSIGEFELTVHVYTDVDADIKVNV
RL9_FRAT1       LFGSVGTAEVAEAVSNQSGKK-IEKSQVRMPE-GVIRSIGEFELTVHVYTDVDADIKVNV
RL9_FRATT       LFGSVGTAEVAEAVSNQSGKK-IEKSQVRMPE-GVIRSIGEFELTVHVYTDVDADIKVNV
RL9_FRATH       LFGSVGIAEVAEAVSNQSGKK-IEKSQVRMPE-GVIRSIGEFELTVHVYTDVDADIKVNV
RL9_FRATF       LFGSVGIAEVAEAVSNQSGKK-IEKSQVRMPE-GVIRSIGEFELTVHVYTDVDADIKVNV
RL9_FRATN       LFGSVGTAEVAEAVSNQSGKK-VEKSQVRMPE-GVIRSVGEFEFTVHVYTDVDADIKVNV
RL9_FRAP2       LFGSVGTAEVAEAVSQASGKE-IEKSQVRMPE-GVIRSIGEFELTIHVYTDVDADIKVNV
RL9_AZOSB       LFGSVTNADVAEALA-AQGFE-IERSTVRMPD-GPLKQIGDTQLEVALHSDVVVSITVSV
RL9_AROAE       LFGSVSNIDIVDALE-TQGFK-VERSAVRMPE-GPIKQVGDSQVDVALHSDIVVPITVSV
RL9_METFK       LFGSVTNGDIAEALT-AQGFE-VSKSEVRLPE-GPLKAIGDYQVHIALHHDVVVEITVSV
RL9_NITMU       LFGSVTNADIEDALK-AQGFE-VERSMIRMPQ-GSLKQVGDHPVTIVLHTDVAAHIIVSV
RL9_DECAR       LFGSVGNADIADALK-AAGYV-VDKSAVRMPE-GPLKAIGEFPLDVALHTDVLANITVAI
RL9_POLAQ       LFGSVTNHDIADALK-AKGFT-IEKSSVRMPT-GPLKMVGDHPVAVAVHTDVVADITIRV
RL9_BORBR       LFGSVTNADVAEGLR-KAGFEAVEKSQVRMPN-GQIKAVGEYPVQAVLHADVVADVVVLV
RL9_BORPA       LFGSVTNADVAEGLR-KAGFEAVEKSQVRMPN-GQIKAVGEYPVQAVLHADVVADVVVLV
RL9_BORPE       LFGSVTNADVAEGLR-KAGFEAVEKSQVRMPN-GQIKAVGEYLVQAVLHADVVADVVVLV
RL9_BORA1       LFGSVTNADIAEGLR-TAGFEGVEKSQVRLPN-GQLKTVGEFPIQVGLHADVLVDVTVLV
RL9_ACIAC       LFGSVTNHDIAEELN-KQGYK-IAKSQVRLPS-GPIKTVGDSTVSVALHTDVVVEVTVSV
RL9_ACISJ       LFGSVTNHDIAEELN-KQGYN-VVKSQVRLPN-GPIKVVGDNTVTVALHTDVAVEVTVSV
RL9_VEREI       LFGSVTNHDIAEELN-KQGFK-LAKSRIRLPN-GPIKMVGDNTVSVVLHTDVVVEVIVSV
RL9_POLNA       LFGSVTNADIAQEVT-KQGFA-VSKSQIRLPN-GPIKTVGDHAINIALHTDVVVDITVTV
RL9_POLSJ       LFGSVTNHDISAELT-KQGFP-VLKSQIRMPN-GPLKTVGDHAVSVALHTDVAVDITVTV
RL9_RHOFT       LFGSVTNADIAEELT-KTGFK-VTKAQIRMPN-GPIKVVGDSKVSVALHTDVLVEITVSV
RL9_METPP       LFGSVTNHDIAEALG-KAGFK-VVKSQVRLPN-GPLKTVGEHPVTVALHTDVVVDVNVTV
RL9_CUPNH       LFGSVTNADIAEALA-GQGFK-LEKAQVRMPN-GPLKMVGDHPVSVALHTDVVVDVTVSV
RL9_CUPMC       LFGSVTNADIAEALA-GQGFK-LEKAQVRMPS-GPLKVVGDHPVSVALHTDVVVDVTVAV
RL9_CUPPJ       LFGSVTNADIAIALG-TQGFK-VEKAQVRLPN-GPLKTVGEHPVAVALHTDVVVDVTVAV
RL9_RALSO       LFGSVTNHDIAAALT-AQGFK-VEKAQVRMPN-GPLKTVGDHPVAVSLHTDVSVDVTVSV
RL9_PARXL       LFGSVTNADIAEALV-KQGFA-VEKAQVRLPE-GPLKLVGEHAVQISLHTDVLVDVTVAV
RL9_BURP1       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURMS       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURP0       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURMA       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURM7       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURPS       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURM9       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURP6       LFGSVTNGDVAELLK-KAGYE-IEKAQVRMPE-GPLKMIGEHGVQVALHTDVLVDVTVNV
RL9_BURTA       LFGSVTNGDVAELLK-KAGYE-VEKAQVRMPE-GPLKMIGEHGVQVALHTDVVVDVTVNV
RL9_BURCA       LFGSVTNGDVAELLK-KAGYE-VEKLQVRMPE-GPLKMIGEHNVQVALHTDVVVDVTINV
RL9_BURCH       LFGSVTNGDVAELLK-KAGYE-VEKLQVRMPE-GPLKMIGEHNVQVALHTDVVVDVTINV
RL9_BURL3       LFGSVTNGDVAELLK-KAGFE-VEKLQVRMPE-GPLKMIGEHSVQVALHTDVVVDITINV
RL9_BURVG       LFGSVTNGDVAELLK-KAGFE-VEKLQVRMPE-GPLKMIGEHVVQVALHTDVVVDVTINV
RL9_BURCM       LFGSVTNGDIAELLK-KAGYE-VEKLQVRMPE-GPLKMIGEHTVQVALHTDVVVDVTINV
RL9_JANMA       LFGSVTNSDIAEALT-KQGFA-VEKAQVRLPT-GPLKVAGDHVVAVALHTDVVVDVTITV
RL9_HERAR       LFGSVTNADIAVALT-KQGFA-VEKAQVRMPT-GPLKVTGDHTVAVALHTDVVIEVTITI
RL9_THIDA       LFGSITNADIAEALQ-AQGHD-VAKADVRLPD-GPLKALGEYPVVLSLHSDVSANITVVV
RL9_NEIMB       LFGSVTNADIAAAIV-AAGIE-AVKANVRLPN-GPLKAVGEYEVEVALHTDAVAKITVAV
RL9_NEIMF       LFGSVTNADIAAAIV-AAGIE-AVKANVRLPN-GPLKAVGEYEVEVALHTDAVAKITVAV
RL9_NEIMA       LFGSVTNADIAAAIV-AAGIE-AVKANVRLPN-GPLKAVGEYEVEVALHTDAVAKITVAV
RL9_NEIM0       LFGSVTNADIAAAIV-AAGIE-AVKANVRLPN-GPLKAVGEYEVEVALHTDAVAKITVAV
RL9_NEIG1       LFGSVTNADIAAAIV-AAGIE-AVKANVRLPN-GPLKAVGEYEVEVALHTDAVAKITVAV
RL9_NEIGO       HNGSVTNADIAAAIV-AAGIE-AVKANVRLPN-GPLKAVGEYEVEVALHTDAVAKITVAV
RL9_CHRVO       LFGSVTNVDVAEAVT-AFGVQ-IKRHEVRLPN-GPFKAIGEYDIEIALHHDVVTPIKIVV
RL9_NITEU       LFGSVTSANITEELR-KQDFP-VEKSMIRMPE-GQIKQIGDYTVTVVLHSEVSAHITVSV
RL9_NITEC       LFGSVTSANIAEELC-KQDFA-IEKSMIRMPE-GQIKQVGDYTVIVVLHNEVSAHITVSV
RL9_VESOH       LFGSINTTDIQTSLI-KSGFK-IEKRNIDIP--ETIRHTGEYKININLHTNITVSVKIVI
RL9_RUTMC       LFGSINTSDIQISLA-ASGFE-VEKRNINMP--ETIHHTGKYEISVDLHTDITVSIKVVI
RL9_BUCAI       IFGSVGVRNIIKEII-LLGIK-INKKEIRLPN-GLLRQVGEHIVVFQPHSKVSINFIVKI
RL9_BUCAP       IFGSIGIRNIIKEMN-LLGIK-VNKKEIKLPN-GVLRQVGEHKVIFQPHNEVCEYFIVNI
RL9_BUCBP       LFGSVGSRDIAKKLSELSNIK-IKKHEIYFLN-GALKHVGQHKVIFKPHHSVSITVEINI
RL9_BUCCC       IFGSIGVKDISKQLI-SLGLL-IKKNEIKLPN-GLLHYLGSHTVLFTPYKNISTEFKVVI
RL9_WIGBR       LFGSIGANHIIEKIK-ERGIR-IMKNEIKLTN-GPLKTIGKHNIKIKVKSNMCTEICVIL
RL9_BLOPB       LFGSIGSRDIATAITAASGFN-ISKSQIRLPNHDVLRTIGTYSINIHIYNDIFSKINVII
RL9_BLOFL       LFGSIGSRDIAKLITESVGFE-VHKSQIRLPNRDALKSIGEHNVCIHVYNEIYANLTVHI
RL9_PELUB       LYGSVKPTEISKLILENDKLD-IKPSMIQPIT--EIKSIGKFKVKIILHSEVDSEITINV
RL9_WOLPM       IFGSVTTREIAKILLQEGHVIDHRSLSFGGVS---IKNLGEYQVNVELHSEVVVPITIYV
RL9_WOLTR       IFGSVTTREVARSLSQE-YEVDHRKISFNGVK---IRNLGEYQASIEFHSEIVVQVAVHV
RL9_ANAPZ       LFGSVAVRDVAKLLGSLGYNVQPKEVFFSEV----IKRIGEYEINVELHADLVAVVKLYV
RL9_ANAMM       LFGSVTVRDVSKLLCDLGYDIQPRCVSFSEV----IKRTGEYEINVELHADLVAALQLHV
RL9_EHRCR       LFGSVTPKCISKLLSDKGYNIHYRNIFFYSV----IKYIGEYVVNLELHPDLVLPITLYV
RL9_EHRCJ       LFGSVTPKCISKLLSDKGYNIHYRNIFFYSV----IKYIGEYVVNLELHPDLVLPITLYV
RL9_EHRRW       LFGSVTPKCISKLLSDKGYNIHYHNIFFHSV----IKYIGEYVVNLELHHDLVVPMMLYV
RL9_EHRRG       LFGSVTPKCISKLLSDKGYNIHYHNIFFHSV----IKYIGEYVVNLELHHDLVVPMMLYV
RL9_NEOSM       LFGAVSAKQVVAELSKKGIEITTKNVVLGAP----IKALGEHEVRIFLHSRVECSLKIHI
RL9_RICPR       LFGSVTNKDIADKLSKNISYN---ISHSNIILDKQIKSTGIYTVEIRLHAELTSIVTVVV
RL9_RICTY       LFGSVTNKDIADKLSKNISYN---ISHSNVILDKQIKSTGIYTVEIRLHAELTAIVTVIV
RL9_RICRS       LFGSVTNKEIANKLSENISYN---ISHSNVILDKQIKSTGIYTVEIRLHAELNAIVTVIV
RL9_RICRO       LFGSVTNKEIANKLSENISYN---ISHSNVILDKQIKSTGIYTVEIRLHAELNAIVTVIV
RL9_RICCN       LFGSVTNKEIADKLSENISYN---ISHSNIILDKQIKSTGIYTVEIRLHAELNAIVTVIV
RL9_RICM5       LFGSVTNKEIADKLSENVSYN---ISHSNIILDKQIKSTGIYTVEIRLHAELNAIVMVIV
RL9_RICFE       LFGSVTNKEIADKLSENVSYN---IAHSNIILDKQIKFTGIYTVEIRLHAELNAIVTVIV
RL9_RICAH       LFGSVTNKEIADKLSKNVSYN---ISHSNIILDKQIKSTGVYTVEIRLHAELNDIVTVIV
RL9_RICCK       LFGSITNKEIADKLSENVSYN---IFHSNIILDKKIKSTGIYTVEIRLHAELNAIVTVIV
RL9_RICBR       LFGSVNNKEIAEKLSQAVSYP---ISHLNIILDTQIKSTGIYKVEVRLHAELSTEVTVIV
RL9_RICB8       LFGSVNNKEIAKKLSQAVSYP---ISHLNIILDTQIKSTGIYKVEVRLHAELSTEVTVIV
RL9_ORITB       LFGSITAKEIIKKL--QISSD---IKAYIDI--KPIKTAGIHEVEVSLHAEVHCKIFINV
RL9_RUBXD       LFGSVTAANIAEAIEKARGIH-LDRRKIRLEE--PIRSLGTHQVPVQVHGEIEASVKVIV
RL9_RHOBA       LYGSVGPHEIVDAL-KASGIT-LAQDQIRLEG--PLKELGLYTVKIHLHSEVDASLKVWV
RL9_DESPS       LFGSVTNSDICAAL-AAQDIV-LDKRQIILPD--PIKTVSETPVLIKVGFQVATEVVVKV
RL9_RHOS1       LYGSVTTRDAAEAATEA--GFTVGRGQIVLDR--PIKDLGLHTVTVTLHPEVVVKITLNV
RL9_RHOS4       LYGSVTTRDAAEAATEA--GFTVGRGQIVLDR--PIKDLGLHTVTVTLHPEVVVKITLNV
RL9_RHOS5       LYGSVTTRDAADAATEA--GFTVDRGQVVLDR--PIKELGLHTVTVTLHPEVAVKITLNV
RL9_DINSH       LYGSVTTRDAAEAATAD--GFSLDRKQVSLSR--PIKELGLHTVHVTLHPEVTADIVLNV
RL9_ROSDO       LYGSVTTRDAAEAATEA--GFTVDRKQVVLS---PIKELGLHAVQVVLHPEVDATIHLNV
RL9_RUEPO       LYGSVTPRDAAEAATEA--GFSVDKKQIALIA--PIKDLGLHTVAVRLHPEVEVSINLNI
RL9_RUEST       LYGSVTTRDAADVATEE--GFSVDRKQVIIRE--PIKTLGLHIAEVHLHPEVMVTIELNV
RL9_PARDP       LYGSVTPRDAADVAIAE--GFAVERRQVVLTA--PIKELGLHEVRVHLHPEVDVTIKLNV
RL9_JANSC       LYGSVTIRDAAEAATAE--GFTVDRKQVALIA--PIKDLGIHTVMVILHPEVEVEIELNV
RL9_RHOCB       LYGSVTPRDAAEAATAG--GFSVDKRQVALKA--PIKELGLHDVHVILHPEVQATITINV
RL9_RHILO       LYGSVSTRDIAELLTAE--GFSVNRNQILLNQ--PIKTIGLTNVAIALHPEVEVTVTLNI
RL9_CHESB       LYGSVSARDIADVVASE--GFKIGRNQVDINQ--PIKTIGLTNVAIALHPEVVATVTLNI
RL9_SINMW       LYGSVAARDIVETLAAE--GFNINRNQVDLNQ--PIKAIGLHTVTLHLHGEVDVAIEINV
RL9_RHIME       LYGSVAARDIVETLAAE--GFNINRNQVDLNQ--PIKAIGLHKVTLHLHGEVDVAIEINV
RL9_RHILT       LYGSVAARDVVEILGAE--GFNIGRNQVHLNT--PIKSIGLHKVELQLHAEVEIHVELNV
RL9_RHIL3       LYGSVAARDVVDILGAE--GFNIGRNQVHLNT--PIKSIGLHKVELQLHAEVEIHVELNV
RL9_RHIEC       LYGSVAARDVVEVLAAE--GFNIGRNQVHLNT--PIKAIGLHKVELQLHAEVEINIELNV
RL9_AGRFC       LYGSVAARDVVEILGAE--GFNIGRNQVELNT--PIKTIGLHNVTLHLHAEVELQVELNV
RL9_BRUAB       LYGSVSTRDIAEIITAN--GFTLHRNQVELNH--PIKTIGLHEVSVSLHPEVQVKVMVNI
RL9_BRUA2       LYGSVSTRDIAEIITAN--GFTLHRNQVELNH--PIKTIGLHEVSVSLHPEVQVKVMVNI
RL9_BRUME       LYGSVSTRDIAEIITAN--GFTLHRNQVELNH--PIKTIGLHEVSVSLHPEVQVKVMVNI
RL9_BRUO2       LYGSVSTRDIAEIITAN--GFTLHRNQVELNH--PIKTIGLHEVSVLLHPEVQVKVMVNI
RL9_BRUC2       LYGSVSTRDIAEIITAD--GFTLHRNQVELNH--PIKTIGLHEVSVSLHPEVQVKVMVNI
RL9_BRUSI       LYGSVSTRDIAEIITAD--GFTLHRNQVELNH--PIKTIGLHEVSVSLHPEVQVKVMVNI
RL9_BRUSU       LYGSVSTRDIAEIITAD--GFTLHRNQVELNH--PIKTIGLHEVSVSLHPEVQVKVMVNI
RL9_OCHA4       LYGSVSTRDIADIISAN--GFTLHRNQVELNH--PIKAIGLHEVSISLHPEVQVQVTVNI
RL9_BARHE       LYGSVSTRDISEIITSE--GFSIGRNQVELNH--PIKTIGLHTIMLSLHPEVQISVIINV
RL9_BARQU       LYGSVSTRDISEIITSA--GFSIGRNQIELNH--PIKTIGLYLITLSLHPEVQISVVINV
RL9_BART1       LYGSVSTRDIAEIITDE--GFSIGRNQIELNH--PIKMIGLHTITLSLHPEVQISVVINV
RL9_BARBK       LYGSVSTRDITDIITMD--GFSIERNQIELNH--PIKTIGLHPVTLNLHPEVQISVTIHV
RL9_PARL1       LYGSVSTRDIATAMTDG--GFTAARNQVVLDK--PIKTIGLHDVRIVLHPEVSATIAINV
RL9_MAGSA       LYGSVSGKDVADAVKAA--GFTIERRMVNLDQ--PIKTLGSYGVRVSLHPEVSVVVTINV
RL9_RHORT       LYGSVSARDITDSLKAE--GFVIARSQVLLNH--PIKDLGRYETRVSLHPEVIVTITVVV
RL9_GLUDA       LYGSVTTRDIAEAATAA--GLTVARTQVILEN--PIKQLGLYDVRVALHPEVSIPVTVNV
RL9_GLUOX       LYGSVSTRDIAAAATEA--GLTISRQQVVLAH--PIKQLGLTEARIVLHPEVSIPLTVNV
RL9_GRABC       LYGSVSSRDIAVAITES--GLSVNRQQIQLDQ--PIKMLGLTDVRVVLHPEVVLPVTVNV
RL9_ACICJ       LYGSVTSRDIADACGEA--SLGITRSQVLLVH--PIKTLGLATVRVALHPEVLIDVVVNV
RL9_RHOP2       LFGSVSVRDIVTSFEAE--GVMISRSQILLDA--PIKTIGKHAIEVAVHPEVEVGVSVTV
RL9_RHOPS       LFGSVSVRDIVTSFEAD--GVKITRSQILLDA--PIKTIGRHTIEVAVHPEVEVGVSVTV
RL9_RHOPA       LFGSVSVRDIIASFDGQ--GVKIDRSQVLLDA--PIKTIGKHSIQVAVHPEVEVAVSVTV
RL9_RHOP5       LFGSVTVRDIIASFAAD--GIQISRSQVLLDM--AVKTIGKHQIAIAVHPEVEVAVSVTV
RL9_RHOPB       LFGSVTVRDIISQFTAD--GVHIERSQVLLDH--PVKTIGKHSISIAVHPEVEVSVSVTV
RL9_BRASO       LFGSVSVRDIVDALAAD--GITVSRPQVWLDA--PIKTIGQQKVTIAIHPEVETSVTVTV
RL9_BRASB       LFGSVSVRDIVVALAAD--GITVSRPQVWLDA--PIKAIGQQKITIAIHPEVETSVTVTV
RL9_NITWN       LFGSVTVRDIVAALAAD--GIIVSRPQVWLDA--PIKTIGQQKLTVAVHPEVEAEITVTV
RL9_NITHX       LFGSVTVRDIVAALAED--GITVSRPQVWLDA--PIKTIGQQKLTVAVHPEVEAHVMVTV
RL9_BRADU       LFGSVNVRDIVVAFEAD--GISLARPQIQLDA--PIKTIGKHTITVAVHPEVEVEITVTV
RL9_CAUVC       LYGSVAGRDVADAIKAE--GGKVDRSMVVLDK--PIKTLGVHEVKVKLHAEVTITVTLNI
RL9_CAUSK       LYGSVAGRDVADAIKAE--GGKVDRSMIVLDK--PIKTLGVHEVKVKLHAEVTVTVTLNI
RL9_MARMM       LYGSVTSRDIAEIVSES--GTKVVRSQIALNA--PIKTLGLHELKIKLHADVSVTVTINI
RL9_HYPNA       LYGSVTARDVAEAAEAA--GYKVDRAAVRLDK--PIKAVGLSEVSVRLHAEVSVKVQVNV
RL9_NOVAD       LYGSVSVRDISDALAEQ--GAKVTKSMIVLER--PIKTIGVYDVRVSLHPEVSVTVKVNV
RL9_SPHWW       LYGSVSARDIVEALAED--GIKVAKSGVVLGR--PIKTIGLHEVKISLHAEVSRTVKVNV
RL9_ZYMMO       LYGSVSARDLADAIVEAKPEAKVAKNQIVLDR--PIKSIGISEVRVVLHPEVAVKIKVNV
RL9_SPHAL       LYGSVSVRDIVDALAEDG-VTGVTKSMVELER--PIKSLGLVDVKVKLHPEVVVTVGVNV
RL9_MAGMM       LFGSVTSADIAVFYKDL--GLNIPRNIIDVLT--PIRTLGEHQVRVRLHPDVVRVISIQV
RL9_DESVH       LYGSVTTAIIGDGLAAQ--GIEVDRRRILLDS--AIRALGEYPVRVRLHADVTAEILVKV
RL9_DESVV       LYGSVTTAIIGDGLAAQ--GIEVDRRRILLDS--AIRALGEYPVRVRLHADVTAEILVKV
RL9_LAWIP       LYGSVTTSIIGHALAEQ--GIDIDRRRILLDA--PIRTLGQHTVRVRLHADVIAEFIVNV
RL9_DESAG       LYGSVTPAHIADALAEA--GVEIDRRRILLDA--PIRNLGEYDVRVRLHADVEAVIALKV
RL9_ANADE       LYGSVTALDVAEALAAR--GVQLDRRSIVLDE--PIKTLGEFEVPVKLHSEVAGKVKVTV
RL9_ANADF       LYGSVTAMDVAEALAAR--GLQIDRRAIDLAE--PIKTTGDFEVPVKLHSEVVGKVKVKV
RL9_MYXXD       LFGSVTALDIAEAVAAE--GQSIDRRHIHLPE--PIKALGNYEVELRLHRDVIAKIKLEV
RL9_SOLUE       LFGSVTSKDIADALTAQ--NYNIDRRKIQLDE--PIKTLGEFKIPVRLYKDVVAEITVIV
RL9_KORVE       LFGSVTTSDIATELEHK--GFKLDRRKLSLVE--PIKTTGDFKVALKLHRDVTVDIPVHV
RL9_GEOMG       LFGAVTNMELAEHLKAQ--GVEIDRKKIVLAE--PIKHVGEYTASVKVHPEVAAALKVVI
RL9_GEOSL       LFGSVTNMELAELLKAQ--GVEIDRKKIVLAE--PIKHVGEFTAVVKVHPEVAANLKVVV
RL9_GEOUR       LFGAVTNMELAEQMKAQ--GIEIDRKKIILAE--PIKHLGEFTATVKIHPEVNATLKVTV
RL9_PELPD       LFGSVTNMEIAAFLKEK--GVDIDRKKIALAE--PIKQVGEYSVPVKLHPEVTASLKVNV
RL9_PELCD       LFGSVTSMEIQAKLAES--GVEVDRKKIQLDE--PIKALGEYEVAVKLPAGILATVKVAV
RL9_SYNAS       LFGSVTAMDIEEALLAQ--NVKIDRKSIVLDE--PIKAIGEFPIVIKLGAGVTAEIKVNV
RL9_SYNFM       LYGSVSAADIQSALEER--GFIVARKDIQLDQ--PIKQLGEFTVSVRVDAQIAATVGVVV
RL9_LEPBL       LFGAVTPIDVASILKKN--GFELDKRKIEIAE--PIRNLGSYKIKIRLAEGIQPVITLHV
RL9_LEPBJ       LFGAVTPIDVASILKKN--GFELDKRKIEIAE--PIRNLGSYKIKIRLAEGIQPVITLHV
RL9_LEPIC       LFGAVTPIDVASILKKN--GFELDKRKIEIAE--PIRNLGSYKIKIRLAEGIQPTITLHV
RL9_LEPIN       LFGAVTPIDVASILKKN--GFELDKRKIEIAE--PIRNLGSYKIKIRLAEGIQPTITLHV
RL9_BDEBA       LFGTVTTTDISKELQKM--GHSIDRRDIHLEE--PIKVLGQHKAVVRYAEGMEAKIQIAV
RL9_THET8       IYGSVTAKDIAEALSRQHGVT-IDPKRLALEK--PIKELGEYVLTYKPHPEVPIQLKVSV
RL9_THETH       IYGSVTAKDIAEALSRQHGVT-IDPKRLALEK--PIKELGEYVLTYKPHPEVPIQLKVSV
RL9_THET2       IYGSVTAKDIAEALSRQHGIT-IDPKRLALEK--PIKELGEYVLTYKPHPEVPIQLKVSV
RL9_DEIRA       IYGAVTHQDVANSLD-QLGFD-VDRRKIDMPK--TVKEVGEYDIAYRAHPEVTIPMKLVV
RL9_DEIGD       IYGAVTHADVADALD-KLGFD-VDRRRIEMPK--TVKEIGEYDIAYRAHPEVTIPMKLVV
RL9_CHLCV       MYGSVTISDIIDEAAKKNIIL-TRKNFPHSHY--AIKNLGKKSVPLKLKEDVTATLFVEV
RL9_CHLAB       MYGSVTVSDIIAEAAKKNIVL-TRKNFPHAHY--AIKNLGKKSVPLKLKEDVTATLIVEV
RL9_CHLFF       MYGSVTISDIIAEAAKKNVIL-TRKNFPNAHY--AIKNLGKKSVPLKLKEGVTATLFVEV
RL9_CHLPN       MYGSVTIADIIAEAAKKNIFL-VRKNFPHAHY--AIKNLGKKNIPLKLKEEVTATLLVEV
RL9_CHLTR       MYGSVTVNDMISAAEQQGVVL-TRKNFPRSHS--GIKNLGRHVVGLKLKEGVTADLHLEV
RL9_CHLTA       MYGSVTVNDMISAAEQQGVVL-TRKNFPRSHS--GIKNLGRHVVGLKLKEGVTADLHLEV
RL9_CHLMU       MYGSVTVNDIISVADQKGVVL-TRKNFPRAHS--GVKTLGKHVIGLKLKEGVTADLHLEV
RL9_PARUW       MYGSVTVAEIVHLIQDHAKIE-LEKKDIQLKH--PIKTTGVHSLVVKLKEGVTANFNLKV
RL9_CHLAA       LYGSVTNADIAAKLHEVAGIE-IDRRKIGLED--PIKRTGEYEVPVELMSGVSSTLKVVV
RL9_CHLPM       LFGTVTAADIAEVLK-AQGVE-IDRRKITM--EAPVKTLGKYEAEVKLFSDVVVRVSFEV
RL9_PELLD       LFGTVTAGDIADALK-AVGVE-IDRRKITL--EAPVKLLGKYEAEAKLFSDVTVKVTFEV
RL9_CHLPD       LFGTVTSGDIADALK-AQGIE-IDRRKITL--EAPVKTLGKYEADAKVFSDVAVKISFEV
RL9_CHLTE       LFGTVTAGDIAEALK-AQGVD-IDRRKIHL--EAPIKALGKYEADAKLFMDITAKLSIEV
RL9_CHLCH       LFGTVTSADIAEALK-AQGFE-IDRRKITI--EAPIKALGKFEAAVKLFSDVTVAVQFEV
RL9_AQUAE       LFGSVTPADIVNALK-EKGIE-IERKNVVF--YHPIKEVGVFPVKIRLHKDVEVDIKVDV
RL9_PORGI       IFGSVTNIQIAEELA-KKGVE-VDRKIIVL--KPAVKEVGNYTAVVRLHKEVTVEIPFEV
RL9_PARD8       IFGSVTNIQVAEALA-KAGFENIDRKIIYI--KESVKEVGSYKAVLKLHKEVSVEVPFEV
RL9_BACFN       IFGSVGNIQIAEELA-KLGHE-IDRKIIVV--KDAVKEVGAYKAIVKLHKEVSVEIPFEV
RL9_BACFR       IFGSVGNIQIAEELA-KLGHE-IDRKIIVV--KDAVKEVGAYKAIVKLHKEVSVEIPFEV
RL9_BACTN       IFGSVSNIQIAEALA-KLGHE-IDRKIIVV--KDAVKEVGNYKAIVKLHKEVSVEIPFEV
RL9_BACV8       IFGSVSNIQIAEELE-KLGHK-VDRKIIVV--KDAVKEVGSYKAIVKLHKEVSVEIPFEV
RL9_CYTH3       IFGAVTSLQISDALA-KKGIS-VDRKKIAF--KGDVKDAGEHTALIDLHKEVKVELKFTV
RL9_FLAJ1       LFGSITNIDIAEALE-KSGNA-IDRKFIT---SGVVKRIGKYNATVRLHRDVIVELPYEI
RL9_FLAPJ       LFGSITNIDIAEALA-KGGQS-IDRKFIT---SGIVKRTGKYNASVRLHRDVIVELAYEI
RL9_GRAFK       LFGSITNGDLADALA-KEGVE-IEKKYISIA-GGNIKRLGQYDATLRFHREVISNFSFDV
RL9_THEEB       LFGSVTPQDVADAIQAITGETIDRREMIL----PEIRKLGTYTAEIKLHPEVTVKLNIQV
RL9_SYNEL       LFGSVTPQDVADAIQAITGETIDRREMIL----PEIRKLGTYTAEIKLHPEVTVKLNIQV
RL9_ACAM1       LFGRVTSPDVAELIANISGFEIDKRGIDI----PDIRKLGTYSVDIKLHPEVIATVKVEV
RL9_SYNP6       IFGTVTNGDVAEAIQVATTQEVDRREITL----PEIHKLGFYKVQVKLHADVTAEVEIQV
RL9_SYNE7       IFGTVTNGDVAEAIQVATTQEVDRREITL----PEIHKLGFYKVQVKLHADVTAEVEIQV
RL9_SYNY3       IFGTVTTQEVADAVEAATNQSLDRRGISL----PDIHKTGFYQAQIKLHPEVIATVEVQV
RL9_TRIV2       IFGTVTSQDVADAIQAATSQEVDRRGITI----PDIGKLGTYKAEIKLFSDVTAQIDIEV
RL9_NOSS1       IFGTVTSQDVADAIQAATSQEVDRRGITI----PDIGKLGTYKAEIKLFSDVTAQIDIEV
RL9_TRIEI       IFGTVTDRELVEVIKESTGQEIDRRGVTL----PEISKIGFYKAEIKLHPEVIAEVEIQV
RL9_MICAN       IFGTVTSQDVATVILENAKLEIDRRGITV----PDIGQLGVYKVQVKLHPEVSADIEIKV
RL9_SYNPW       LFGTVTNGDVAEVIEEATKKEVDRRDITV----PDIHRTGNYKVSVKLHSEVTAEINLEV
RL9_SYNS3       LFGTVTNGDVAEAIESATKKEVDRRDITV----PDIHRTGSYKVQVKLHSEVTAEINLEV
RL9_SYNPX       LFGTVTNGDVAEAIQDATKKEIDRRDIVV----PEIHRTGKYSVTVKLHSEVTAEINLEV
RL9_SYNSC       LFGTVTNGDVAEAIETATKKEIDRRDIVV----PEIHRTGKYTVTVKLHSEVTAEINLEV
RL9_SYNS9       LFGTVTNGDVAEAIEESTKKEIDRRDILV----PEIHRTGKYTVTVKLHSEVTAEINLEV
RL9_PROMM       LFGTVTNGDVAEAIETATKKEIDRRNIIV----PEIHRTGSYKVQVKLHNEVNAEINLEV
RL9_PROM3       LFGTVTNGDVAEAIETATKKEIDRRNIIV----PEIHRTGSYKVQVKLHNEVNAEINLEV
RL9_SYNR3       LFGTVTNVDVAEAIESATKKLVDKRDITV----PEVHRTGNYKVQVKLHPEVVAEINLEV
RL9_PROMT       LFGTVTNGDVAEVVKEATKKDIDRRDISI----PEIHGVGKYKVQIKLHNEVNAEINLEV
RL9_PROM1       LFGTVTNGDVAEVVKEATKKDIDRRDISV----PEIHGVGKYKVQIKLHNEVNAEINLEV
RL9_PROMA       LFGTVTNGDVSEAIQLATQKEIDRRNIIV----PEIHETGKYKVQVKLHSEVTAEINLEV
RL9_PROM0       LFGTVTNGDVAEAIEAATKKEIDRRNITV----PDIHNLGSFTAKIKLHPEVNAEVNIEV
RL9_PROM2       LFGTVTNGDVAEAIEEATKKEIDRRNITV----PDIHNLGSFTAKIKLHPEVNAEVNIEV
RL9_PROM9       LFGTVTNGDVAEAIEAATKKEIDRRNITV----PDIHNLGSFTAKIKLHPDVNAEVNIEV
RL9_PROMS       LFGTVTNGDVAEAIEAATKKEIDRRNITV----PDIHNLGAFTAKIKLHPEVNAEVNIEV
RL9_PROMP       LFGTVTNGDVAEAIEAATKKDIDRRDITV----PDIHNLGSFVAKIKLHQEVSAEVNIEV
RL9_PROM5       LFGTVTNGDVAEAIQSATKKDIDRRDITV----PDIHNLGSFVAKIKLHQEVSAEVNIEV
RL9_SYNJB       LFGQVTTSDIAEVVLATSGLDIDRRNILLN---EEIKKTGVYPVQVKLHPEVTATLRIQV
RL9_SYNJA       LFGQVTASDIAEVVLATSGLDIDRRNVLLD---EEIKKTGVYLVQVKLHPEVTATLRIQV
RL9_GLOVI       LFGTVTNQDVAEVVASKAGITIDRREITIE---EPIKRTGVYTVKARIFQDVVATLRLQV
RL9_SALRD       IFGTVTTQQIAVELSN-RGFNIDRRDIELD---EDIRFVGAYTASIDLGYGIEATLDIQV
RK9_PYRYE       IFGSVTEKEISQIIKNTTNIDIEKQSISL----PDVKTIGIYDVEIKLLHQVTANIKLQV
RK9_PORPU       IFGSVTEKEISQIIKNTTNVDIDKQNILI----PEIKTIGLYNIEIKLFNQVTANIQLQV
RK9_GRATL       IFGSVNDKEIISKLFSITGEKLEKKNIYL----PNIKALGIYNLNIIFTSDIQVSMKLQI
RL9_UREPA       TFGSISNKQIIDEINK-EQKFITK-HMITKPH---ALGIGEHIVEILLHKKVTAKLHVIV
RL9_UREP2       TFGSISNKQIIDEINK-EQKFITK-HMITKPH---ALGIGEHIVEILLHKKVTAKLHVIV
RL9_MYCGE       PYGSIITKQIINLAKQ-QRLDLQR-FMFKDNV---RLQFGEHKLILHLFEEITATLTVIV
RL9_MYCPN       PYGSIITKQIINQAHT-KGMALQK-FMFKDNV---RLGFGDHEITLHIFEDTTAVLKVKV
RL9_MYCGA       AFGTIGFKQIVDDLSK-KHIFVTK-DMLDSKM---KLDIGEHRVKINIFEGIHATILVKV
RL9_MYCPU       THHSISAKKLLERLHE-LGFDLPK-HSIEKVH---LNLIGINHVNVKLFDKIVAKLTVVI
RL9_MYCMO       VHSSISAKNILNELEEKHGLKIDR-HALENVH---INTIGLSKIIINLYKDIKAILLVKV
RL9_MYCS5       VHGSVSTKELKTKLLE-HKIKLHD-HAIQHVH---LNVEGTHVVEVSLYKDIKAKLRVNL
RL9_MYCH7       VHGAITAKKIKKELEI-KGIFVDK-QAIQTSG---ISTFGTSFVDIKLSSQTIAKLKINI
RL9_MYCH2       VHGAITAKKIKKELEI-KGIFVDK-QAIQTSG---ISTFGTSFVDIKLSSQTIAKLKINI
RL9_MYCHJ       VHGAITAKKIKKELEI-KGIFVDK-QAIQTSG---ISTFGTSFVDIKLSSQTIAKLKINI
RL9_MYCCT       VFGSISSQDIVNQLKDLHRIELDKKKFIRFKN---INKIGINYIKVKLDFGIEAIIKVDV
RL9_MYCMS       VFGSISSQDIVNQLKDVHRIEIDKKKFIHFKN---INKIGINYVKVKLDFGIEALIKIDV
RL9_MESFL       AFHSISNQDIVDQLKNSHKIDLDKRKFVNFKN---LNQIGLHYIVIKLGFGIEAKLKVEI
                    :                                  .                    

RL9_CAMC5       QGE---------------------------------------------------------
RL9_CAMC1       QGE---------------------------------------------------------
RL9_CAMFF       AGE---------------------------------------------------------
RL9_CAMJE       KAE---------------------------------------------------------
RL9_CAMJR       KAE---------------------------------------------------------
RL9_CAMJD       KAE---------------------------------------------------------
RL9_CAMJJ       KAE---------------------------------------------------------
RL9_CAMJ8       KAE---------------------------------------------------------
RL9_CAMHC       VGE---------------------------------------------------------
RL9_SULDN       VGE---------------------------------------------------------
RL9_NITSB       EAE---------------------------------------------------------
RL9_ARCB4       IAE---------------------------------------------------------
RL9_SULNB       VGV---------------------------------------------------------
RL9_HELPY       VAE---------------------------------------------------------
RL9_HELPJ       VAE---------------------------------------------------------
RL9_HELPH       VAE---------------------------------------------------------
RL9_HELAH       VAE---------------------------------------------------------
RL9_HELHP       KAQ---------------------------------------------------------
RL9_WOLSU       EGSNV-------------------------------------------------------
RL9_FERNB       LREE--------------------------------------------------------
RL9_THEM4       IQEGKN------------------------------------------------------
RL9_THEMA       EREE--------------------------------------------------------
RL9_THEP1       EREE--------------------------------------------------------
RL9_PSELT       VGEEKG------------------------------------------------------
RL9_PETMO       KPEN--------------------------------------------------------
RL9_FUSNN       IAK---------------------------------------------------------
RL9_BACHD       VEE---------------------------------------------------------
RL9_BACSK       VEA---------------------------------------------------------
RL9_GEOTN       TEQK--------------------------------------------------------
RL9_GEOSE       TEQK--------------------------------------------------------
RL9_GEOKA       KEQK--------------------------------------------------------
RL9_BACCZ       SEQ---------------------------------------------------------
RL9_BACAH       SEQ---------------------------------------------------------
RL9_BACAN       SEQ---------------------------------------------------------
RL9_BACHK       SEQ---------------------------------------------------------
RL9_BACC1       SEQ---------------------------------------------------------
RL9_BACCR       SEQ---------------------------------------------------------
RL9_BACCN       SEQ---------------------------------------------------------
RL9_BACVZ       KEEA--------------------------------------------------------
RL9_BACSU       KEEA--------------------------------------------------------
RL9_BACP2       TEQA--------------------------------------------------------
RL9_BACLD       KEQS--------------------------------------------------------
RL9_LISIN       SEE---------------------------------------------------------
RL9_LISW6       SEE---------------------------------------------------------
RL9_LISMO       SEE---------------------------------------------------------
RL9_LISMF       SEE---------------------------------------------------------
RL9_STAAW       VEQ---------------------------------------------------------
RL9_STAAE       VEQ---------------------------------------------------------
RL9_STAAC       VEQ---------------------------------------------------------
RL9_STAAR       VEQ---------------------------------------------------------
RL9_STAAS       VEQ---------------------------------------------------------
RL9_STAA3       VEQ---------------------------------------------------------
RL9_STAAT       VEQ---------------------------------------------------------
RL9_STAA1       VEQ---------------------------------------------------------
RL9_STAAM       VEQ---------------------------------------------------------
RL9_STAA2       VEQ---------------------------------------------------------
RL9_STAA9       VEQ---------------------------------------------------------
RL9_STAAN       VEQ---------------------------------------------------------
RL9_STAA8       VEQ---------------------------------------------------------
RL9_STAAB       VEQ---------------------------------------------------------
RL9_STAS1       VEQ---------------------------------------------------------
RL9_STAEQ       VEQ---------------------------------------------------------
RL9_STAES       VEQ---------------------------------------------------------
RL9_STAHJ       VEK---------------------------------------------------------
RL9_OCEIH       AEK---------------------------------------------------------
RL9_LACBA       VAKQQ-------------------------------------------------------
RL9_LACPL       VEK---------------------------------------------------------
RL9_ENTFA       VAE---------------------------------------------------------
RL9_PEDPA       AEQ---------------------------------------------------------
RL9_LACSS       VAE---------------------------------------------------------
RL9_LACRD       AEK---------------------------------------------------------
RL9_LACS1       SEK---------------------------------------------------------
RL9_LACP3       IEQK--------------------------------------------------------
RL9_LACAC       TEQD--------------------------------------------------------
RL9_LACH4       TEQD--------------------------------------------------------
RL9_LACJO       TEQD--------------------------------------------------------
RL9_LACDA       TQEN--------------------------------------------------------
RL9_LACDB       TQEN--------------------------------------------------------
RL9_STRT2       KNSAE-------------------------------------------------------
RL9_STRT1       KNSAE-------------------------------------------------------
RL9_STRTD       KNSAE-------------------------------------------------------
RL9_STRA5       KEA---------------------------------------------------------
RL9_STRA3       KEA---------------------------------------------------------
RL9_STRA1       KEA---------------------------------------------------------
RL9_STRPD       TEA---------------------------------------------------------
RL9_STRPM       TEA---------------------------------------------------------
RL9_STRPF       TEA---------------------------------------------------------
RL9_STRP3       TEA---------------------------------------------------------
RL9_STRPC       TEA---------------------------------------------------------
RL9_STRP1       TEA---------------------------------------------------------
RL9_STRPB       TEA---------------------------------------------------------
RL9_STRPG       TEA---------------------------------------------------------
RL9_STRP8       TEA---------------------------------------------------------
RL9_STRP6       TEA---------------------------------------------------------
RL9_STRMU       KEA---------------------------------------------------------
RL9_STRP2       KEG---------------------------------------------------------
RL9_STRR6       KEG---------------------------------------------------------
RL9_STRPN       KEG---------------------------------------------------------
RL9_STRGC       KEG---------------------------------------------------------
RL9_STRSV       KEG---------------------------------------------------------
RL9_LACLS       SEA---------------------------------------------------------
RL9_LACLM       SEA---------------------------------------------------------
RL9_LACLA       SEA---------------------------------------------------------
RL9_LEUMM       SEG---------------------------------------------------------
RL9_OENOB       SELN--------------------------------------------------------
RL9_ALKOO       KEA---------------------------------------------------------
RL9_ALKMQ       TEEA--------------------------------------------------------
RL9_CLOD6       KEKQ--------------------------------------------------------
RL9_CALS4       VAE---------------------------------------------------------
RL9_HUNT2       EQE---------------------------------------------------------
RL9_CLOTE       EDI---------------------------------------------------------
RL9_CLOK5       AEK---------------------------------------------------------
RL9_CLOAB       SEG---------------------------------------------------------
RL9_CLONN       SEK---------------------------------------------------------
RL9_CLOPE       VPVQ--------------------------------------------------------
RL9_CLOP1       VPVQ--------------------------------------------------------
RL9_CLOPS       VPVQ--------------------------------------------------------
RL9_CLOB8       VPQE--------------------------------------------------------
RL9_CLOB1       LEE---------------------------------------------------------
RL9_CLOBH       LEE---------------------------------------------------------
RL9_CLOBL       LEE---------------------------------------------------------
RL9_CARHZ       KEEGRG------------------------------------------------------
RL9_DESHY       KAS---------------------------------------------------------
RL9_LACP7       DSL---------------------------------------------------------
RL9_DESRM       ASMD--------------------------------------------------------
RL9_DEHMB       TAEENT------------------------------------------------------
RL9_DEHMC       TAEENT------------------------------------------------------
RL9_DEHM1       TAEENT------------------------------------------------------
RL9_CALS8       TSS---------------------------------------------------------
RL9_MOOTA       VAEGS-------------------------------------------------------
RL9_PELTS       AGE---------------------------------------------------------
RL9_SYMTH       LPE---------------------------------------------------------
RL9_STRAW       VAA---------------------------------------------------------
RL9_STRCO       VAA---------------------------------------------------------
RL9_ACIC1       VPAS--------------------------------------------------------
RL9_KINRD       VEATA-------------------------------------------------------
RL9_FRACC       TQA---------------------------------------------------------
RL9_FRAAA       KKA---------------------------------------------------------
RL9_SALTO       VQG---------------------------------------------------------
RL9_SALAI       VQG---------------------------------------------------------
RL9_THEFY       VGV---------------------------------------------------------
RL9_NOCSJ       IPA---------------------------------------------------------
RL9_CLAMS       VAAK--------------------------------------------------------
RL9_CLAM3       VAAK--------------------------------------------------------
RL9_LEIXX       VAAN--------------------------------------------------------
RL9_RENSM       VAGK--------------------------------------------------------
RL9_PAEAT       VAAK--------------------------------------------------------
RL9_ARTS2       VAGK--------------------------------------------------------
RL9_MYCGI       VAG---------------------------------------------------------
RL9_MYCVP       VAG---------------------------------------------------------
RL9_MYCSK       VAES--------------------------------------------------------
RL9_MYCSS       VAES--------------------------------------------------------
RL9_MYCSJ       VAES--------------------------------------------------------
RL9_MYCS2       VAQ---------------------------------------------------------
RL9_MYCA1       VPQS--------------------------------------------------------
RL9_MYCPA       VPQS--------------------------------------------------------
RL9_MYCBO       VAQS--------------------------------------------------------
RL9_MYCBP       VAQS--------------------------------------------------------
RL9_MYCTU       VAQS--------------------------------------------------------
RL9_MYCTA       VAQS--------------------------------------------------------
RL9_MYCLE       VAAR--------------------------------------------------------
RL9_MYCUA       VAES--------------------------------------------------------
RL9_NOCFA       DAAAS-------------------------------------------------------
RL9_RHOJR       VGA---------------------------------------------------------
RL9_CORGB       VAA---------------------------------------------------------
RL9_CORGL       VAA---------------------------------------------------------
RL9_COREF       VAA---------------------------------------------------------
RL9_CORDI       VAA---------------------------------------------------------
RL9_CORJK       VSA---------------------------------------------------------
RL9_SACEN       SAAS--------------------------------------------------------
RL9_CUTAK       VPAA--------------------------------------------------------
RL9_TROW8       YAE---------------------------------------------------------
RL9_TROWT       YAE---------------------------------------------------------
RL9_BIFAA       VAE---------------------------------------------------------
RL9_BIFLO       VAE---------------------------------------------------------
RL9_BORBP       KKEKKQE-------------------DKKSLNKKLNKVDE--------------------
RL9_BORAP       KKEEKQE-------------------DKKPLNKKLNKVDEQAERERV-------------
RL9_BORBU       KKEKKQE-------------------DKKSLSKKLNKADEQGERAEV-------------
RL9_TREDE       EAQIAEEKPVKASEKKGRRPRRDEEASDEQILAEENSVTEEAVSEEIQNSESEN------
RL9_TREPA       KNQ-----------------------------SEADSVSE--------------------
RL9_VIBVY       VAE---------------------------------------------------------
RL9_VIBVU       VAE---------------------------------------------------------
RL9_VIBCB       VAAE--------------------------------------------------------
RL9_VIBPA       VAAE--------------------------------------------------------
RL9_VIBC3       VAE---------------------------------------------------------
RL9_VIBCH       VAE---------------------------------------------------------
RL9_PHOPR       VAAE--------------------------------------------------------
RL9_ALIF1       VAAE--------------------------------------------------------
RL9_IDILO       VPAE--------------------------------------------------------
RL9_SHEB9       VAEA--------------------------------------------------------
RL9_SHEB8       VAEA--------------------------------------------------------
RL9_SHEB5       VAEA--------------------------------------------------------
RL9_SHESM       VAEA--------------------------------------------------------
RL9_SHESA       VAEA--------------------------------------------------------
RL9_SHESR       VAEA--------------------------------------------------------
RL9_SHESW       VAEA--------------------------------------------------------
RL9_SHEPC       VAEA--------------------------------------------------------
RL9_SHEON       VAEA--------------------------------------------------------
RL9_SHEAM       VAE---------------------------------------------------------
RL9_SHEDO       VAEA--------------------------------------------------------
RL9_SHEFN       VAEA--------------------------------------------------------
RL9_SHELP       VAED--------------------------------------------------------
RL9_SHEHH       VAEA--------------------------------------------------------
RL9_SHEPA       VAEA--------------------------------------------------------
RL9_SHESH       VAED--------------------------------------------------------
RL9_PSEHT       IAEA--------------------------------------------------------
RL9_PSEA6       IQEA--------------------------------------------------------
RL9_COLP3       IAEA--------------------------------------------------------
RL9_PSYIN       VQAE--------------------------------------------------------
RL9_AERS4       VAL---------------------------------------------------------
RL9_AERHH       VAL---------------------------------------------------------
RL9_ECOK1       VAE---------------------------------------------------------
RL9_ECOL6       VAE---------------------------------------------------------
RL9_ECO57       VAE---------------------------------------------------------
RL9_ECOLI       VAE---------------------------------------------------------
RL9_SHIF8       VAE---------------------------------------------------------
RL9_SHISS       VAE---------------------------------------------------------
RL9_SHIFL       VAE---------------------------------------------------------
RL9_ECOHS       VAE---------------------------------------------------------
RL9_ECOLC       VAE---------------------------------------------------------
RL9_ECOL5       VAE---------------------------------------------------------
RL9_ECOUT       VAE---------------------------------------------------------
RL9_ECO24       VAE---------------------------------------------------------
RL9_SHIBS       VAE---------------------------------------------------------
RL9_SHIDS       VAE---------------------------------------------------------
RL9_SALTY       VAE---------------------------------------------------------
RL9_SALPB       VAE---------------------------------------------------------
RL9_SALAR       VAE---------------------------------------------------------
RL9_SALPA       VAE---------------------------------------------------------
RL9_SALCH       VAE---------------------------------------------------------
RL9_SALTI       VAE---------------------------------------------------------
RL9_CITK8       VAE---------------------------------------------------------
RL9_CROS8       VAE---------------------------------------------------------
RL9_ENT38       VAE---------------------------------------------------------
RL9_KLEP7       VAE---------------------------------------------------------
RL9_YERPA       VPEA--------------------------------------------------------
RL9_YERPN       VPEA--------------------------------------------------------
RL9_YERPS       VPEA--------------------------------------------------------
RL9_YERPP       VPEA--------------------------------------------------------
RL9_YERPE       VPEA--------------------------------------------------------
RL9_YERP3       VPEA--------------------------------------------------------
RL9_YERE8       VPEA--------------------------------------------------------
RL9_PECAS       VAEA--------------------------------------------------------
RL9_SERP5       VAEA--------------------------------------------------------
RL9_PHOLL       VAEA--------------------------------------------------------
RL9_SODGM       VPEA--------------------------------------------------------
RL9_BAUCH       IAEK--------------------------------------------------------
RL9_ACTP2       VAE---------------------------------------------------------
RL9_HAEDU       VAE---------------------------------------------------------
RL9_ACTSZ       VAE---------------------------------------------------------
RL9_MANSM       VAE---------------------------------------------------------
RL9_PASMU       VAE---------------------------------------------------------
RL9_HAEIE       VAE---------------------------------------------------------
RL9_HAEIN       VAE---------------------------------------------------------
RL9_HAEIG       VAE---------------------------------------------------------
RL9_HAEI8       VAE---------------------------------------------------------
RL9_HAES1       VAE---------------------------------------------------------
RL9_HISS2       VAE---------------------------------------------------------
RL9_MARHV       VAE---------------------------------------------------------
RL9_HAHCH       VGE---------------------------------------------------------
RL9_PSEMY       VAA---------------------------------------------------------
RL9_PSEU5       VAG---------------------------------------------------------
RL9_PSESM       VAA---------------------------------------------------------
RL9_PSEU2       VAA---------------------------------------------------------
RL9_PSE14       VAA---------------------------------------------------------
RL9_PSEF5       VAA---------------------------------------------------------
RL9_PSEPF       VAA---------------------------------------------------------
RL9_PSEP1       VAA---------------------------------------------------------
RL9_PSEPK       VAA---------------------------------------------------------
RL9_PSEPG       VAA---------------------------------------------------------
RL9_PSEE4       VAA---------------------------------------------------------
RL9_PSEA7       VAE---------------------------------------------------------
RL9_PSEAE       VAE---------------------------------------------------------
RL9_PSEAB       VAE---------------------------------------------------------
RL9_CHRSD       VAE---------------------------------------------------------
RL9_SACD2       VADANA------------------------------------------------------
RL9_PSYCK       LSEDGDNEDLDEDNAADENEDYSEE-----------------------------------
RL9_PSYA2       LSEDGDNEDLDENDATDENEE---------------------------------------
RL9_PSYWF       LSEDGDVEAAQQE--AEEDAE---------------------------------------
RL9_ACIBT       VSE---------------------------------------------------------
RL9_ACIAD       VSE---------------------------------------------------------
RL9_ALCBS       VPAE--------------------------------------------------------
RL9_MARMS       IAE---------------------------------------------------------
RL9_HYDCU       KATEE-------------------------------------------------------
RL9_NITOC       TGEEE-------------------------------------------------------
RL9_ALKEH       QSQEA-------------------------------------------------------
RL9_HALHL       EGDAS-------------------------------------------------------
RL9_XYLFA       QGVP--------------------------------------------------------
RL9_XYLFT       QGVP--------------------------------------------------------
RL9_XANC5       ESDA--------------------------------------------------------
RL9_XANAC       ESDA--------------------------------------------------------
RL9_XANC8       ESDA--------------------------------------------------------
RL9_XANCP       ESDA--------------------------------------------------------
RL9_XANOR       ESDA--------------------------------------------------------
RL9_XANOM       ESDA--------------------------------------------------------
RL9_METCA       IGE---------------------------------------------------------
RL9_COXBR       APENSNS-----------------------------------------------------
RL9_COXBU       APENSNS-----------------------------------------------------
RL9_COXBN       APENSNS-----------------------------------------------------
RL9_LEGPH       IPAK--------------------------------------------------------
RL9_LEGPC       IPAK--------------------------------------------------------
RL9_LEGPL       IPAK--------------------------------------------------------
RL9_LEGPA       ISAK--------------------------------------------------------
RL9_DICNV       VVAE--------------------------------------------------------
RL9_FRATW       VAAEA-------------------------------------------------------
RL9_FRAT1       VAAEA-------------------------------------------------------
RL9_FRATT       VAAEA-------------------------------------------------------
RL9_FRATH       VAAEA-------------------------------------------------------
RL9_FRATF       VAAEA-------------------------------------------------------
RL9_FRATN       VAAEA-------------------------------------------------------
RL9_FRAP2       VASEA-------------------------------------------------------
RL9_AZOSB       LGEQQQ------------------------------------------------------
RL9_AROAE       LGEQQ-------------------------------------------------------
RL9_METFK       LGE---------------------------------------------------------
RL9_NITMU       LGESVS------------------------------------------------------
RL9_DECAR       VAE---------------------------------------------------------
RL9_POLAQ       VGEQA-------------------------------------------------------
RL9_BORBR       EGEMA-------------------------------------------------------
RL9_BORPA       EGEMA-------------------------------------------------------
RL9_BORPE       EGEMA-------------------------------------------------------
RL9_BORA1       EGEMN-------------------------------------------------------
RL9_ACIAC       YGETA-------------------------------------------------------
RL9_ACISJ       YGETA-------------------------------------------------------
RL9_VEREI       YGETA-------------------------------------------------------
RL9_POLNA       YGETA-------------------------------------------------------
RL9_POLSJ       YGETA-------------------------------------------------------
RL9_RHOFT       YGETA-------------------------------------------------------
RL9_METPP       VGETD-------------------------------------------------------
RL9_CUPNH       VGESV-------------------------------------------------------
RL9_CUPMC       LGEHV-------------------------------------------------------
RL9_CUPPJ       VGEQV-------------------------------------------------------
RL9_RALSO       LGETV-------------------------------------------------------
RL9_PARXL       IGEHV-------------------------------------------------------
RL9_BURP1       IGDHA-------------------------------------------------------
RL9_BURMS       IGDHA-------------------------------------------------------
RL9_BURP0       IGDHA-------------------------------------------------------
RL9_BURMA       IGDHA-------------------------------------------------------
RL9_BURM7       IGDHA-------------------------------------------------------
RL9_BURPS       IGDHA-------------------------------------------------------
RL9_BURM9       IGDHA-------------------------------------------------------
RL9_BURP6       IGDHA-------------------------------------------------------
RL9_BURTA       IGDHA-------------------------------------------------------
RL9_BURCA       IGDHA-------------------------------------------------------
RL9_BURCH       IGDHA-------------------------------------------------------
RL9_BURL3       IGDHA-------------------------------------------------------
RL9_BURVG       IGDHA-------------------------------------------------------
RL9_BURCM       IGDHA-------------------------------------------------------
RL9_JANMA       IGDHA-------------------------------------------------------
RL9_HERAR       VGEHA-------------------------------------------------------
RL9_THIDA       VGEQ--------------------------------------------------------
RL9_NEIMB       VAATE-------------------------------------------------------
RL9_NEIMF       VAATE-------------------------------------------------------
RL9_NEIMA       VAATE-------------------------------------------------------
RL9_NEIM0       VAATE-------------------------------------------------------
RL9_NEIG1       IAAAE-------------------------------------------------------
RL9_NEIGO       IAAAE-------------------------------------------------------
RL9_CHRVO       VGEA--------------------------------------------------------
RL9_NITEU       LGETTI------------------------------------------------------
RL9_NITEC       LGETTN------------------------------------------------------
RL9_VESOH       EALQKV------------------------------------------------------
RL9_RUTMC       EGFQEA------------------------------------------------------
RL9_BUCAI       IAKN--------------------------------------------------------
RL9_BUCAP       ISKK--------------------------------------------------------
RL9_BUCBP       VSQDKDK-----------------------------------------------------
RL9_BUCCC       LSK---------------------------------------------------------
RL9_WIGBR       KNNI--------------------------------------------------------
RL9_BLOPB       LDEIV-------------------------------------------------------
RL9_BLOFL       LNSVLFQDKSKKS-----------------------------------------------
RL9_PELUB       VTADTIQ-----------------------------------------------------
RL9_WOLPM       VKSETDANELRQVKLQNQKS------------------EQQEAEQDANKEATDGDDS---
RL9_WOLTR       VRSETDAHELRQVKSQSQKS------------------QQQEAKQNEVGEATDSDKADQK
RL9_ANAPZ       VRNEAEAERTRLQVARDR----------KSRNAAAASEVQDAPVEDGGDEVVSVDSVAAE
RL9_ANAMM       VRNESEAERVRLGIAKSEDQAAAAAEVEQAEDVAAAEQQDSSPVDDHADDADGATGGEGR
RL9_EHRCR       VKNDLGAMQAQKLHAEKKRK------IEEGKVEKGSCTEGESLELGSVDNDINSGNVDSN
RL9_EHRCJ       VKNDLGAMQAQKLHAEKKRK------IEKEVEEGSGTSVDESLKLDSVSDSIDTSGVNSS
RL9_EHRRW       VKNDLGAMQAQKLHLDKQKK------EEKAKDEVSATEKDEELMLSSVTNDNDGDGAKEI
RL9_EHRRG       VKNDLGAMQAQKLHLDKQKK------EEKAKDEVSATEKDEELMLSSVTNDNDGDGAKEI
RL9_NEOSM       LDASRRGADGTITGTS--------------------------------------------
RL9_RICPR       ARSESEAQDYLREQKAE----TLEDVDETA------------------------------
RL9_RICTY       ARSDSEAQDYLREQKTE----NSADLAESE------------------------------
RL9_RICRS       ARSESEAQDYLREQKTE----TSEDLAESA------------------------------
RL9_RICRO       ARSESEAQDYLREQKTE----TSEDLAESA------------------------------
RL9_RICCN       ARSESEAQDYLREQKTE----TSEDLAELA------------------------------
RL9_RICM5       ARSESEAQDYLREQKTE----TSEDLAESA------------------------------
RL9_RICFE       ARSESEAQDYLREQKTE----TSEDLAESA------------------------------
RL9_RICAH       ARSESEAQDYLREKKTE----TSEDLAESA------------------------------
RL9_RICCK       ARSESEVQDYLREQKNE----SLETLAESA------------------------------
RL9_RICBR       ARSESEIQDYLREQKTEK--STTEPLAESA------------------------------
RL9_RICB8       ARSESEIQDYLREQKTEK--STTEPLAESA------------------------------
RL9_ORITB       ARSNTEAQEYLKKFNTSLQDTNNNVLVEKNSSIS--------------------------
RL9_RUBXD       VPKL--------------------------------------------------------
RL9_RHOBA       VPTVAAEGGEPGAS----------------------------------------------
RL9_DESPS       VPLSTKA-----------------------------------------------------
RL9_RHOS1       ARSVEEAELQASGKSIQEL---AAEAEAA-------------ADFEIAELFDEIGA----
RL9_RHOS4       ARSVEEAELQASGKSIQEL---AAEAEAA-------------ADFEIAELFDEIGA----
RL9_RHOS5       ARSPEEAELQASGKSIQEL---AAEAEAA-------------ADFEIAELFDEIGA----
RL9_DINSH       ARSAEEAELQASGKSIQEL---AAEAEAE-------------AEFEIAELFDDIGS----
RL9_ROSDO       ARSVEEAELQASGKSIQEL---AAEEEAA-------------AEFEIQELFDDIGA----
RL9_RUEPO       ARSPEEAELQASGKSIQEL---AAEEEAA-------------AEFEIAELFDDLGG----
RL9_RUEST       ARSPEEAELQASGKSIQEL---AAEEEAA-------------AEFEISELFDDIGG----
RL9_PARDP       ARSAEEAELQASGKSIQEL---AAEEEAA-------------AEFEIAELFDDIGS----
RL9_JANSC       ARSPEEAELQASGKSIQDL---AAEEEAQ-------------AEFEIAELFDDIGA----
RL9_RHOCB       ARSAEEAAIQAAGKSIQQL---AAEADAA-------------AEFEIAELFDEVGA----
RL9_RHILO       ARTADEAERQAKGETLTTA---EAIYGDDI-----------NDNARPENFFDPNAE----
RL9_CHESB       ARSADEAERQARGETLDSA---EAIYGEEI-----------NESARPEAFFDPEAE----
RL9_SINMW       ARSAEEAERQAKGESLTSA---DAIYGVD------------EDALKPEDFFNPEAE----
RL9_RHIME       ARSAEEAERQAKGESLTSA---DAIYGVD------------EDALKPEDFFNPEAE----
RL9_RHILT       ARSAEEAERQAKGEELTSV---DAIYGVD------------EDALRPEDFFDPEAD----
RL9_RHIL3       ARSAEEAERQSKGEELTSV---DAIYGVD------------EDALRPEDFFDPEAD----
RL9_RHIEC       ARSAEEAERQAKGEELTSV---DAIYGVD------------EDALRPEDFFDPEAD----
RL9_AGRFC       ARSAEEAERQSKGESLTSA---DAIYGVD------------EDALRPEDFFDPEAD----
RL9_BRUAB       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BRUA2       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BRUME       ARSTEEAECQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BRUO2       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BRUC2       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BRUSI       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BRUSU       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_OCHA4       ARSTEEAERQAKGEDLTSI---EAIYGIE-------------EQPLSEEVFD--------
RL9_BARHE       ARSASEAQRQAEGETLTSA---EAIYDVR-------------KELLAENQEETFAENQQK
RL9_BARQU       ARSASEAQRQAEGETLTSA---EAIYDIQ-------------EKPLAENQE---------
RL9_BART1       ARSTSEAQRQAEGETLTSA---EEIYNLQ-------------EEILEENQEE--------
RL9_BARBK       ARSANEAQLQEEAKILTSV---EATEIVQ-------------EQPLEENIG---------
RL9_PARL1       ARTQEEAERQAAGEDLTQRRDDEEEEAVEA-----------AEFFESEELAPGDEE----
RL9_MAGSA       ARSAEEAERAAAAAAAAAE-VVE-AEEAPA-----------EEDVAAEETSE--------
RL9_RHORT       ARSEAEAQASAAAAAALLE-RPEDAEEAVA-----------NEEEAEAALLD--------
RL9_GLUDA       ARSEEEAERQARGEEIGVE---KEE----------------PSGFVEEALEE--------
RL9_GLUOX       ARSAEEAERQARGEAIGVQ---DEDENILGE--------LQAENAAEEAAAE--------
RL9_GRABC       ARSVEEAERQARGEAVGLA---AEE----------------AAAAAEAALIE--------
RL9_ACICJ       ARSPEEAEKQARGEAIMRE---ESE-------------------YELETGEE--------
RL9_RHOP2       ARSAEEAERINRGEDISTR--REDQDAAA------------EAIAAAGEFFDP-------
RL9_RHOPS       ARSVEEAERINRGEDISSR--REDQDAAA------------EAIAAAGEFFDP-------
RL9_RHOPA       ARSAEEAERINRGEDISTR--REDEDAAA------------EALAAAGEFFDP-------
RL9_RHOP5       ARSVDEAERINRGEDISTK--REDKDAAA------------EAIAAAGEFFDP-------
RL9_RHOPB       ARSALEAERINRGEDISTR--QEDQDAAA------------EALAAAGEFFDP-------
RL9_BRASO       ARSADEAERIKRGEDISTR--QEDRDAAA------------EAIAAAGEFFDP-------
RL9_BRASB       ARSADEAERIKRGEDISTR--QEDRDAAA------------EAIAAAGEFFDP-------
RL9_NITWN       ARSVDEAERIQRGEDISTR--REDRDAAA------------EAIAAAGEFFDP-------
RL9_NITHX       ARSADEAERIKRGEDISTR--REDRDAAA------------EAIAAAGEFFDP-------
RL9_BRADU       ARSQDEAERINRGEDISTR--NEDRDAAA------------EAIAAAGEFFDP-------
RL9_CAUVC       ARSQDEAERQARGENVINSQFEED---------------RAAEAEAAQDMAEGG------
RL9_CAUSK       ARSQDEADRQARGENVVAAQFEED---------------RAAEAEAASDMAAGG------
RL9_MARMM       ARSQDEAERQAAGEDVIAAQADED---------------RAIADAQAAELFEASEEGQEL
RL9_HYPNA       ARSTEEAERQEKGEDIVAALQAEN---------------QAQADEQAGELAAAAAE----
RL9_NOVAD       ARSPDEAELQSKGVNVIDAMFDNE---------TGGFTEEYDPNAEPGEIPTELLE----
RL9_SPHWW       ARSPEEAELQSQGVDVMAQLFERD---------EAGFTEDYDPNAEPGEIPTELQDEA--
RL9_ZYMMO       ARSPEEAELQAEGVDVMNQMFERD---------GASFTEDYDPNAEPG-LATEAEEAV--
RL9_SPHAL       ARSPDEAEMQSQGIDVIAAMFEEEQAEAAAAALEPDSEEEFEAATPPSELAAEASDE---
RL9_MAGMM       ERAVK-------------------------------------------------------
RL9_DESVH       VSEDKVND------VAESA---------------------PAEEP--EAAAE--------
RL9_DESVV       VSEDKVND------VAESA---------------------PAEEP--EAAAE--------
RL9_LAWIP       ASEEKLYDDTPDRTETEES---------------------TKELQ--EEHAE--------
RL9_DESAG       VAEGRTEE-----ADAEES---------------------AAEEPAVEEAAE--------
RL9_ANADE       EAEAE-------------------------------------------------------
RL9_ANADF       EAEAA-------------------------------------------------------
RL9_MYXXD       LPE---------------------------------------------------------
RL9_SOLUE       AKEE--------------------------------------------------------
RL9_KORVE       AKEAEVAAQ---------------------------------------------------
RL9_GEOMG       TKAD--------------------------------------------------------
RL9_GEOSL       TKAE--------------------------------------------------------
RL9_GEOUR       SKA---------------------------------------------------------
RL9_PELPD       SAPAAAE-----------------------------------------------------
RL9_PELCD       TALD--------------------------------------------------------
RL9_SYNAS       VPEQA-------------------------------------------------------
RL9_SYNFM       EKEE--------------------------------------------------------
RL9_LEPBL       KKEEE-------------------------------------------------------
RL9_LEPBJ       KKEEE-------------------------------------------------------
RL9_LEPIC       KKEEE-------------------------------------------------------
RL9_LEPIN       KKEEE-------------------------------------------------------
RL9_BDEBA       ERA---------------------------------------------------------
RL9_THET8       VAQE--------------------------------------------------------
RL9_THETH       VAQE--------------------------------------------------------
RL9_THET2       VAQE--------------------------------------------------------
RL9_DEIRA       HAAK--------------------------------------------------------
RL9_DEIGD       HAQK--------------------------------------------------------
RL9_CHLCV       SSESSYVAVLNQQPTQEEP-AAEESN----------------------------------
RL9_CHLAB       SSESSYVAVLNPQPSQEQT-AAEELN----------------------------------
RL9_CHLFF       SSESAYIAVLNQQSSQEQTVAAEELE----------------------------------
RL9_CHLPN       TSDNEYVTVLAQGKQTEEN---QEG-----------------------------------
RL9_CHLTR       RADHEIIEQKELQSAEEQEG----------------------------------------
RL9_CHLTA       RADHEIIEQKELQSAEEQEG----------------------------------------
RL9_CHLMU       RADHEIAEQKELQSMEEQED----------------------------------------
RL9_PARUW       MSEEGYRTSLEEQKA---------------------------------------------
RL9_CHLAA       VGE---------------------------------------------------------
RL9_CHLPM       EAEGVEA-----------------------------------------------------
RL9_PELLD       EAEGTEA-----------------------------------------------------
RL9_CHLPD       EAEGSEA-----------------------------------------------------
RL9_CHLTE       EAEGASEE----------------------------------------------------
RL9_CHLCH       EAEGMEA-----------------------------------------------------
RL9_AQUAE       KPEEK-------------------------------------------------------
RL9_PORGI       VSENETIIEAKPEEAPVPVAEEPTAETEQAEVAAE-------------------------
RL9_PARD8       VSE---------------------------------------------------------
RL9_BACFN       VAE---------------------------------------------------------
RL9_BACFR       VAE---------------------------------------------------------
RL9_BACTN       VAE---------------------------------------------------------
RL9_BACV8       VAE---------------------------------------------------------
RL9_CYTH3       VAE---------------------------------------------------------
RL9_FLAJ1       VAEK--------------------------------------------------------
RL9_FLAPJ       VAEQA-------------------------------------------------------
RL9_GRAFK       VGDA--------------------------------------------------------
RL9_THEEB       VAD---------------------------------------------------------
RL9_SYNEL       VAD---------------------------------------------------------
RL9_ACAM1       VPE---------------------------------------------------------
RL9_SYNP6       AAL---------------------------------------------------------
RL9_SYNE7       AAL---------------------------------------------------------
RL9_SYNY3       APL---------------------------------------------------------
RL9_TRIV2       VAS---------------------------------------------------------
RL9_NOSS1       VAS---------------------------------------------------------
RL9_TRIEI       VGH---------------------------------------------------------
RL9_MICAN       IAQ---------------------------------------------------------
RL9_SYNPW       VSY---------------------------------------------------------
RL9_SYNS3       VSY---------------------------------------------------------
RL9_SYNPX       VSY---------------------------------------------------------
RL9_SYNSC       VGY---------------------------------------------------------
RL9_SYNS9       VSY---------------------------------------------------------
RL9_PROMM       VSY---------------------------------------------------------
RL9_PROM3       VSY---------------------------------------------------------
RL9_SYNR3       VSH---------------------------------------------------------
RL9_PROMT       TSY---------------------------------------------------------
RL9_PROM1       TSY---------------------------------------------------------
RL9_PROMA       IGN---------------------------------------------------------
RL9_PROM0       TS----------------------------------------------------------
RL9_PROM2       TS----------------------------------------------------------
RL9_PROM9       TS----------------------------------------------------------
RL9_PROMS       TS----------------------------------------------------------
RL9_PROMP       TS----------------------------------------------------------
RL9_PROM5       TS----------------------------------------------------------
RL9_SYNJB       TPE---------------------------------------------------------
RL9_SYNJA       TPE---------------------------------------------------------
RL9_GLOVI       NAAG--------------------------------------------------------
RL9_SALRD       IPESG-------------------------------------------------------
RK9_PYRYE       LPESN-------------------------------------------------------
RK9_PORPU       LPESN-------------------------------------------------------
RK9_GRATL       LPFFA-------------------------------------------------------
RL9_UREPA       SKE---------------------------------------------------------
RL9_UREP2       SKE---------------------------------------------------------
RL9_MYCGE       NPENGTTN----------------------------------------------------
RL9_MYCPN       TPDNGVK-----------------------------------------------------
RL9_MYCGA       SKAQ--------------------------------------------------------
RL9_MYCPU       EADV--------------------------------------------------------
RL9_MYCMO       EKDE--------------------------------------------------------
RL9_MYCS5       HINVKK------------------------------------------------------
RL9_MYCH7       TKDE--------------------------------------------------------
RL9_MYCH2       TKDE--------------------------------------------------------
RL9_MYCHJ       TKDE--------------------------------------------------------
RL9_MYCCT       KEV---------------------------------------------------------
RL9_MYCMS       KEVQKWNKN---------------------------------------------------
RL9_MESFL       QGV---------------------------------------------------------
                                                                            

RL9_CAMC5       -----------------------------------------------
RL9_CAMC1       -----------------------------------------------
RL9_CAMFF       -----------------------------------------------
RL9_CAMJE       -----------------------------------------------
RL9_CAMJR       -----------------------------------------------
RL9_CAMJD       -----------------------------------------------
RL9_CAMJJ       -----------------------------------------------
RL9_CAMJ8       -----------------------------------------------
RL9_CAMHC       -----------------------------------------------
RL9_SULDN       -----------------------------------------------
RL9_NITSB       -----------------------------------------------
RL9_ARCB4       -----------------------------------------------
RL9_SULNB       -----------------------------------------------
RL9_HELPY       -----------------------------------------------
RL9_HELPJ       -----------------------------------------------
RL9_HELPH       -----------------------------------------------
RL9_HELAH       -----------------------------------------------
RL9_HELHP       -----------------------------------------------
RL9_WOLSU       -----------------------------------------------
RL9_FERNB       -----------------------------------------------
RL9_THEM4       -----------------------------------------------
RL9_THEMA       -----------------------------------------------
RL9_THEP1       -----------------------------------------------
RL9_PSELT       -----------------------------------------------
RL9_PETMO       -----------------------------------------------
RL9_FUSNN       -----------------------------------------------
RL9_BACHD       -----------------------------------------------
RL9_BACSK       -----------------------------------------------
RL9_GEOTN       -----------------------------------------------
RL9_GEOSE       -----------------------------------------------
RL9_GEOKA       -----------------------------------------------
RL9_BACCZ       -----------------------------------------------
RL9_BACAH       -----------------------------------------------
RL9_BACAN       -----------------------------------------------
RL9_BACHK       -----------------------------------------------
RL9_BACC1       -----------------------------------------------
RL9_BACCR       -----------------------------------------------
RL9_BACCN       -----------------------------------------------
RL9_BACVZ       -----------------------------------------------
RL9_BACSU       -----------------------------------------------
RL9_BACP2       -----------------------------------------------
RL9_BACLD       -----------------------------------------------
RL9_LISIN       -----------------------------------------------
RL9_LISW6       -----------------------------------------------
RL9_LISMO       -----------------------------------------------
RL9_LISMF       -----------------------------------------------
RL9_STAAW       -----------------------------------------------
RL9_STAAE       -----------------------------------------------
RL9_STAAC       -----------------------------------------------
RL9_STAAR       -----------------------------------------------
RL9_STAAS       -----------------------------------------------
RL9_STAA3       -----------------------------------------------
RL9_STAAT       -----------------------------------------------
RL9_STAA1       -----------------------------------------------
RL9_STAAM       -----------------------------------------------
RL9_STAA2       -----------------------------------------------
RL9_STAA9       -----------------------------------------------
RL9_STAAN       -----------------------------------------------
RL9_STAA8       -----------------------------------------------
RL9_STAAB       -----------------------------------------------
RL9_STAS1       -----------------------------------------------
RL9_STAEQ       -----------------------------------------------
RL9_STAES       -----------------------------------------------
RL9_STAHJ       -----------------------------------------------
RL9_OCEIH       -----------------------------------------------
RL9_LACBA       -----------------------------------------------
RL9_LACPL       -----------------------------------------------
RL9_ENTFA       -----------------------------------------------
RL9_PEDPA       -----------------------------------------------
RL9_LACSS       -----------------------------------------------
RL9_LACRD       -----------------------------------------------
RL9_LACS1       -----------------------------------------------
RL9_LACP3       -----------------------------------------------
RL9_LACAC       -----------------------------------------------
RL9_LACH4       -----------------------------------------------
RL9_LACJO       -----------------------------------------------
RL9_LACDA       -----------------------------------------------
RL9_LACDB       -----------------------------------------------
RL9_STRT2       -----------------------------------------------
RL9_STRT1       -----------------------------------------------
RL9_STRTD       -----------------------------------------------
RL9_STRA5       -----------------------------------------------
RL9_STRA3       -----------------------------------------------
RL9_STRA1       -----------------------------------------------
RL9_STRPD       -----------------------------------------------
RL9_STRPM       -----------------------------------------------
RL9_STRPF       -----------------------------------------------
RL9_STRP3       -----------------------------------------------
RL9_STRPC       -----------------------------------------------
RL9_STRP1       -----------------------------------------------
RL9_STRPB       -----------------------------------------------
RL9_STRPG       -----------------------------------------------
RL9_STRP8       -----------------------------------------------
RL9_STRP6       -----------------------------------------------
RL9_STRMU       -----------------------------------------------
RL9_STRP2       -----------------------------------------------
RL9_STRR6       -----------------------------------------------
RL9_STRPN       -----------------------------------------------
RL9_STRGC       -----------------------------------------------
RL9_STRSV       -----------------------------------------------
RL9_LACLS       -----------------------------------------------
RL9_LACLM       -----------------------------------------------
RL9_LACLA       -----------------------------------------------
RL9_LEUMM       -----------------------------------------------
RL9_OENOB       -----------------------------------------------
RL9_ALKOO       -----------------------------------------------
RL9_ALKMQ       -----------------------------------------------
RL9_CLOD6       -----------------------------------------------
RL9_CALS4       -----------------------------------------------
RL9_HUNT2       -----------------------------------------------
RL9_CLOTE       -----------------------------------------------
RL9_CLOK5       -----------------------------------------------
RL9_CLOAB       -----------------------------------------------
RL9_CLONN       -----------------------------------------------
RL9_CLOPE       -----------------------------------------------
RL9_CLOP1       -----------------------------------------------
RL9_CLOPS       -----------------------------------------------
RL9_CLOB8       -----------------------------------------------
RL9_CLOB1       -----------------------------------------------
RL9_CLOBH       -----------------------------------------------
RL9_CLOBL       -----------------------------------------------
RL9_CARHZ       -----------------------------------------------
RL9_DESHY       -----------------------------------------------
RL9_LACP7       -----------------------------------------------
RL9_DESRM       -----------------------------------------------
RL9_DEHMB       -----------------------------------------------
RL9_DEHMC       -----------------------------------------------
RL9_DEHM1       -----------------------------------------------
RL9_CALS8       -----------------------------------------------
RL9_MOOTA       -----------------------------------------------
RL9_PELTS       -----------------------------------------------
RL9_SYMTH       -----------------------------------------------
RL9_STRAW       -----------------------------------------------
RL9_STRCO       -----------------------------------------------
RL9_ACIC1       -----------------------------------------------
RL9_KINRD       -----------------------------------------------
RL9_FRACC       -----------------------------------------------
RL9_FRAAA       -----------------------------------------------
RL9_SALTO       -----------------------------------------------
RL9_SALAI       -----------------------------------------------
RL9_THEFY       -----------------------------------------------
RL9_NOCSJ       -----------------------------------------------
RL9_CLAMS       -----------------------------------------------
RL9_CLAM3       -----------------------------------------------
RL9_LEIXX       -----------------------------------------------
RL9_RENSM       -----------------------------------------------
RL9_PAEAT       -----------------------------------------------
RL9_ARTS2       -----------------------------------------------
RL9_MYCGI       -----------------------------------------------
RL9_MYCVP       -----------------------------------------------
RL9_MYCSK       -----------------------------------------------
RL9_MYCSS       -----------------------------------------------
RL9_MYCSJ       -----------------------------------------------
RL9_MYCS2       -----------------------------------------------
RL9_MYCA1       -----------------------------------------------
RL9_MYCPA       -----------------------------------------------
RL9_MYCBO       -----------------------------------------------
RL9_MYCBP       -----------------------------------------------
RL9_MYCTU       -----------------------------------------------
RL9_MYCTA       -----------------------------------------------
RL9_MYCLE       -----------------------------------------------
RL9_MYCUA       -----------------------------------------------
RL9_NOCFA       -----------------------------------------------
RL9_RHOJR       -----------------------------------------------
RL9_CORGB       -----------------------------------------------
RL9_CORGL       -----------------------------------------------
RL9_COREF       -----------------------------------------------
RL9_CORDI       -----------------------------------------------
RL9_CORJK       -----------------------------------------------
RL9_SACEN       -----------------------------------------------
RL9_CUTAK       -----------------------------------------------
RL9_TROW8       -----------------------------------------------
RL9_TROWT       -----------------------------------------------
RL9_BIFAA       -----------------------------------------------
RL9_BIFLO       -----------------------------------------------
RL9_BORBP       -----------------------------------------------
RL9_BORAP       -----------------------------------------------
RL9_BORBU       -----------------------------------------------
RL9_TREDE       -----------------------------------------------
RL9_TREPA       -----------------------------------------------
RL9_VIBVY       -----------------------------------------------
RL9_VIBVU       -----------------------------------------------
RL9_VIBCB       -----------------------------------------------
RL9_VIBPA       -----------------------------------------------
RL9_VIBC3       -----------------------------------------------
RL9_VIBCH       -----------------------------------------------
RL9_PHOPR       -----------------------------------------------
RL9_ALIF1       -----------------------------------------------
RL9_IDILO       -----------------------------------------------
RL9_SHEB9       -----------------------------------------------
RL9_SHEB8       -----------------------------------------------
RL9_SHEB5       -----------------------------------------------
RL9_SHESM       -----------------------------------------------
RL9_SHESA       -----------------------------------------------
RL9_SHESR       -----------------------------------------------
RL9_SHESW       -----------------------------------------------
RL9_SHEPC       -----------------------------------------------
RL9_SHEON       -----------------------------------------------
RL9_SHEAM       -----------------------------------------------
RL9_SHEDO       -----------------------------------------------
RL9_SHEFN       -----------------------------------------------
RL9_SHELP       -----------------------------------------------
RL9_SHEHH       -----------------------------------------------
RL9_SHEPA       -----------------------------------------------
RL9_SHESH       -----------------------------------------------
RL9_PSEHT       -----------------------------------------------
RL9_PSEA6       -----------------------------------------------
RL9_COLP3       -----------------------------------------------
RL9_PSYIN       -----------------------------------------------
RL9_AERS4       -----------------------------------------------
RL9_AERHH       -----------------------------------------------
RL9_ECOK1       -----------------------------------------------
RL9_ECOL6       -----------------------------------------------
RL9_ECO57       -----------------------------------------------
RL9_ECOLI       -----------------------------------------------
RL9_SHIF8       -----------------------------------------------
RL9_SHISS       -----------------------------------------------
RL9_SHIFL       -----------------------------------------------
RL9_ECOHS       -----------------------------------------------
RL9_ECOLC       -----------------------------------------------
RL9_ECOL5       -----------------------------------------------
RL9_ECOUT       -----------------------------------------------
RL9_ECO24       -----------------------------------------------
RL9_SHIBS       -----------------------------------------------
RL9_SHIDS       -----------------------------------------------
RL9_SALTY       -----------------------------------------------
RL9_SALPB       -----------------------------------------------
RL9_SALAR       -----------------------------------------------
RL9_SALPA       -----------------------------------------------
RL9_SALCH       -----------------------------------------------
RL9_SALTI       -----------------------------------------------
RL9_CITK8       -----------------------------------------------
RL9_CROS8       -----------------------------------------------
RL9_ENT38       -----------------------------------------------
RL9_KLEP7       -----------------------------------------------
RL9_YERPA       -----------------------------------------------
RL9_YERPN       -----------------------------------------------
RL9_YERPS       -----------------------------------------------
RL9_YERPP       -----------------------------------------------
RL9_YERPE       -----------------------------------------------
RL9_YERP3       -----------------------------------------------
RL9_YERE8       -----------------------------------------------
RL9_PECAS       -----------------------------------------------
RL9_SERP5       -----------------------------------------------
RL9_PHOLL       -----------------------------------------------
RL9_SODGM       -----------------------------------------------
RL9_BAUCH       -----------------------------------------------
RL9_ACTP2       -----------------------------------------------
RL9_HAEDU       -----------------------------------------------
RL9_ACTSZ       -----------------------------------------------
RL9_MANSM       -----------------------------------------------
RL9_PASMU       -----------------------------------------------
RL9_HAEIE       -----------------------------------------------
RL9_HAEIN       -----------------------------------------------
RL9_HAEIG       -----------------------------------------------
RL9_HAEI8       -----------------------------------------------
RL9_HAES1       -----------------------------------------------
RL9_HISS2       -----------------------------------------------
RL9_MARHV       -----------------------------------------------
RL9_HAHCH       -----------------------------------------------
RL9_PSEMY       -----------------------------------------------
RL9_PSEU5       -----------------------------------------------
RL9_PSESM       -----------------------------------------------
RL9_PSEU2       -----------------------------------------------
RL9_PSE14       -----------------------------------------------
RL9_PSEF5       -----------------------------------------------
RL9_PSEPF       -----------------------------------------------
RL9_PSEP1       -----------------------------------------------
RL9_PSEPK       -----------------------------------------------
RL9_PSEPG       -----------------------------------------------
RL9_PSEE4       -----------------------------------------------
RL9_PSEA7       -----------------------------------------------
RL9_PSEAE       -----------------------------------------------
RL9_PSEAB       -----------------------------------------------
RL9_CHRSD       -----------------------------------------------
RL9_SACD2       -----------------------------------------------
RL9_PSYCK       -----------------------------------------------
RL9_PSYA2       -----------------------------------------------
RL9_PSYWF       -----------------------------------------------
RL9_ACIBT       -----------------------------------------------
RL9_ACIAD       -----------------------------------------------
RL9_ALCBS       -----------------------------------------------
RL9_MARMS       -----------------------------------------------
RL9_HYDCU       -----------------------------------------------
RL9_NITOC       -----------------------------------------------
RL9_ALKEH       -----------------------------------------------
RL9_HALHL       -----------------------------------------------
RL9_XYLFA       -----------------------------------------------
RL9_XYLFT       -----------------------------------------------
RL9_XANC5       -----------------------------------------------
RL9_XANAC       -----------------------------------------------
RL9_XANC8       -----------------------------------------------
RL9_XANCP       -----------------------------------------------
RL9_XANOR       -----------------------------------------------
RL9_XANOM       -----------------------------------------------
RL9_METCA       -----------------------------------------------
RL9_COXBR       -----------------------------------------------
RL9_COXBU       -----------------------------------------------
RL9_COXBN       -----------------------------------------------
RL9_LEGPH       -----------------------------------------------
RL9_LEGPC       -----------------------------------------------
RL9_LEGPL       -----------------------------------------------
RL9_LEGPA       -----------------------------------------------
RL9_DICNV       -----------------------------------------------
RL9_FRATW       -----------------------------------------------
RL9_FRAT1       -----------------------------------------------
RL9_FRATT       -----------------------------------------------
RL9_FRATH       -----------------------------------------------
RL9_FRATF       -----------------------------------------------
RL9_FRATN       -----------------------------------------------
RL9_FRAP2       -----------------------------------------------
RL9_AZOSB       -----------------------------------------------
RL9_AROAE       -----------------------------------------------
RL9_METFK       -----------------------------------------------
RL9_NITMU       -----------------------------------------------
RL9_DECAR       -----------------------------------------------
RL9_POLAQ       -----------------------------------------------
RL9_BORBR       -----------------------------------------------
RL9_BORPA       -----------------------------------------------
RL9_BORPE       -----------------------------------------------
RL9_BORA1       -----------------------------------------------
RL9_ACIAC       -----------------------------------------------
RL9_ACISJ       -----------------------------------------------
RL9_VEREI       -----------------------------------------------
RL9_POLNA       -----------------------------------------------
RL9_POLSJ       -----------------------------------------------
RL9_RHOFT       -----------------------------------------------
RL9_METPP       -----------------------------------------------
RL9_CUPNH       -----------------------------------------------
RL9_CUPMC       -----------------------------------------------
RL9_CUPPJ       -----------------------------------------------
RL9_RALSO       -----------------------------------------------
RL9_PARXL       -----------------------------------------------
RL9_BURP1       -----------------------------------------------
RL9_BURMS       -----------------------------------------------
RL9_BURP0       -----------------------------------------------
RL9_BURMA       -----------------------------------------------
RL9_BURM7       -----------------------------------------------
RL9_BURPS       -----------------------------------------------
RL9_BURM9       -----------------------------------------------
RL9_BURP6       -----------------------------------------------
RL9_BURTA       -----------------------------------------------
RL9_BURCA       -----------------------------------------------
RL9_BURCH       -----------------------------------------------
RL9_BURL3       -----------------------------------------------
RL9_BURVG       -----------------------------------------------
RL9_BURCM       -----------------------------------------------
RL9_JANMA       -----------------------------------------------
RL9_HERAR       -----------------------------------------------
RL9_THIDA       -----------------------------------------------
RL9_NEIMB       -----------------------------------------------
RL9_NEIMF       -----------------------------------------------
RL9_NEIMA       -----------------------------------------------
RL9_NEIM0       -----------------------------------------------
RL9_NEIG1       -----------------------------------------------
RL9_NEIGO       -----------------------------------------------
RL9_CHRVO       -----------------------------------------------
RL9_NITEU       -----------------------------------------------
RL9_NITEC       -----------------------------------------------
RL9_VESOH       -----------------------------------------------
RL9_RUTMC       -----------------------------------------------
RL9_BUCAI       -----------------------------------------------
RL9_BUCAP       -----------------------------------------------
RL9_BUCBP       -----------------------------------------------
RL9_BUCCC       -----------------------------------------------
RL9_WIGBR       -----------------------------------------------
RL9_BLOPB       -----------------------------------------------
RL9_BLOFL       -----------------------------------------------
RL9_PELUB       -----------------------------------------------
RL9_WOLPM       -----------------------------------------------
RL9_WOLTR       -----------------------------------------------
RL9_ANAPZ       D-GGADASGGTA-----------------------------------
RL9_ANAMM       DEGAGDASDGEEMPST-------------------------------
RL9_EHRCR       ESEKQDSVSE-------------------------------------
RL9_EHRCJ       DKEEENNIIE-------------------------------------
RL9_EHRRW       VVEGTEESQ--------------------------------------
RL9_EHRRG       VVEGTEESQ--------------------------------------
RL9_NEOSM       -----------------------------------------------
RL9_RICPR       -----------------------------------------------
RL9_RICTY       -----------------------------------------------
RL9_RICRS       -----------------------------------------------
RL9_RICRO       -----------------------------------------------
RL9_RICCN       -----------------------------------------------
RL9_RICM5       -----------------------------------------------
RL9_RICFE       -----------------------------------------------
RL9_RICAH       -----------------------------------------------
RL9_RICCK       -----------------------------------------------
RL9_RICBR       -----------------------------------------------
RL9_RICB8       -----------------------------------------------
RL9_ORITB       -----------------------------------------------
RL9_RUBXD       -----------------------------------------------
RL9_RHOBA       -----------------------------------------------
RL9_DESPS       -----------------------------------------------
RL9_RHOS1       ---------ASQED---------------------------------
RL9_RHOS4       ---------ASQED---------------------------------
RL9_RHOS5       ---------ASQDE---------------------------------
RL9_DINSH       ---------AASEDSDLVETPEDRATEEAEDEQP-------------
RL9_ROSDO       ---------AASEDEELAETAGVAPAEPSEEDDSAKA----------
RL9_RUEPO       ---------AASDDDDQAPASDETA----------------------
RL9_RUEST       ---------AASDDEGDAPAAAADEEESK------------------
RL9_PARDP       ---------AGRDEDEAAN----------------------------
RL9_JANSC       ---------AGMDDDDDDAPAPAQADPSSEESSEED-----------
RL9_RHOCB       ---------AASDDE--------------------------------
RL9_RHILO       --------FDG--GEDNA-----------------------------
RL9_CHESB       --------IEQEEGEENA-----------------------------
RL9_SINMW       --------IES---EEE------------------------------
RL9_RHIME       --------LES---EEE------------------------------
RL9_RHILT       --------GVD---EDEA-----------------------------
RL9_RHIL3       --------GVD---EDEA-----------------------------
RL9_RHIEC       --------GLD---ENEA-----------------------------
RL9_AGRFC       --------GNE---DDE------------------------------
RL9_BRUAB       ---------DEDEAEDQA-----------------------------
RL9_BRUA2       ---------DEDEAEDQA-----------------------------
RL9_BRUME       ---------DEDEAEDQA-----------------------------
RL9_BRUO2       ---------DEDEAEDQA-----------------------------
RL9_BRUC2       ---------DEDEAEDQA-----------------------------
RL9_BRUSI       ---------DEDEAEDQA-----------------------------
RL9_BRUSU       ---------DEDEAEDQA-----------------------------
RL9_OCHA4       ---------EEDEAEDQA-----------------------------
RL9_BARHE       ALAKEMNDNDANSINEEA-----------------------------
RL9_BARQU       ----EMNDNDANSINEQA-----------------------------
RL9_BART1       LLVEEINDNDINSPHQEA-----------------------------
RL9_BARBK       -----------------------------------------------
RL9_PARL1       --------EEAAGEEEDAKE---------------------------
RL9_MAGSA       ---------AAEA----------------------------------
RL9_RHORT       ---------DEDADEYEQG----------------------------
RL9_GLUDA       ---------TVEAPAEA------------------------------
RL9_GLUOX       ---------AAEASEEA------------------------------
RL9_GRABC       ---------VADEEEVEISA---------------------------
RL9_ACICJ       ---------VAEGPEQTA-----------------------------
RL9_RHOP2       ---------DAVQDDEEQPVEQ-------------------------
RL9_RHOPS       ---------DAQQDEE--PEQQ-------------------------
RL9_RHOPA       ---------DAQFGEE-QPTEE-------------------------
RL9_RHOP5       ---------DAMHEDE--ATEQ-------------------------
RL9_RHOPB       ---------EAHNDGE--QEEEAGDK---------------------
RL9_BRASO       ---------EAQE----EAAGEPAAQ---------------------
RL9_BRASB       ---------EAQED---EAAAGETAQ---------------------
RL9_NITWN       ---------DAQHDDEPAAEDDQNAEEK-------------------
RL9_NITHX       ---------EAEPDDVAEAGGEQTAEEK-------------------
RL9_BRADU       ---------EAQHDDVEPAPAAEETEK--------------------
RL9_CAUVC       ---------AGSFEGDHYEA---------------------------
RL9_CAUSK       ---------AGSFEGDHYES---------------------------
RL9_MARMM       AAQREATEDAGADESEETEA---------------------------
RL9_HYPNA       ---------RGDMGGDEE-----------------------------
RL9_NOVAD       ----------GGEEAAEA-----------------------------
RL9_SPHWW       ---------PAAEATDEA-----------------------------
RL9_ZYMMO       ---------ADADDNAETNSEESL-----------------------
RL9_SPHAL       ----------DADDAKEA-----------------------------
RL9_MAGMM       -----------------------------------------------
RL9_DESVH       -----------------------------------------------
RL9_DESVV       -----------------------------------------------
RL9_LAWIP       -----------------------------------------------
RL9_DESAG       -----------------------------------------------
RL9_ANADE       -----------------------------------------------
RL9_ANADF       -----------------------------------------------
RL9_MYXXD       -----------------------------------------------
RL9_SOLUE       -----------------------------------------------
RL9_KORVE       -----------------------------------------------
RL9_GEOMG       -----------------------------------------------
RL9_GEOSL       -----------------------------------------------
RL9_GEOUR       -----------------------------------------------
RL9_PELPD       -----------------------------------------------
RL9_PELCD       -----------------------------------------------
RL9_SYNAS       -----------------------------------------------
RL9_SYNFM       -----------------------------------------------
RL9_LEPBL       -----------------------------------------------
RL9_LEPBJ       -----------------------------------------------
RL9_LEPIC       -----------------------------------------------
RL9_LEPIN       -----------------------------------------------
RL9_BDEBA       -----------------------------------------------
RL9_THET8       -----------------------------------------------
RL9_THETH       -----------------------------------------------
RL9_THET2       -----------------------------------------------
RL9_DEIRA       -----------------------------------------------
RL9_DEIGD       -----------------------------------------------
RL9_CHLCV       -----------------------------------------------
RL9_CHLAB       -----------------------------------------------
RL9_CHLFF       -----------------------------------------------
RL9_CHLPN       -----------------------------------------------
RL9_CHLTR       -----------------------------------------------
RL9_CHLTA       -----------------------------------------------
RL9_CHLMU       -----------------------------------------------
RL9_PARUW       -----------------------------------------------
RL9_CHLAA       -----------------------------------------------
RL9_CHLPM       -----------------------------------------------
RL9_PELLD       -----------------------------------------------
RL9_CHLPD       -----------------------------------------------
RL9_CHLTE       -----------------------------------------------
RL9_CHLCH       -----------------------------------------------
RL9_AQUAE       -----------------------------------------------
RL9_PORGI       -----------------------------------------------
RL9_PARD8       -----------------------------------------------
RL9_BACFN       -----------------------------------------------
RL9_BACFR       -----------------------------------------------
RL9_BACTN       -----------------------------------------------
RL9_BACV8       -----------------------------------------------
RL9_CYTH3       -----------------------------------------------
RL9_FLAJ1       -----------------------------------------------
RL9_FLAPJ       -----------------------------------------------
RL9_GRAFK       -----------------------------------------------
RL9_THEEB       -----------------------------------------------
RL9_SYNEL       -----------------------------------------------
RL9_ACAM1       -----------------------------------------------
RL9_SYNP6       -----------------------------------------------
RL9_SYNE7       -----------------------------------------------
RL9_SYNY3       -----------------------------------------------
RL9_TRIV2       -----------------------------------------------
RL9_NOSS1       -----------------------------------------------
RL9_TRIEI       -----------------------------------------------
RL9_MICAN       -----------------------------------------------
RL9_SYNPW       -----------------------------------------------
RL9_SYNS3       -----------------------------------------------
RL9_SYNPX       -----------------------------------------------
RL9_SYNSC       -----------------------------------------------
RL9_SYNS9       -----------------------------------------------
RL9_PROMM       -----------------------------------------------
RL9_PROM3       -----------------------------------------------
RL9_SYNR3       -----------------------------------------------
RL9_PROMT       -----------------------------------------------
RL9_PROM1       -----------------------------------------------
RL9_PROMA       -----------------------------------------------
RL9_PROM0       -----------------------------------------------
RL9_PROM2       -----------------------------------------------
RL9_PROM9       -----------------------------------------------
RL9_PROMS       -----------------------------------------------
RL9_PROMP       -----------------------------------------------
RL9_PROM5       -----------------------------------------------
RL9_SYNJB       -----------------------------------------------
RL9_SYNJA       -----------------------------------------------
RL9_GLOVI       -----------------------------------------------
RL9_SALRD       -----------------------------------------------
RK9_PYRYE       -----------------------------------------------
RK9_PORPU       -----------------------------------------------
RK9_GRATL       -----------------------------------------------
RL9_UREPA       -----------------------------------------------
RL9_UREP2       -----------------------------------------------
RL9_MYCGE       -----------------------------------------------
RL9_MYCPN       -----------------------------------------------
RL9_MYCGA       -----------------------------------------------
RL9_MYCPU       -----------------------------------------------
RL9_MYCMO       -----------------------------------------------
RL9_MYCS5       -----------------------------------------------
RL9_MYCH7       -----------------------------------------------
RL9_MYCH2       -----------------------------------------------
RL9_MYCHJ       -----------------------------------------------
RL9_MYCCT       -----------------------------------------------
RL9_MYCMS       -----------------------------------------------
RL9_MESFL       -----------------------------------------------