CLUSTAL format seed alignment for MF_00505

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HTPG_BACSU      --------MAKKE------------------------FKAESKRLLDMMINSIYTQKEIF
HTPG_BACVZ      --------MRKKK------------------------FKAESKRLLDMMINSIYTQKEIF
HTPG_BACLD      --------MAKRE------------------------FKAESKRLLDIMINSIYSQKEVF
HTPG_BACHD      --------MERKE------------------------FKAESKRLLEMMVNSIYSQKEIF
HTPG_BACSK      --------MEKKQ------------------------FQAESKRLLEMMVNSIYSQKEIF
HTPG_OCEIH      --------MGKRK------------------------FKAESQKLLDMVINSIYSQREVF
HTPG_CLOBH      --------METKQ------------------------FKAESKRLLDLMINSIYTHKEIF
HTPG_CLOB1      --------METKQ------------------------FKAESKRLLDLMINSIYTHKEIF
HTPG_CLOBL      --------METKQ------------------------FKAESKRLLDLMINSIYTHKEIF
HTPG_ALKMQ      --------MIKKE------------------------FKAESKRLLDLMINSIYTHKEIF
HTPG_ALKOO      --------METKQ------------------------FKAESKRLLDLMIHSIYTQKEIF
HTPG_CLOP1      --------MEKRE------------------------FKAESKRLLDIVINSIYTNREIF
HTPG_CLOPE      --------MEKRE------------------------FKAESKRLLDIVINSIYTNREIF
HTPG_CLOPS      --------MEKRE------------------------FKAESKRLLDIVINSIYTNREIF
HTPG_CLOAB      --------MAVKQ------------------------FKAESKRLLDLMINSIYTNKEIF
HTPG_CLOTE      --------MAVKQ------------------------FKAESKRLLDLMINSIYTNKEIF
HTPG_FUSNN      --------MKKEEKI----------------------FKAETKELLNLMIHSIYTNKEIF
HTPG_RHIME      ----MSEVETSVEKHV---------------------FEADVAKLLHLMVHSVYSDKNVF
HTPG_RHIEC      ---MTTTVEQTAESHV---------------------FEADVARLLHMMVHSVYSDKGVF
HTPG_NITWN      -MTSTIDKNGAAESRV---------------------FEADVAKLLQMMVHSVYSDKDVF
HTPG_NITHX      -MTSTIDSDGAAESRV---------------------FEADVAKLLQMMVHSVYSDKDVF
HTPG_AZOC5      ---MTTAEAAAPESRT---------------------FEADVAKLLHLMVHSVYSDKDVF
HTPG_RHILO      ----MTTDTKATETRA---------------------FEADVSRLLHMMVHSVYSDKDVF
HTPG_RHOP2      ----MTTIDTASETKP---------------------FQAEVAELLNLMVHSVYSETDIF
HTPG_RHOPS      ----MTTTDTASETKP---------------------FQAEVAELLNLMVHSVYSETDIF
HTPG_RHOPA      ----MTMTDTASETKP---------------------FQAEVAELLNLMVHSVYSETDIF
HTPG_RHOP5      ----MTTTDTAPQTQP---------------------FQAEVAELLNLMVHSVYSETEIF
HTPG_RHOPB      ----MTTTDTAPQSQP---------------------FQAEVAELLNLMVHSVYSETDIF
HTPG_BRADU      ----MTTSDSAVHTQP---------------------FQAEVSELLHLMVHSVYSETDIF
HTPG_GLUOX      --MSETNTQKAAEKHE---------------------FSAEVGRLLDLVVHALYSDREIF
HTPG_MAGSA      ---------MAEEKRQ---------------------FQAEVGKLLDIVVHSLYSNKEIF
HTPG_RHORT      ---------MSEETLS---------------------FQAEVSKLLDIVVHSLYSDRKIF
HTPG_ROSDO      -----MTDASVKETFS---------------------FQTEVGQLLDIVAGSLYSNREIF
HTPG_RICRS      ---------MIQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICRO      ---------MIQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICCN      ---------MIQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICFE      ---------MTQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICAH      ---------MTQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICCK      ---------MTQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICBR      ---------MKQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICB8      ---------MKQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICTY      ---------MTQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_RICPR      ---------MTQEKKK---------------------FDAEVGKILNLMIHSLYSNKEIF
HTPG_ORITB      ---------MSVETYK---------------------FDAEVGKVLHLVIHTLYTNKKIF
HTPG_EHRCJ      -----MQDVVNSEKLK---------------------FDAEVGKVLKLVIHSLYTNKDIF
HTPG_EHRCR      -----MQDVINSEKLK---------------------FDAEVGKVLKLVIHSLYTNKDIF
HTPG_EHRRW      -----MQGTVNSERLK---------------------FDAEVGKVLKLVIHSLYTNKDIF
HTPG_EHRRG      -----MQGTVNSERLK---------------------FDAEVGKVLKLVIHSLYTNKDIF
HTPG_WOLPM      -MELKMHNVQETENLK---------------------FDAEVGKVLNIVIHSLYTNKDIF
HTPG_WOLTR      MMELKMHNVKGTENLK---------------------FDAEVGKVLNIVIHSLYTNKDIF
HTPG_ANAPZ      --------MADIEELK---------------------FDAEVGKVLSLVVHSLYTNKDIF
HTPG_ANAMM      --------MGDVEELK---------------------FSAEVGKVLSLVVHSLYTNKDIF
HTPG_NEOSM      -----MEKTEHKNTYS---------------------FDADASKVLNLVIHSLYRHKDVF
HTPG_TREDE      ---------MAQYK-----------------------FETEVNQLLSLIIHSLYSNKEIF
HTPG_TREPA      ---------MAQYE-----------------------FQTEVSQLLTLIIHSLYSHKEIF
HTPG_HELPH      -------MSNQEYT-----------------------FQTEINQLLDLMIHSLYSNKEIF
HTPG_HELPJ      -------MSNQEYT-----------------------FQTEINQLLDLMIHSLYSNKEIF
HTPG_HELPY      -------MSNQEYT-----------------------FQTEINQLLDLMIHSLYSNKEIF
HTPG_HELAH      -------MSNQEYT-----------------------FQTEINQLLDLMIHSMYSNKEIF
HTPG_HELHP      --------MATKHQ-----------------------FQTEITQLLDLMIHSLYSHKEIF
HTPG_WOLSU      ---------MAKHT-----------------------FQTEVNQLLDLMIHSLYSNKEIF
HTPG_CAMJJ      ------------MQ-----------------------FQTEVNQLLQLMIHSLYSNKEIF
HTPG_CAMJ8      ------------MQ-----------------------FQTEVNQLLQLMIHSLYSNKEIF
HTPG_CAMJR      ------------MQ-----------------------FQTEVNQLLQLMIHSLYSNKEIF
HTPG_CAMJE      ------------MQ-----------------------FQTEVNQLLQLMIHSLYSNKEIF
HTPG_CAMJD      ------------MQ-----------------------FQTEVNQLLQLMIHSLYSNKEIF
HTPG_CAMHC      ---------MAKRK-----------------------FKTEVNQLLNLMINSLYSNKEIF
HTPG_SULNB      ---------MAKHQ-----------------------FQTEIGQLLKLMTHSLYSNKEIF
HTPG_ARCB4      ---------MAKHQ-----------------------FQTEVGQLLHLMTHSLYSNKEIF
HTPG_BORBP      ----------MKKQ-----------------------FDTEVNDLLYLIIHSLYSHKEIF
HTPG_BORBU      ----------MKKQ-----------------------FDTEVNDLLYLIIHSLYSHKEIF
HTPG_BORAP      ----------MKKQ-----------------------FDTEVNDLLYLIIHSLYSHKEIF
HTPG_SULDN      ---------MAKHQ-----------------------FQTEANQILNLMIHSLYSNKEIF
HTPG_MYCTA      -------MNAHVEQLE---------------------FQAEARQLLDLMVHSVYSNKDAF
HTPG_MYCBO      -------MNAHVEQLE---------------------FQAEARQLLDLMVHSVYSNKDAF
HTPG_MYCBP      -------MNAHVEQLE---------------------FQAEARQLLDLMVHSVYSNKDAF
HTPG_MYCTU      -------MNAHVEQLE---------------------FQAEARQLLDLMVHSVYSNKDAF
HTPG_MYCA1      -------MNARVEQLE---------------------FQAEARQLLDLMVHSVYSNKDSF
HTPG_MYCPA      -------MNARVEQLE---------------------FQAEARQLLDLMVHSVYSNKDSF
HTPG_MYCUA      -------MNARVEQLE---------------------FQAEARQLLDLMIHSVYSNKDSF
HTPG_MYCLE      -------MSAQVEQLE---------------------FQAEARQLLDLMVHSVYSNKDAF
HTPG_MYCGI      -------MAPHVEQLE---------------------FQAEARQLLDLMIHSVYSNKDSF
HTPG_MYCVP      -------MAAHVEQLE---------------------FQAEARQLLDLMIHSVYSNKDSF
HTPG_RHOJR      -------MSTKIEQLE---------------------FQAETRQLLDLMIHSVYSNKDSF
HTPG_NOCFA      -------MTEHVEQLE---------------------FQAETHQLLELMIHSVYSNKDTF
HTPG_SALTO      ---------MSSETLE---------------------FQAEARQLLQLMVHSIYSNKDVF
HTPG_SALAI      ---------MSGETLE---------------------FQAEARQLLQLMVHSIYSNKDVF
HTPG_FRACC      -------MSTRVETLE---------------------FQAEARQLLQLMVHSIYSNKDIF
HTPG_STRCO      ---------MTTETFE---------------------FQVEARQLLQLMIHSVYSNKDVF
HTPG_GEOSL      ---------MSKTVKK---------------------FETEVQQLLDLVIHSLYSNKDIF
HTPG_GEOMG      ---------MTKTTKK---------------------FETEVQQLLDLVIHSLYSNKDIF
HTPG_GEOUR      ---------MTKSTKK---------------------FETEVQQLLDLVIHSLYSNKDIF
HTPG_PELPD      ---------MSKTTKQ---------------------FQTEVKQLLDLVIHSLYSNRDIF
HTPG_BDEBA      ---------MAKQVQN---------------------FNAEIKQLLDIVIHSLYSHKEIF
HTPG_MYXXD      ---MTVENAPQRETHA---------------------FQAEINQLLSLVINSLYSHKEIF
HTPG_METFK      ----MSTETLQKET---------------------LGFQAEVKQLLQLMIHSLYSNKEIV
HTPG_THIDA      -----MSATSSKET---------------------LGFQAEVKQLLQLMIHSLYSNKDIF
HTPG_CHRVO      -------MSAQKET---------------------LGFQTEVKQLLKLMIHSLYSNKEIF
HTPG_DECAR      -MSESATANANRET---------------------LGFQAEVKQLLQLMIHSLYSNKEIF
HTPG_AROAE      ---MTTEHAAGAQT---------------------LNFQAEVKQLLHLMIHSLYSNREIF
HTPG_NITEC      -----MQTAENVEH---------------------LNFQAEAKQLLRLMIHSLYSNKEIF
HTPG_NITEU      -----MQTAENIEH---------------------LNFQAEANQLLKLMIHSLYSNKEIF
HTPG_NITMU      -----MEATATKEH---------------------LNFQTEVKQLLKLMIHSLYSNKEIF
HTPG_BORBR      --MSQTTTNSASET---------------------LGFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BORPA      --MSQTTTNSASET---------------------LGFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BORPE      --MSQTTTTSASET---------------------LGFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BORA1      -----MTQNATSET---------------------LGFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURPS      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURMA      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURM7      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURP1      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURM9      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURMS      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURP0      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURP6      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURTA      ---------MTQQT---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURCA      ---------MAHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURCH      ---------MAHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURCM      ---------MAHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_BURL3      ---------MAHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_PARXL      ---------MAQET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_CUPNH      -------MTAPHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_CUPPJ      -------MSAPHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_CUPMC      -------MTAPHET---------------------MSFQAEVKQLLHLMIHSLYSNKEIF
HTPG_RALSO      -------MGAPHEK---------------------MAFQAEVKQLLHLMIHSLYSNKEIF
HTPG_ACISJ      ---------MSKHT---------------------HSFQAEVAQLLHLVTHSLYSNKEIF
HTPG_VEREI      ---------MSKQT---------------------LSFQAEVAQLLHLVTHSLYSNQEIF
HTPG_RHOFT      ---------MTKQT---------------------LSFQAEVAQLLHLVTHSLYSNKEIF
HTPG_POLNA      ---------MQKQT---------------------LSFQAEVAQLLKLVTHSLYSNPDIF
HTPG_POLSJ      ---------MHKQT---------------------LSFQAEVAQLLNLVTHSLYSNPDIF
HTPG_METPP      ---------MNKQT---------------------LSFQAEVQQLLHLVTHSLYSNKEIF
HTPG_PSYCK      ---------MSELNPVDNQKVDSINVDKSSPELKKHTFEAEVAQLLHLVTHSLYSNSDIF
HTPG_PSYA2      ---------MSEQNPTDSK----------NPELKKHTFEAEVAQLLHLVTHSLYSNSDIF
HTPG_ACIAD      ---------MTEQTATQNY-----------------SFQAEVAQLLHLVTHSLYSNPEIF
HTPG_ALKEH      -----MATDAHKET---------------------LEFQAEVQQLLHLMIHSLYSNKDIF
HTPG_HALHL      -----MSADTQSET---------------------LEFQAEVQQLLSLMIHSVYSNREVF
HTPG_NITOC      -----MTVASHKET---------------------LGFQTEVKQLLNLMIHALYSNKEIF
HTPG_MAGMM      -----MSAATETEV---------------------REFQTEVSQLLDLMIHALYSNKEIF
HTPG_METCA      -----MTEAENRVT---------------------LGFEAEVKQLLHLMIHSLYGNKEIF
HTPG_COXBR      -----MSLQPQAET---------------------LSFEAEVKQLLHLVAHSLYSNKEIF
HTPG_COXBU      -----MSLQPQAET---------------------LSFEAEVKQLLHLVAHSLYSNKEIF
HTPG_COXBN      -----MSLQPQSET---------------------LSFEAEVKQLLHLVAHSLYSNKEIF
HTPG_HAEIN      -------MSQNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_HAEIE      -------MSQNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_HAEI8      -------MSQNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_HAEIG      -------MSQNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_AGGAC      -------MSTNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_HAES1      -------MSTNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_HISS2      -------MSTNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_PASMU      -------MSTNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_ACTSZ      -------MSNNQQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_MANSM      -------MSN-KETCG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_ACTP2      -------MSTNQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_ECOLI      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECOL5      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECOHS      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECOL6      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SHIBS      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SHISS      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECO57      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECOLC      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECOUT      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECOK1      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ECO24      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SHIFL      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SHIDS      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SALPB      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SALPA      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SALTY      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SALCH      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SALTI      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_CITK8      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_CROS8      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_KLEP7      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ENT38      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_PECAS      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_YERPA      ------MNMKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_YERPS      ------MNMKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_YERPN      ------MNMKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_YERPP      ------MNMKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_YERPE      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_YERE8      ------MSMKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_SERP5      ------MSMKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_PHOLL      --------MKGQETRG---------------------FQSEVKQLLQLMIHSLYSNKEIF
HTPG_SODGM      --------MKGQETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_BAUCH      ------MILKEQETLG---------------------FQSEVKQLLNLMIHSLYSNKEIF
HTPG_VIBCH      --MSETATT-NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_VIBC3      --MSETATT-NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_VIBPA      --MSETVSQ-NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_VIBCB      --MSETVSH-NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_VIBVY      --MNETVAN-NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_VIBVU      --MNETVAN-NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_ALIF1      --MSEQTA--NKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_PHOPR      --MSEQGTHINKETRG---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_AERHH      -----MTQSVHAETHG---------------------FQTEVKQLLSLMAHSLYSNKEVF
HTPG_AERS4      -----MTQSVHAETHG---------------------FQTEVKQLLSLMAHSLYSNKEVF
HTPG_PSEHT      ------MTAAQKETLG---------------------FQTEVKQLLNLMIHSLYSNKEIF
HTPG_COLP3      -----MSETNQVQNHA---------------------FASDNAKILQLMIHSLYSNKEIF
HTPG_PSEA6      -----MADVAHQETHG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_IDILO      -----MAEAGQMEKHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSYIN      --------MEHQQNHT---------------------FSADTGKLLKLMIHSLYSNKEIF
HTPG_SHEPA      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHEHH      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHESH      --------MSQQETHG---------------------FQTEVKQLLNLMIHSLYSNKEIF
HTPG_SHELP      --------MSHQETHG---------------------FQTEVKQLLNLMIHSLYSNKEIF
HTPG_SHEPC      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHESW      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHESM      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHESR      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHESA      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHEON      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHEB9      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHEB8      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHEB5      --------MSQQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_SHEDO      --------MSQQETHG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_SHEFN      --------MSQQETHG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_SHEAM      --------MSHQETHG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_BUCAI      ------MKTQKKEVYN---------------------FQSETKKLLHLMIHSLYSNKEIF
HTPG_BUCAP      ------MNIQKKEVYS---------------------FQSEVKQLLHLMIHSLYSNKEIF
HTPG_BUCBP      ----MTANKNQKKTYN---------------------FKSETKELLHLMIHSLYSNREIF
HTPG_BUCCC      ------MNNKNKITHT---------------------FQSEVKELLHLMIHSLYSNKEIF
HTPG_WIGBR      --------MQKKETLE---------------------FQSEVKQLLNLMIHSLYSNKEIF
HTPG_LEGPH      -------MVSKQQTMG---------------------FQTEVKQMLHLVVHSLYSNKEIF
HTPG_LEGPC      -------MVSKQQTMG---------------------FQTEVKQMLHLVVHSLYSNKEIF
HTPG_LEGPL      -------MVSKQQTMG---------------------FQTEVKQMLHLVVHSLYSNKEIF
HTPG_LEGPA      -------MVSKQQTMG---------------------FQTEVKQMLHLVVHSLYSNKEIF
HTPG_PSEAE      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSEA7      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSEMY      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSEPF      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSEF5      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSEU2      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSE14      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSESM      -----MSVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_PSEPK      -----MTVETQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_XANC5      -----MTVETDKQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XANAC      -----MTVETDKQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XANOM      -----MTVDTDKQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XANOR      -----MTVDTDKQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XANCP      -----MTVDTDKQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XANC8      -----MTVDTDKQTLG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XYLFA      -----MTLEADKQTHG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_XYLFT      -----MTLEADKQTHG---------------------FQTEVKQLLQLMIHSLYSNKEIF
HTPG_SACD2      -----MTAEATVETRG---------------------FETEAKQLLHLMIHSLYSNKEIF
HTPG_MARHV      -----MTVEANKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_HAHCH      -----MTTATEKQTLG---------------------FQAEVKQLLHLMIHSLYSNKEIF
HTPG_MARMS      -----MATDTQKETLG---------------------FQTEVKQLLHLMIHSLYSNKEIF
HTPG_CHRSD      -----MTTAAHAETLG---------------------FQTEVKQLLQLMIHSLYSNREIF
HTPG_ALCBS      -------MSAEKQTHG---------------------FQAEVSRLLHLMIHSLYSNREIF
HTPG_RUTMC      --------MAEKQIHT---------------------FQTEVSQLLDLMIHSLYSNKEIF
HTPG_VESOH      --------MTIKQTHS---------------------FQTEVSQLLHLMIHSLYSNKEIF
HTPG_HYDCU      --------MSHTETHA---------------------FQTEVNQLLKLMIHALYSNKEIF
HTPG_FRAT1      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_FRATT      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_FRATW      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_FRATN      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_FRATF      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_FRATH      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_FRAP2      -------MSEKKYT-----------------------FETEVDKLLHLVIHSLYSNREIF
HTPG_PELLD      --------MSNKQN----------------TAVQEFEYKAEMKQLLDLIVHSLYTHPEIF
HTPG_CHLPM      --------MSKKTN----------------APVQEFEYKAEMKQLLDLIVHSLYTHPEIF
HTPG_CHLCH      --------MSSTENNGTA------------VPLQEFEYKAEMKQLLDLIIHSLYTHPEIY
HTPG_CHLPD      --------MTNNDT----------------PGMREYEYKAEMKQLLELIVHSLYTHPEIF
HTPG_CHLTE      --------MSSNPT----------------SSVREFEYKAEMKQLLNLIVHSLYTHPEIF
HTPG_DESHY      --------MSQIET---------------------KEFQTEIRQLLDIVINSLYTDREIF
HTPG_DESPS      --------MTEAKN---------------------YEFQAETKKLLDIVINSLYTERDVF
HTPG_DESAG      ----MSKEHGAAAE--------------------KHEFRTEVRKLLHIITHSLYTNREIF
HTPG_DESVH      --------MATAPA--------------------SHAFRTEVRKMLHIITHSLYTNREIF
HTPG_BACFR      ---------MQKGN-----------------------IGVTTENIFPIIKKFLYSDHEIF
HTPG_BACFN      ---------MQKGN-----------------------IGVTTENIFPIIKKFLYSDHEIF
HTPG_BACTN      ---------MQKGN-----------------------IGVTTENIFPIIKKFLYSDHEIF
HTPG_PORGI      --------MSKKGT-----------------------IGVTSDNIFPVIKKFLYSDHEIF
                                                            :: ::   :* .    

HTPG_BACSU      LRELISNSSDAIDKIYYKALTDDALTF----DKDSYYIKVAADKDARTLTISDTGIGMTK
HTPG_BACVZ      LRELISNASDAIDKIYYKALTDDSLTF----DQDNYYIKVTADKEARTLTVTDTGIGMTK
HTPG_BACLD      LRELISNASDAIDKIYYKALTDDSLTF----NKDDYYIKISADKENRTLTIADTGIGMTK
HTPG_BACHD      LRELISNASDAIDKIYYRALSDDSITF----NKDDYFIKVTANKEDRTLTVSDTGIGMTK
HTPG_BACSK      LRELISNASDAIDKMYYRSLTDDSLSF----EKDRYAIYVEADKDNRKLVMKDTGIGMTK
HTPG_OCEIH      LRELISNASDAIDKIYYKALTDDSLSF----DVDNYYIKITPNKEERTLTVVDTGIGMTK
HTPG_CLOBH      LRELISNSSDAIDKIYYKTLTDDSLKF----ERDNYYIRVVSDKENRILKIADTGIGMTK
HTPG_CLOB1      LRELISNSSDAIDKIYYKTLTDDSLKF----ERDNYYIRVVSDKENRILKIADTGIGMTK
HTPG_CLOBL      LRELISNSSDAIDKIYYKTLTDDSLKF----ERDDYYIKVVSDKENRVLKIADTGIGMTK
HTPG_ALKMQ      LRELISNSSDAIDKIYYKALTDESMIF----NKEDYYIKITTDKENKMLIISDMGIGMTK
HTPG_ALKOO      LRELISNASDAIDKIYYRALTDEALNF----NKEDYYIKIIPDKEKRILRIIDTGIGMTK
HTPG_CLOP1      LRELISNASDAIDKVYYKTLGDSSLTF----NKDDYYIKIKPNKEERTLTISDKGIGMTE
HTPG_CLOPE      LRELISNASDAIDKVYYKTLGDSSLTF----NKDDYYIKIKPNKEERTLTISDKGIGMTE
HTPG_CLOPS      LRELISNASDAIDKVYYKTLGDSSLTF----NKDDYYIKIKPNKEERTLTISDKGIGMTE
HTPG_CLOAB      LRELISNASDAIDKCYYRSLVDTNITF----NKDDFYIRISADKENKTLTITDTGIGMTK
HTPG_CLOTE      LRELISNASDAIDKRYYRSLTDENISF----NKKDFYIRIIPNKEERTLTIIDTGIGMSV
HTPG_FUSNN      LRELISNANDAIDKLKFQSLTDTDILK----DNDKFRIDISVDKDNRTLTISDNGIGMTY
HTPG_RHIME      LRELISNAADACEKLRYEAIVAPELLG----SDPASRITLTLDEENARLVIEDNGIGMGR
HTPG_RHIEC      LRELISNGADACEKLRYEAIETPSLLA----ADAESRIMLRLDEESRQLVVEDNGIGMRR
HTPG_NITWN      LRELISNAADACERLRYEAISDPALLT----DETRPRISITIDAERRQLAVEDNGIGMGR
HTPG_NITHX      LRELISNAADACERLRYDAISDPALLA----DDARPQIAITIDAERRQLTVDDNGIGMSR
HTPG_AZOC5      LRELISNAADACEKLRYEAITTPALLG----EDARPRITLAIDAEGGRLTVEDNGIGMSR
HTPG_RHILO      LRELISNAADACEKLRFEAVSRPELLG----DDPKPRISISADPDNKEITVEDNGIGMSR
HTPG_RHOP2      LRELISNASDALDKLRYESIANPALMA----DGGEPKIRIVPKKAPDTLTVIDNGIGMDR
HTPG_RHOPS      LRELISNASDALDKLRYESIATPALME----AGGAPKIQIVPRKAPDTLTVIDNGIGMNR
HTPG_RHOPA      LRELISNASDALDKLRYESIAKPELME----KGGEPKIRIIPKKAPDTLTIVDNGIGMDR
HTPG_RHOP5      LRELISNGSDALDKLRYEAISKPDLME----AGGTPKIQIVPKKAPDTLSVIDNGIGMDR
HTPG_RHOPB      LRELISNASDALDKLRYESIAKPELMA----DGGEPKIRILPKKEPDTLSVIDNGLGMDR
HTPG_BRADU      LRELVSNASDACDKLRYEAIESPALLG----EGDALKIRIIPNKTAGTLTIADNGIGMER
HTPG_GLUOX      LRELVANAADATDKRRFEALTDSALAL----PENAS-IRINPDKSQKELTISDDGVGMTH
HTPG_MAGSA      LRELISNASDSCDRLRYGAITEPDLLD----GDSEFRIRLVPDKDAGTLTIIDNGQGMSH
HTPG_RHORT      LRELISNASDACDKLRYEGLTQPALLE----GDGAFRIRLSIDAEAGTLTIADNGIGMNR
HTPG_ROSDO      LRELVSNASDACDKLRYEALTNPSLAQ----NADEFAISLAVDKKAKTLSVSDNGIGMNH
HTPG_RICRS      MRELISNASDACDKLRYLSQSNSELVA----GDSNFKITVKVDKDNGQIIIRDNGIGMNK
HTPG_RICRO      MRELISNASDACDKLRYLSQSNSELVA----GDSNFKITVKVDKDNGQIIIRDNGIGMNK
HTPG_RICCN      MRELISNASDACDKLRYLSQSNSELVA----GDSNFKITVKVDKDHRQIIIRDNGIGMNK
HTPG_RICFE      MRELISNASDACDKLRYLSQSNSELTS----GDSNFKITVKVDKDKGQIIIRDNGIGMNK
HTPG_RICAH      MRELISNASDACDKLRYLSQSHSELVA----SDSNFKITVKVDKDNWQIIIRDNGIGMNK
HTPG_RICCK      MRELISNASDACDKLRYLSQSNNTLVA----GDSNFKITVKIDKNNGQIIIRDNGIGMNK
HTPG_RICBR      MRELISNASDACDKLRYLSQSEAELVA----GDSNFKITVKGDKNNGQVIIRDNGIGMNK
HTPG_RICB8      MRELISNASDACDKLRYLSQSEAELVA----GDSNFKITVKGDKNNGQVIIRDNGIGMNK
HTPG_RICTY      MRELISNASDACDKLRYLSQSNSELIS----GDSNFKIIVKVDKDNEQIIIRDNGIGMNK
HTPG_RICPR      MRELISNASDACDKLRYLSQSNSELIA----GDSNFKIIVKVDKDNGQIIIRDNGIGMNK
HTPG_ORITB      LRELISNASDACDKLRYLSQSNAELLQ----GESDFKITVSMDKEKRYIILQDNGIGMNK
HTPG_EHRCJ      LRELISNASDACDKLRYESLSNQDLID----GDTDFKIVISVDQDKNRLYISDNGIGMNR
HTPG_EHRCR      LRELVSNASDACDKLRYESLSNQDLID----QDSDFKIVISVDQDKNRLYISDNGIGMNR
HTPG_EHRRW      LRELISNASDACDKLRYQSLSNQDLMD----AGSELKIVISVDKDKNRLYISDNGIGMNR
HTPG_EHRRG      LRELISNASDACDKLRYQSLSNQDLMD----AGSELKIVISVDKDKNRLYISDNGIGMNR
HTPG_WOLPM      LRELISNASDACDKLRYESQLNPNLLD----LSDELKITISSNKDKNELYITDNGIGMNR
HTPG_WOLTR      LRELVSNASDACDKLRYESQLNPNLLD----SSGELKITISSNKDENELYVTDNGIGMSR
HTPG_ANAPZ      LRELLSNASDACDKLRHEFLSNHDLME----EGEELKVVISVDKDSKQLSICDNGIGMNR
HTPG_ANAMM      LREVISNASDACDKLRYLFCSDQSLME----AGEELRIVISVDRDRRELTVRDNGIGMSR
HTPG_NEOSM      LRELISNASDALNKLREASYFDQELLE----DNPELEILISLNKEKKILEISDNGIGMDE
HTPG_TREDE      LRELVSNASDALDKLKYLTLSDEAYKQI----KFEPRIDICFDDTANTLTVRDTGLGMNE
HTPG_TREPA      LRELISNASDALDKLKYEALVDGTYKQL----HCEARIDIAFEEDAQRLVVRDTGIGMNA
HTPG_HELPH      LRELISNASDALDKLNYLMLTDEKLKGL----NITPSIHLSFDSQKKTLTIKDNGIGMDK
HTPG_HELPJ      LRELISNASDALDKLNYLMLTDEKLKGL----NTTPSIHLSFDSQKKTLTIKDNGIGMDK
HTPG_HELPY      LRELVSNASDALDKLNYLMLTDEKLKGL----NTTPSIHLSFDSQKKTLTIKDNGIGMDK
HTPG_HELAH      LRELISNASDALDKLNYLMLTDEKLKGL----KITPSIHLSFDSQKKTLTIKDNGIGMDK
HTPG_HELHP      LRELISNASDALDKLSYLTLTQENLKTL----SFEPRIDISFDEEKKTITIEDNGIGMNE
HTPG_WOLSU      LRELISNASDALEKLQYLTLTDENLKNL----QYTPRIDIHFDEEKKILTLSDTGIGMNE
HTPG_CAMJJ      LRELISNASDALDKLNFLSVSDDKYKSL----KFEPKIEIKIDKDKKTLSISDNGIGMDK
HTPG_CAMJ8      LRELISNASDALDKLNFLSVSDDKYKSL----KFEPKIEIKIDKDKKTLSISDNGIGMDK
HTPG_CAMJR      LRELISNASDALDKLNFLSVSDDKYKSL----KFEPKIEIKIDKDKKTLSISDNGIGMDK
HTPG_CAMJE      LRELISNASDALDKLNFLSVSDDKYKSL----KFEPKIEIKIDKDKKTLSISDNGIGMDK
HTPG_CAMJD      LRELISNASDALDKLNFLSVSDDKYKSL----KFEPKIEIKIDKDKKTLSISDNGIGMDK
HTPG_CAMHC      LRELISNASDALDKLNYLALTKDEYKKL----TYTPKIEITLDKEAKTLTISDTGIGMDE
HTPG_SULNB      IRELISNASDALDKFNYLSLTDEKFKEE----NWSGKISIKLDKDDNSLTIGDNGIGMNE
HTPG_ARCB4      IRELVSNASDAIDKLNYLRLTDENLKDKY--AQWKGEINISFDEKDKSLSIIDNGIGMNE
HTPG_BORBP      LRELISNASDAIDKLKFLSLTNEKFKNI----ALEPKIEITFDD--KSILIKDNGIGMNE
HTPG_BORBU      LRELISNASDAIDKLKFLSLTNEKFKNI----ALEPKIEISFDD--KSILIKDNGIGMDE
HTPG_BORAP      LRELISNASDAIDKLKFLSLTNEKFKNI----ALEPKIEITFDD--KSILIKDNGIGMNE
HTPG_SULDN      IRELVSNASDALDKLNMLVLTNDEYKGV----NFSPRIDIIADKEAKTLTIKDSGIGMNE
HTPG_MYCTA      LRELISNASDALDKLRIEALRNKDLE----VDTSDLHIEIDADKAARTLTVRDNGIGMAR
HTPG_MYCBO      LRELISNASDALDKLRIEALRNKDLE----VDTSDLHIEIDADKAARTLTVRDNGIGMAR
HTPG_MYCBP      LRELISNASDALDKLRIEALRNKDLE----VDTSDLHIEIDADKAARTLTVRDNGIGMAR
HTPG_MYCTU      LRELISNASDALDKLRIEALRNKDLE----VDTSDLHIEIDADKAARTLTVRDNGIGMAR
HTPG_MYCA1      LRELISNASDALDKLRLEAFRNKDLD----VDTSDLHIQIEVDKDARTLTIRDNGIGMTR
HTPG_MYCPA      LRELISNASDALDKLRLEAFRNKDLD----VDTSDLHIQIEVDKDARTLTIRDNGIGMTR
HTPG_MYCUA      LRELISNASDALDKLRIEAFRNKDLE----VDTSDLHIETEADKGARTLTVRDNGIGMTR
HTPG_MYCLE      LRELISNASDALDKLRLEAFRNKDLDPR-TVDTSDLHIEIEVDKNTRILTVRDNGIGMTR
HTPG_MYCGI      LRELISNASDALDKLRLEAFRNKDLD----VDTSDLHIEIVVDKEARTLTVRDNGIGMSR
HTPG_MYCVP      LRELVSNASDALDKLRLESFRNKDLD----VDTSDLHIEIDVDKEARTLTVRDNGIGMTR
HTPG_RHOJR      LRELISNASDALDKLRLEAFRNKELH----VDTSDLHVEIEVDAEKRTLTVRDNGIGMSH
HTPG_NOCFA      LRELISNASDALDKLRLESFKDKDLH----VDTADLHIELEVDKDNRILTVRDNGIGMSR
HTPG_SALTO      LRELISNASDALDKLRLASLRDKDLD----VDTADLHIAIEIDPDARTLTVRDNGIGMSR
HTPG_SALAI      LRELISNASDALDKLRLASMRDKDLD----VDTSDLHIAIEVDQDARTLTVRDNGIGMTR
HTPG_FRACC      LRELISNASDALDKLRIASLVKDGPR----VDSADLRIEIEADVNARTLTVRDNGIGMSR
HTPG_STRCO      LRELVSNASDALDKLRLAALRDDAPD----ADVSDLHIELEVDKDARTLTVRDNGIGMSY
HTPG_GEOSL      LRELISNASDAIDKVLFESHQNAAVIE----GEPEGKIKLIPDKDAGTLTIRDNGVGMTL
HTPG_GEOMG      LRELISNSSDAIDKVLFEAHQNAAVIE----GEPEGKIKLIPDKEAGTITIRDNGVGMTM
HTPG_GEOUR      LRELVSNASDAIDKVKFESHSNMDILE----GNTDWKIKLIPDKTAGTLTIRDNGIGMNV
HTPG_PELPD      LRELISNSSDAIDKIRFEAHSNEELLE----GNSDWKIKLIPDKDAGTLTILDNGIGMTM
HTPG_BDEBA      LRELLSNASDAIDKLKFNSLTHPSLLP----ENWQPAIRLEPNSETKTLKIIDNGIGMTQ
HTPG_MYXXD      LRELVSNASDALDKLRFRAITEPELL----ADEPALELRLIPDEAKGTLTIEDTGIGMSH
HTPG_METFK      LRELISNASDAADKLRFEALADNSLY----GNDSDLKIRVSFDKQARTITISDNGIGMSR
HTPG_THIDA      LRELISNASDAADKLRFEALSDAALF----ENDPELKIRIAFDRDARTLTISDNGIGMSR
HTPG_CHRVO      LRELISNASDAADKLRFEGLAKPELF----ENDPELKIRIAFDKDARTITIADNGIGMSR
HTPG_DECAR      LRELVSNASDACDKLRFEALNNSALY----GDDSELKIRIAFDKDARTITISDNGIGLSR
HTPG_AROAE      LRELVSNASDACDKLRFEALDKPELF----EGDSELAIRVGFDSEAKTVTVSDNGIGMSR
HTPG_NITEC      LRELISNASDAADKLRFEGLSDTALY----ESDPDLKIRIAYDKEARTITISDNGIGMSR
HTPG_NITEU      LRELISNASDAADKLRFEGLSDAALY----ESDPDLKIRIAYDKEARTITIIDNGIGMSR
HTPG_NITMU      LRELISNASDAADKLRFEALTDGALY----ESDSDLKIRVSYDKEARTITVADNGIGMSR
HTPG_BORBR      LRELVSNASDACDKLRFEAIDQPGLL----DGDGELAIRVDYDKAARTITISDNGIGLSR
HTPG_BORPA      LRELVSNASDACDKLRFEAIDQPGLL----DGDGELAIRVDYDKAARTITISDNGIGLSR
HTPG_BORPE      LRELVSNASDACDKLRFEAIDQPGLL----EGDGELAIRVGYDKAARTITISDNGIGLSR
HTPG_BORA1      LRELVSNASDACDKLRFEAIDQPELL----AGDSELAIRVSYDKAARTITIADNGIGLSR
HTPG_BURPS      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURMA      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURM7      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURP1      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURM9      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURMS      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURP0      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURP6      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTITIDDNGIGMSR
HTPG_BURTA      LRELVSNASDAADKLRFEALENNALY----ESDPNLRIRLSFDKAARTLTIDDNGIGMSR
HTPG_BURCA      LRELVSNASDAADKLRFEGLADNALY----ENDPNLRIRIGYDKAARTITIDDNGIGMSR
HTPG_BURCH      LRELVSNASDAADKLRFEGLADNALY----ENDPNLRIRIGYDKAARTITIDDNGIGMSR
HTPG_BURCM      LRELVSNASDAADKLRFEGLADNALY----ENDPNLRIRIGFDKAARTITIDDNGIGMSR
HTPG_BURL3      LRELVSNASDAADKLRFEGLADNALY----EDDPNVRIRIGYDKAARTITIDDNGIGMSR
HTPG_PARXL      LRELISNASDAADKLRFEAIENSALY----ENDPNLRIRVSYDKDARTITIDDNGIGMSR
HTPG_CUPNH      LRELVSNASDATDKLRFEAIANPSLL----ENDADLAIRIEADAKARTLTITDNGIGMSR
HTPG_CUPPJ      LRELVSNASDATDKLRFEAIANPSLL----ENDADLAIRIEADTAARTLKITDNGIGMSR
HTPG_CUPMC      LRELVSNASDATDKLRFEAIANPALL----ENDADLAIRIEADPAARTLKITDNGIGMSR
HTPG_RALSO      LRELVSNASDAVDKLRFEGIADPSLL----EGGGELGIRIGFDAQARTVTIADNGIGMSR
HTPG_ACISJ      LRELVSNASDACDKLRFEALNNAALY----EDAPNLEVRVSFDKEARTLTITDNGIGMSE
HTPG_VEREI      LRELISNASDACDKLRFAGLNQPALF----EDAPQLEVRVSFDQTARTLTITDNGIGMSQ
HTPG_RHOFT      LRELISNASDACDKLRYEAINDSGLY----EDAPTLEVRVSFDPAAKTLTISDNGIGMSA
HTPG_POLNA      LRELISNASDACDKLRFEALNDAGLY----ENDSELKVRVSFDKAAKTLTITDNGIGMSQ
HTPG_POLSJ      LRELISNASDACDKLRFEALNDAALY----EGDSELQVRLRYNKTANTLTITDNGIGLSE
HTPG_METPP      LRELISNASDACDKLRFEALNDAALY----EDASTLEVRVSFDKEARTITIADNGIGMSA
HTPG_PSYCK      VRELVSNASDACDKLRFEATNDDSLY----EDDGELKIRIAVDEDAKTITFTDNGIGMNE
HTPG_PSYA2      VRELVSNASDACDKLRFEATNDDSLY----EDDGELRIRIAVDEDAKTITFTDNGIGMNE
HTPG_ACIAD      LRELISNASDACDKLRFEGINHPEYY----EDDANLRVRVSLDKENKTITISDNGIGLSQ
HTPG_ALKEH      LRELISNASDAIDKLRFQSLQDESLL----EGEGDLRIRVSVDKDARTITVADNGIGMTR
HTPG_HALHL      LRELISNASDAIDKLRFEALQQESLY----EDDPELKIRVEADPEARTVTVIDNGIGMSR
HTPG_NITOC      LRELISNGADAADKLRFEALTDDALY----EDDSALHIRLSYDKDKRTLTIADNGIGMGR
HTPG_MAGMM      LRELISNASDANDKLRFAGLSDDSLF----EGDSELTIKLEFDKEAGTFSIMDNGIGMSR
HTPG_METCA      LRELISNASDAADKLRFSALGNDALY----EGDSRLRVRIEFDKAARTLSISDNGIGMTR
HTPG_COXBR      LRELISNSSDAADKLRYQALSDAALY----ENDADLKIWIDFDKDNRTITIRDNGIGMSR
HTPG_COXBU      LRELISNSSDAADKLRYQALSDAALY----ENDADLKIWIDFDKDNRTITIRDNGIGMSR
HTPG_COXBN      LRELISNSSDAADKLRYQALSDAALY----ENDADLKIWIDFDKDNRTITIRDNGIGMSR
HTPG_HAEIN      LRELISNASDAADKLRFKALSNPALY----EGDGDLRVRVSFDADKGTITISDNGIGMTR
HTPG_HAEIE      LRELISNASDAADKLRFKALSNPALY----EGDGDLRVRVSFDADKGTITISDNGIGMTR
HTPG_HAEI8      LRELISNASDAADKLRFKALSNPALY----EGDGDLRVRVSFDADKGTITISDNGIGMTR
HTPG_HAEIG      LRELISNASDAADKLRFKALSNPALY----EGDGDLRVRVSFDADKGIITISDNGIGMTR
HTPG_AGGAC      LRELISNASDAADKLRFKALSNPDLY----AGDGELRVCISFDSEKGTLTVSDNGIGMTR
HTPG_HAES1      LRELISNASDAADKLRFKALSAPELY----EGDGDLKVRISFDAEKGTLTISDNGIGMTR
HTPG_HISS2      LRELISNASDAADKLRFKALSAPELY----EGDGDLKVRISFDAEKGTLTISDNGIGMTR
HTPG_PASMU      LRELISNASDAADKLRFKALSVPELY----EGDGDLKVRIRFDEEKGTLTISDNGIGMTR
HTPG_ACTSZ      LRELISNASDAADKLRFKALSAPELY----EGDGDLKVRIRFDEKKGTLTVSDNGIGMTR
HTPG_MANSM      LRELISNASDAADKLRFKALSAPELY----EGDGDLKVRISFDDKKGTLTVSDNGIGMTR
HTPG_ACTP2      LRELISNASDAADKLRFKALSNPALY----EGDGELRVRVSFDETLGTLTISDNGIGMNR
HTPG_ECOLI      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECOL5      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECOHS      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECOL6      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_SHIBS      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_SHISS      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECO57      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECOLC      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECOUT      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECOK1      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_ECO24      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_SHIFL      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_SHIDS      LRELISNASDAADKLRFRSLSNPDLY----EGDGELRVRVSFDKDKRTLTISDNGVGMTR
HTPG_SALPB      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTIADNGVGMNR
HTPG_SALPA      LRELISNASDAADKLRFRALSNPDLY----EGDSELRVRVSFDKDKRTLTIADNGVGMNR
HTPG_SALTY      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTIADNGVGMNR
HTPG_SALCH      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTIADNGVGMNR
HTPG_SALTI      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTIADNGVGMNR
HTPG_CITK8      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDKRTLTIADNGVGMNR
HTPG_CROS8      LRELISNASDAADKLRFRALSSPDLY----EGDGDLRVRVSFDKDKRTLTIADNGIGMTR
HTPG_KLEP7      LRELISNASDAADKLRFRALSQPDLY----EGDGELRVRVSFDKDNRTLTIADNGIGMNR
HTPG_ENT38      LRELISNASDAADKLRFRALSNPDLY----EGDGELRVRVSFDKDNRTLTIADNGIGMNR
HTPG_PECAS      LRELISNASDAADKLRFRALSTPELY----AGDGDLRVRVSTDKEKRTLTISDNGIGMSR
HTPG_YERPA      LRELISNASDAADKLRFRALSNPELF----EGDGELRVRLSFDKEKRTLTLSDNGIGMTR
HTPG_YERPS      LRELISNASDAADKLRFRALSNPELF----EGDGELRVRLSFDKEKRTLTLSDNGIGMTR
HTPG_YERPN      LRELISNASDAADKLRFRALSNPELF----EGDGELRVRLSFDKEKRTLTLSDNGIGMTR
HTPG_YERPP      LRELISNASDAADKLRFRALSNPELF----EGDGELRVRLSFDKEKRTLTLSDNGIGMTR
HTPG_YERPE      LRELISNASDAADKLRFRALSNPELF----EGDGELRVRLSFDKEKRTLTLSDNGIGMTR
HTPG_YERE8      LRELISNASDAADKLRFRALSHPELF----EGDGELRVRLSFDKEKRTLTLSDNGIGMSR
HTPG_SERP5      LRELISNASDAADKLRFRALSAPELY----EGDGELRVRLSFDKDQRTLTIADNGIGMNR
HTPG_PHOLL      LRELISNASDAADKLRFRALSVPKLY----ENDGELRVRLSFDKEKRCITISDNGIGMTR
HTPG_SODGM      LRELISNASDAADKLRFRALSQPDLY----EGDGELRVRLSCDKEKRTLTFSDNGIGMRR
HTPG_BAUCH      LRELISNASDAADKLRFLALAKPDLY----EGNGELYVRIICNKEKRTITIIDNGIGMCR
HTPG_VIBCH      LRELISNASDAVDKLRFQALSHPDLY----QGDAELGVKLSFDKDKNTLTISDNGIGMTR
HTPG_VIBC3      LRELISNASDAVDKLRFQALSHPDLY----QGDAELGVKLSFDKDKNTLTISDNGIGMTR
HTPG_VIBPA      LRELISNASDASDKLRFQALSNPDLY----EGNADLGVKLSFDESANTLTISDNGIGMSR
HTPG_VIBCB      LRELISNASDASDKLRFQALSNPDLY----EGNADLGVKLAFDESANTLTISDNGIGMSR
HTPG_VIBVY      LRELISNASDAADKLRFQALSNPALY----ENDAELGVKLSFNEEHNTLTISDNGIGMSR
HTPG_VIBVU      LRELISNASDAADKLRFQALSNPALY----ENDAELGVKLSFNEEHNTLTISDNGIGMSR
HTPG_ALIF1      LRELISNASDASDKLRFKALSNGDLY----EGNADLGVKLSFNEAANTLTISDNGIGMSR
HTPG_PHOPR      LRELISNASDAADKLRFRALSQPDLF----ENDADIGVKLSFNAEAGTLTVSDNGIGMNR
HTPG_AERHH      LRELISNASDAADKLRFKALSDASLF----ENDGQLRVRLVVDKENRTLTISDNGIGMTR
HTPG_AERS4      LRELISNASDAADKLRFKALSDASLF----ENDGQLRVRLVVDKENRTLTISDNGIGMTR
HTPG_PSEHT      LRELVSNASDAADKLRFLALSQGDLY----QGDADLRVRISADKEANTITISDNGIGMTR
HTPG_COLP3      LRELVSNAADAADKLRFKALSDNTLY----ENDGDLRVRVSCDKENNTLTISDNGIGMNV
HTPG_PSEA6      LRELVSNAADAADKLRFKALSNDSLY----EGDGDLCVKLSIDKDAGSITISDNGIGMDR
HTPG_IDILO      LRELVSNASDAADKLRFKALSDNSLY----GDDSDLHVRVSVDKDSRTITISDNGVGMTR
HTPG_PSYIN      LRELVSNAADAADKLRFKALSDGSLF----ENDGDLRVRLSFDADLKTITISDNGIGMSR
HTPG_SHEPA      LRELVSNAADAADKLRYEALTNDNLY----EGDGELRVRISADKEKGTVTIEDNGIGMTR
HTPG_SHEHH      LRELVSNAADAADKLRYEALTNDALY----EGDGELRVRISADKEKGTVTIEDNGIGMTR
HTPG_SHESH      LRELVSNAADASDKLRYEALTNDALY----EGDGELRVRISTNKEKGTVTIEDNGIGMTR
HTPG_SHELP      LRELVSNAADAADKLRYEALTKDELY----EGDGELRVRVSADSEKGTVTIEDNGIGMTR
HTPG_SHEPC      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKDKGTVTIEDNGVGMTR
HTPG_SHESW      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKDKGTVTIEDNGVGMTR
HTPG_SHESM      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHESR      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHESA      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHEON      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHEB9      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHEB8      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHEB5      LRELVSNAADAADKLRYLALTNDALY----EGDGELRVRISADKEKGTVTIEDNGVGMTR
HTPG_SHEDO      LRELVSNAADAADKLRYLALTDDALY----EGDGELRVRVSTDKEKGTVTISDNGIGMTR
HTPG_SHEFN      LRELVSNAADAADKLRYLALTDDTLY----EGNGDLRVRVSANKEKGTVTISDNGIGMTR
HTPG_SHEAM      LRELVSNAADAADKLRYLALTNDSLY----EGDGELRVRVSADKDKGTVTIEDNGIGMTR
HTPG_BUCAI      LRELISNSSDAIDKLRFESISSPELY----ENDSDVKIQISINKAQRTLIISDNGIGMTK
HTPG_BUCAP      LRELISNASDAIDKLRFQSISNPELY----ENDSDFKIQISINKSQGTLIISDNGIGMTR
HTPG_BUCBP      FRELISNAADAIDKLKFNAISAPELY----ENDTNLYIRIFSNKNNNSLTISDNGIGMKY
HTPG_BUCCC      LRELISNASDAIEKIRFEKLYSLKKYR---ENLYTPKIKISIKKDEKKIIISDNGIGMTY
HTPG_WIGBR      LRELISNASDALDKLRFLSISD-EKIK---IKQNKLCIFIDYDKNKKSITIQDNGIGMSK
HTPG_LEGPH      LRELISNASDALDKLRFLALSNGSLF----ENDSDLKISIQINEKLQTITISDNGIGLSW
HTPG_LEGPC      LRELISNASDALDKLRFLALSNGSLF----ENDSDLKISIQINEKLQTITISDNGIGLSW
HTPG_LEGPL      LRELISNASDALDKLRFLALSNGSLF----ENDSDLKISIQINEKLQTITISDNGIGLSW
HTPG_LEGPA      LRELISNASDALDKLRFLALSNGSLF----ENDSDLKISIQINEKLQTITISDNGIGLSW
HTPG_PSEAE      LRELISNASDAADKLRFEALANPELL----EGGAELKIRVSFDKEANTVTLEDNGIGMSR
HTPG_PSEA7      LRELISNASDAADKLRFEALANPELL----EGGAELKIRVSFDKEANTVTLEDNGIGMSR
HTPG_PSEMY      LRELISNASDAADKLRFEALAKPELL----EGGAELKIRLSFDKDAKTVTLEDNGIGMSR
HTPG_PSEPF      LRELISNASDAVDKLRFEALAKPELL----EDGAELKIRVSFDKDAKTVTLEDNGIGMNR
HTPG_PSEF5      LRELISNASDAVDKLRFEALSKPELL----EGGAELKIRVSFDKDAKTVTLEDNGIGMSR
HTPG_PSEU2      LRELISNASDAVDKLRFEALSKPELL----EGGAELKIRVSFDKDAKTVTLEDNGIGMSR
HTPG_PSE14      LRELISNASDAVDKLRFEALSKPELL----EGGAELKIRVSFDKDAKTVTLEDNGIGMSR
HTPG_PSESM      LRELISNASDAVDKLRFEALSRPELL----EGGAELKIRVSFDKDAKTVTLEDNGIGMSR
HTPG_PSEPK      LRELISNASDAADKLRFEALAKPELF----EGDADLKIRLSFDKDAGTVTLEDNGIGMSR
HTPG_XANC5      LRELVSNAADAADKLRFEALVKPELL----EGSGELRIRVDYDKDARTVTIDDNGIGMSR
HTPG_XANAC      LRELVSNAADAADKLRFEALVKPELL----EGSGELRIRVDYDKDARTVTIDDNGIGMSR
HTPG_XANOM      LRELVSNAADAADKLRFEALVKPELL----EGSGELRIRVDYDKDARTVTIDDNGIGMSR
HTPG_XANOR      LRELVSNAADAADKLRFEALVKPELL----EGSGELRIRVDYDKDARTVTIDDNGIGMSR
HTPG_XANCP      LRELVSNAADAADKLRFEALVKPELL----EGSGELRIRVDFDKEARTVTIDDNGIGMSR
HTPG_XANC8      LRELVSNAADAADKLRFEALVKPDLL----EGSGELRIRVDFDKDARTVTIDDNGIGMSR
HTPG_XYLFA      LRELISNAADAADKLRFEALSAPALL----EEDPNLRIRVEFDKQAHTITIDDNGIGMSR
HTPG_XYLFT      LRELISNAADAADKLRFEALSAPSLL----EEDPNLRIRVEFDKQAHTITIDDNGIGMSR
HTPG_SACD2      LRELVSNASDAADKLRFEALKQPELL----EQDSELKITIDFDKEAKTLSITDNGIGMNR
HTPG_MARHV      LRELISNASDAEDKLRFAALKDDKLF----EGDSDLKIRLDYDKDAGTITIADNGIGMTR
HTPG_HAHCH      LRELVSNASDALDKLRFQALSKEDLY----EGDNDLKVRLEFDDKAQTITLSDNGIGMSR
HTPG_MARMS      LRELISNASDAVDKLRFESVANADLL----AEDPNLRVRIEFDKDTNTVVIDDNGVGMSR
HTPG_CHRSD      LRELISNAADACDKLRYEALENDTLY----GDDSELRIEIEHDAEAGTVTVRDNGIGMSR
HTPG_ALCBS      LRELISNASDACDKLRFEALDNPALL----EQGGEPQITLRVDKDAGTLTIADNGIGMSE
HTPG_RUTMC      LRELVSNSSDAVDKLKFKSLSDDTLI----EGKEELQIHINTNKDASTITITDNGIGMTE
HTPG_VESOH      LRELISNASDAVDKLKFKSLSDDTLI----EGKEALQIHIDVNKDANTITITDNGIGMSE
HTPG_HYDCU      LRELVSNASDALDKLRFESVSNDALS----EGESELAIQVGFDKEARTVSIIDNGIGMTR
HTPG_FRAT1      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_FRATT      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_FRATW      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_FRATN      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_FRATF      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_FRATH      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_FRAP2      LRELVSNSSDAIEKLRYESISNAALN----EDDTDYAIRIDFDKDAKTITVSDNGIGMTE
HTPG_PELLD      LRELVSNASDALSKARFSALTDDTMAK----VSGEAAIRISLDAKTAAFAIEDTGIGMTE
HTPG_CHLPM      LRELVSNAADALSKARFSSLTDGGLMA----AAGEDAIHITLDKEKLLFVIEDSGIGMSE
HTPG_CHLCH      LRELISNASDALSKARFNALTDQDMLD----KDAELAIRLTLNAEEKSVVIEDSGIGMTE
HTPG_CHLPD      LRELISNASDALSKVRFNALTDESIIN----SDAGLAIRITLDPEAHTIVIEDNGTGMTE
HTPG_CHLTE      LRELISNASDALGKARFRMLSSDEGLD----KSGDLKITITVDKESGSFVIEDTGIGMSE
HTPG_DESHY      LRELISNAADASEKVRYMQLSGQNVKD----QELPLEIRITPDENAKTLTIADAGIGMTK
HTPG_DESPS      VRELISNSADALEKMRHEALTCQEVLD----EDLPLEITIDLDEEAHTLTISDSGIGMTE
HTPG_DESAG      LRELVSNASDALDKLRFAQTRGEAAPA----ADLDLNIAITVNEETRTLTVSDTGIGMTR
HTPG_DESVH      LRELVSNASDALDKLRFIRSRGDAVVA----PDLAPGIDISVDKEARILTIADTGVGMTR
HTPG_BACFR      LRELVSNAVDATQKLNTLASISEFKG-----ELGDLTVHVSLGK--DTITISDRGIGLTA
HTPG_BACFN      LRELVSNAVDATQKLNTLASISEFKG-----ELGDLTVHVSLGK--DTITISDRGIGLTA
HTPG_BACTN      LRELVSNAVDATQKLNTLASIGEFKG-----ELGDLTIHVELGK--DTITISDRGIGLTA
HTPG_PORGI      LREIVSNAVDATQKLKTLTSVGEFKG-----ETGDLRVTVSVDEVARTITVSDRGVGMTE
                .**:::*. *:  :                       :          . . * * *:  

HTPG_BACSU      DELEQHLGTIAKSGSLAFKKE-NELKDG-------HDIIGQFGVGFYAAFMVADVVTVIS
HTPG_BACVZ      DELEQHLGTIAKSGSLAFKQE-NDSKDG-------HDIIGQFGVGFYAAFMVADKVTVKS
HTPG_BACLD      EELEEHLGTIAKSGSLAFKQE-NELKDG-------HDIIGQFGVGFYAAFMVADTVTVIT
HTPG_BACHD      EELESNLGTIAKSGSLAFKTE-NESKDG-------HDIIGQFGVGFYSAFMVADKVTVTT
HTPG_BACSK      EELEANLGTIAKSGSLAFKKE-TEIEDG-------HDIIGQFGVGFYAAFMVADKVTVIT
HTPG_OCEIH      EELENNLGVIAKSGSHTFKSE-NEIKDG-------HDIIGQFGVGFYAAFMVADKVEVVT
HTPG_CLOBH      EELENNLGVIAKSGSLQFKKE-NEVKEG-------YDIIGQFGVGFYSAFLVSDDVTVIS
HTPG_CLOB1      EELENNLGVIAKSGSLQFKKE-NEVKEG-------YDIIGQFGVGFYSAFLVSDDVTVIS
HTPG_CLOBL      EELENNLGVIAKSGSLQFKKE-NEVKEG-------YDIIGQFGVGFYSAFLVSDDVTVIS
HTPG_ALKMQ      EELEENLGVIAQSGSFTFKKE-NEIKDG-------FDIIGQFGVGFYSAFMVADSVTVIS
HTPG_ALKOO      EELEENLGVIAKSGSLAFKSA-HELKDG-------YDIIGQFGVGFYSSFMVAETVTVIS
HTPG_CLOP1      KELDENLGVIAKSGSLQFKKE-NEIKDG-------FDIIGQFGVGFYSGFLVADKITVIT
HTPG_CLOPE      KELDENLGVIAKSGSLQFKKE-NEIKDG-------FDIIGQFGVGFYSGFLVADKITVIT
HTPG_CLOPS      KELDENLGVIAKSGSLQFKKE-NEIKDG-------FDIIGQFGVGFYSGFLVADKITVIT
HTPG_CLOAB      DDLENNLGTIAKSGSFAFKSE-NEAKEG-------VDIIGQFGVGFYSAFMVADDVTVIS
HTPG_CLOTE      EELENNLGTIAKSGSLAFKNK-MESKEG-------IDIIGQFGVGFYSAFMIADKIVVKS
HTPG_FUSNN      EEVDDNIGTIAKSGSKLFKEQLEEAKKGD------IDIIGQFGVGFYSGFIVADKITLET
HTPG_RHIME      DELVESLGTIARSGTRAFMERIE-----AAQNKDGAQLIGQFGVGFYSAFMVADNVDVVS
HTPG_RHIEC      DEMIEALGTIARSGTRAFMERIA-----ENKAAEGAQFIGQFGVGFYSCFMVAEHVDVIS
HTPG_NITWN      DELVDALGTIARSGTKAFIEQAE-----AAESGDGVALIGQFGVGFYSAFMVADQVDVVS
HTPG_NITHX      DEMVDALGTIARSGTKAFIEQAKVEQAKSAEAGDGVTVIGQFGVGFYSAFMVADQVDVIS
HTPG_AZOC5      DEMVEALGTIARSGTKAFMERIE-----AAAGGEKAELIGQFGVGFYSAFMVAEKVDVIS
HTPG_RHILO      DDMAEALGTIARSGTRAFIERVG-------SGTEDTQLIGQFGVGFYSAFMVADRVDVIS
HTPG_RHOP2      QELIDNLGTIAKSGTKSFLTKLT-------EAKDGAGLIGQFGVGFYAAFMVADSITVTS
HTPG_RHOPS      QELIDNLGTIAKSGTKSFLTKLT-------EAKDGAGLIGQFGVGFYAAFMVADNIVVTS
HTPG_RHOPA      QELIDNLGTIAKSGTKSFISKLA-------ETKDSAGLIGQFGVGFYAAFMVADKITVTS
HTPG_RHOP5      QELIDNLGTIAKSGTKSFLTKLT-------EAKDGSNLIGQFGVGFYAAFMVADRIVVTS
HTPG_RHOPB      QELIDNLGTIAKSGTKSFLTKLT-------EAKDGAGLIGQFGVGFYAAFMVADRIVVTS
HTPG_BRADU      QELIDHLGTIARSGTKAFVSKLK-------EAKDGLGLIGQFGVGFYSAFMVADKIIVVS
HTPG_GLUOX      DELAQNLGTIARSGTRAFGEKLN-----AAKPEDRPSLIGQFGVGFYAAFMVADRVDVTS
HTPG_MAGSA      DELIANLGTIAKSGTSEFLARLTGD------AKKDVSLIGQFGVGFYSAFMVAEEVTVTS
HTPG_RHORT      HELIENLGTIARSGTQAFAEALKAKS---QAASGDVSLIGQFGVGFYSAFMVADKVEVVT
HTPG_ROSDO      GDLLDTLGTIARSGTGAFLDALKSE------EKGDIGLIGQFGVGFYSAFMVAERVDVLT
HTPG_RICRS      DDLIENLGTIARSGTANFLKSLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICRO      DDLIENLGTIARSGTANFLKSLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICCN      DDLIENLGTIARSGTANFLKSLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICFE      DDLIENLGTIARSGTANFLKSLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICAH      EDLIDNLGTIARSGTANFLKSLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICCK      EDLIENLGTIARSGTANFLKNLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICBR      EDLIENLGTIARSGTANFLKNLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICB8      EDLIENLGTIARSGTANFLKNLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICTY      EDLIENLGTIARSGTANFLKNLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_RICPR      EDLIENLGTIARSGTANFLKNLSGDS---KKD---NMLIGQFGVGFYSSFMVADKVTVTS
HTPG_ORITB      EDLTQNLGTIASSGTQKFLEQLGNDA---KKD---NMLIGQFGVGFYSSYMVADEVKVIS
HTPG_EHRCJ      QDLIDNLGTIAHSGTQRFLDAINNET---SSQ-GVVELIGKFGVGFYSAFMVASEVIVES
HTPG_EHRCR      QDLIDNLGTIAHSGTQRFLDEINNGT---SSQ-GVVELIGKFGVGFYSAFMVASEVIVES
HTPG_EHRRW      EDLINNLGTIAHSGTQKFLDAINSGA---SSQQGVVELIGKFGVGFYSAFMVASEVIVES
HTPG_EHRRG      EDLINNLGTIAHSGTQKFLDAINSGA---SSQQGVVELIGKFGVGFYSAFMVASEVIVES
HTPG_WOLPM      QDLIDNLGTIASSGTQKFLDAIKNSK---DSS-QTVELIGKFGVGFYSSFMVASEVIVES
HTPG_WOLTR      QDLIGNLGTIASSGTQKFLDAIKNSK---DSS-QAVELIGKFGVGFYSSFMVASEVIVES
HTPG_ANAPZ      DELIANLGTIASSGTQRFLEALGGDK---AKG---YDLIGKFGVGFYSVFMVASEVVVDT
HTPG_ANAMM      KELIDNLGTIASSGTQRFLEEFKGGK---AQG---CDLIGKFGVGFYSVFMVATDVVVES
HTPG_NEOSM      KELVENLGTVARSGTEKFLESLKDK---------KVDLIGQFGVGFYSVFMVADKVEVET
HTPG_TREDE      EDLKNNLGTIARSGTKAFLDQLAAADKKD-----SN-LIGQFGVGFYSAFMAASTIDVIS
HTPG_TREPA      EDLRANLGTIARSGTKAFLSTLTRDQKQD-----SN-LIGQFGVGFYSAFMVASKVEVIT
HTPG_HELPH      NDLIEHLGTIAKSGTKSFLSALSGDKKKD-----SA-LIGQFGVGFYSAFMVASKIVVQT
HTPG_HELPJ      SDLIEHLGTIAKSGTKSFLSALSGDKKKD-----SA-LIGQFGVGFYSAFMVASKIVVQT
HTPG_HELPY      NDLIEHLGTIAKSGTKNFLSALSGDKKKD-----SA-LIGQFGVGFYSAFMVASKIVVQT
HTPG_HELAH      NDLIEHLGTIAKSGTKSFLSALSGDKKKD-----SA-LIGQFGVGFYSAFMVAGKIVVQT
HTPG_HELHP      NDMKEHLGIIAKSGTKSFLSQLSGDKKKD-----SA-LIGQFGVGFYSAFMVAHRVVVQS
HTPG_WOLSU      SDLVENLGTIAKSGTKSFVSRLSGDKKKD-----SA-LIGQFGVGFYAAFMVADKIVVTT
HTPG_CAMJJ      DDLINNLGTIAKSGTKSFLENLSGDAKKD-----SQ-LIGQFGVGFYSAFMVASKIEVLS
HTPG_CAMJ8      DDLINNLGTIAKSGTKSFLENLSGDAKKD-----SQ-LIGQFGVGFYSAFMVASKIEVLS
HTPG_CAMJR      DDLINNLGTIAKSGTKSFLENLSGDAKKD-----SQ-LIGQFGVGFYSAFMVASKIEVLS
HTPG_CAMJE      DDLINNLGTIAKSGTKSFLENLSGDAKKD-----SQ-LIGQFGVGFYSAFMVASKIEVLS
HTPG_CAMJD      NDLINNLGTIAKSGTKSFLENLSGDAKKD-----SQ-LIGQFGVGFYSAFMVASKIEVLS
HTPG_CAMHC      NELENNLGTIARSGTKGFIEQLSGDAKKD-----SN-LIGQFGVGFYSAFMVADKIEVLT
HTPG_SULNB      EDLMDNLGTIAKSGTKAFMENLTGDAKKD-----SN-LIGQFGVGFYSVFMVAEKVDVIS
HTPG_ARCB4      ADLIASIGTIAKSGTKSFVEALTGDAKKD-----SN-LIGQFGVGFYSVFMVADKVDVIS
HTPG_BORBP      QDLTNHLGVIAKSGTKEFINNLKQDEKKS-----AS-LIGQFGVGFYSAFIVSEKVEVTS
HTPG_BORBU      QDLTNHLGVIAKSGTKEFINNLKQDEKKS-----AS-LIGQFGVGFYSAFIVSEKVEVTS
HTPG_BORAP      QELTNHLGVIAKSGTKEFINNLKQDEKKS-----AN-LIGQFGVGFYSAFIVSEKVEVTS
HTPG_SULDN      EDLMNNLGTIAKSGTKAFLENLSGDQKKD-----SH-LIGQFGVGFYASFMVAHKVEVTT
HTPG_MYCTA      EEVVDLIGTLAKSGTAELRAQLREAKNA---A-ASEELIGQFGIGFYSSFMVADKVQLLT
HTPG_MYCBO      EEVVDLIGTLAKSGTAELRAQLREAKNA---A-ASEELIGQFGIGFYSSFMVADKVQLLT
HTPG_MYCBP      EEVVDLIGTLAKSGTAELRAQLREAKNA---A-ASEELIGQFGIGFYSSFMVADKVQLLT
HTPG_MYCTU      EEVVDLIGTLAKSGTAELRAQLREAKNA---A-ASEELIGQFGIGFYSSFMVADKVQLLT
HTPG_MYCA1      AEVVDLIGTLAKSGTAELRQQLREAKNAQNEA-ASEELIGQFGIGFYSSFMVADKVELLT
HTPG_MYCPA      AEVVDLIGTLAKSGTAELRQQLREAKNAQNEA-ASEELIGQFGIGFYSSFMVADKVELLT
HTPG_MYCUA      AEVVDLIGTLAKSGTAELRAQLREAKND---A-ASEELIGQFGIGFYSSFMVADKVELLT
HTPG_MYCLE      AEVVDLIGTLAKSGTAKLRQKLHAAKNLKDTA-ASEGLIGQFGIGFYSSFMVANKVELLT
HTPG_MYCGI      DEVVRLIGTLAKSGTAELRQQLREAKDA---N-ANEELIGQFGIGFYASFMVADRVELLT
HTPG_MYCVP      DEVVSLIGTLAKSGTGELRQQLREAKDK---D-TSEELIGQFGIGFYASFMVADRVELLT
HTPG_RHOJR      DEVVDLIGTLAKSGTADLRRKLKEAKDA---A-ASEELIGQFGIGFYSTFMVADKVTLLT
HTPG_NOCFA      AEVVDLIGTLAKSGTAELRRKLSEAKSE---A-AAEELIGQFGIGFYSTFMVADKVTLTT
HTPG_SALTO      DEVVQVIGTIAKSGTAELLRTLRESADA---E-TSQELIGQFGVGFYAAFMVADRVVLVT
HTPG_SALAI      DEVVQVIGTIAKSGTAELLRKLRETTDA---E-TSQELIGQFGVGFYAAFMVADRVVLVT
HTPG_FRACC      DEVVGLIGTIAKSGTAELLRKLRESEDG---A-ASSDLIGQFGVGFYSTFMVADKVTLLT
HTPG_STRCO      DEVTRLIGTIANSGTAKFLEELREAKDA---A-GADGLIGQFGVGFYSGFMVADEVTLVT
HTPG_GEOSL      EEVEKNIGTIAHSGTKAFLANLKEQNVA-----DHPELIGQFGVGFYASFMVADRVTLVT
HTPG_GEOMG      EEVEKNIGTIAHSGTKAFLANLKEQNVS-----EHPELIGQFGVGFYASFMVADRVTLVT
HTPG_GEOUR      VEVEENIGTIARSGTRAFMENLKDKNVQ-----NNPELIGQFGVGFYASFMVADKVTLIT
HTPG_PELPD      AEVEENIGTIARSGTKAFMQALKDKSAT-----DNPELIGQFGVGFYASFMVADRVILET
HTPG_BDEBA      EEVVEFIGTIARSGAKAFMQMNAE--MK-----TKPELIGQFGVGFYSAFMVADRVTLHT
HTPG_MYXXD      DELVKNLGTIAHSGSREFIEALAQKGQQ-----KDMQLIGQFGVGFYSAYLVADRVEVVS
HTPG_METFK      EEVINNIGTIAKSGTKEFLQSLTGDQAKD-----AN-LIGQFGVGFYSAFIIADKVTLTT
HTPG_THIDA      QEVIDHIGTIAKSGTREFFSQLSGDQKKD-----AA-LIGQFGVGFYSAFIVADRVTLTT
HTPG_CHRVO      DEVVSHIGTIAKSGTKSFFEQLSGDEKKD-----AH-LIGQFGVGFYSAFIVADKVTLTT
HTPG_DECAR      DEAVEHLGTIAKSGTKEFFSALTGDQAKD-----AH-LIGQFGVGFYSSFIIADKVTVVS
HTPG_AROAE      DEVITHLGTIAKSGTKEFFSQLTGDQKKD-----AH-LIGQFGVGFYSAFIVADKVTVVT
HTPG_NITEC      QEVIDNIGTIAKSGTREFIDSLTGDQARD-----AN-LIGQFGVGFYSAFIVADKVTLTT
HTPG_NITEU      QEVINNIGTIAKSGTREFFDSLTGDQAKD-----AN-LIGQFGVGFYSAFIVADKVTLTT
HTPG_NITMU      QEVIDHIGTIAKSGTREFFDALTGDQAKD-----AH-LIGQFGVGFYSAFIVADKVTLTT
HTPG_BORBR      DEAVANLGTIARSGTREFFSQLTGDKQKD-----AQ-LIGQFGVGFYSSFIVADKVTVLS
HTPG_BORPA      DEAVANLGTIARSGTREFFSQLTGDKQKD-----AQ-LIGQFGVGFYSSFIVADKVTVLS
HTPG_BORPE      DEAVANLGTIARSGTREFFSQLTGDKQKD-----AQ-LIGQFGVGFYSSFIVADKVTVLS
HTPG_BORA1      EEAIANLGTIARSGTREFFSQLTGDKQKD-----AQ-LIGQFGVGFYSSFIVADRVSVLS
HTPG_BURPS      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURMA      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURM7      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURP1      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURM9      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURMS      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURP0      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURP6      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_BURTA      DEAIANLGTIARSGTKEFFSKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADKITVET
HTPG_BURCA      DEAIANLGTIARSGTKEFFTKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADKITVET
HTPG_BURCH      DEAIANLGTIARSGTKEFFTKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADKITVET
HTPG_BURCM      DEAIANLGTIARSGTKEFFTKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADKITVET
HTPG_BURL3      DEAIANLGTIARSGTKEFFTKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADKITVET
HTPG_PARXL      DEAIANLGTIARSGTKEFFGKLSGDQQKD-----AA-LIGQFGVGFYSGFIVADRITVET
HTPG_CUPNH      DEAIHNLGTIARSGTKEFFQQLSGDQQKD-----AA-LIGQFGVGFYSAFIVADKVTVET
HTPG_CUPPJ      DEAIRNLGTIARSGTKEFFQQLSGDQQKD-----AA-LIGQFGVGFYSAFIVADKVTVET
HTPG_CUPMC      DEAIRNLGTIARSGTKEFFQQLSGDQQKD-----AA-LIGQFGVGFYSAFIVADKVTVET
HTPG_RALSO      DEAIRNLGTIARSGTREFFSQLSGDQQKD-----AA-LIGQFGVGFYSAFIVADRVTVES
HTPG_ACISJ      QEAIDHLGTIAKSGTRDFMNRLSGDQKAD-----AQ-LIGQFGVGFYSGFIVADRITVES
HTPG_VEREI      QEAIEHLGTIAKSGTKDFMGQLSGDQKQD-----AQ-LIGQFGVGFYSGFIVADKITVES
HTPG_RHOFT      QEAIDHLGTIAKSGTKDFVSKLSGDQKAD-----SQ-LIGQFGVGFYSGFIVADKITVES
HTPG_POLNA      QEAIEHLGTIAKSGTRDFVAKLSGDQKND-----AQ-LIGQFGVGFYSGFIVADKITVES
HTPG_POLSJ      REAIENLGTIAKSGTRDFMAKLSGDQKND-----AQ-LIGQFGVGFYSGFIVADRITVES
HTPG_METPP      DEVIANLGTIAKSGTREFVGKLSGEQAKD-----AQ-LIGQFGVGFYSGYIVADRITVES
HTPG_PSYCK      ADAIENLGTIAKSGTKAFLDKLSESQKQD-----GQ-LIGQFGVGFYSGFIVADTISVET
HTPG_PSYA2      ADAIENLGTIAKSGTKAFLDKLSDSQKQD-----GQ-LIGQFGVGFYSGFIVADTISVET
HTPG_ACIAD      QEAIDNLGTIAKSGTKDFMSKLTGDQKSD-----AQ-LIGQFGVGFYSGFIVADKITVES
HTPG_ALKEH      DEVAENLGTIARSGTKAFLDQLTGDQQKD-----AK-LIGQFGVGFYSAFVVAEHVTVHT
HTPG_HALHL      EDVIENLGTIAHSGTRRFLEQLTGDQHKD-----AQ-LIGQFGVGFYSAFVVADRVEVYT
HTPG_NITOC      QEVVENIGTIAKSGTRAFLESLSGDQAKD-----AR-LIGQFGVGFYSAFIVADKVVLET
HTPG_MAGMM      DEVISNIGTIAKSGTKEFFKSLTGDQQRD-----AH-LIGQFGVGFYSSFIVADKVTLET
HTPG_METCA      EEVQHNIGTIARSGTRHFFESLTGDEAKD-----SQ-LIGQFGVGFYSAFIVADKVVLET
HTPG_COXBR      EEVIENLGTIAKSGTRAFRELLAEKKAED-----SQ-LIGQFGVGFYSAFIVADRVVVRT
HTPG_COXBU      EEVIENLGTIAKSGTRAFRELLAEKKAED-----SQ-LIGQFGVGFYSAFIVADRVVVRT
HTPG_COXBN      EEVIENLGTIAKSGTRAFRELLAEKKAED-----SQ-LIGQFGVGFYSAFIVADRVVVRT
HTPG_HAEIN      EQVIDHLGTIAKSGTKEFLTALGQDQAKN-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_HAEIE      EQVIDHLGTIAKSGTKEFLTALGQDQAKN-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_HAEI8      EQVIDHLGTIAKSGTKEFLTALGQDQAKN-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_HAEIG      EQVIDHLGTIAKSGTKEFLTALGQDQAKN-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_AGGAC      EQVIDHLGTIAKSGTKEFLAALGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_HAES1      EQVIDHLGTIAKSGTKEFLAALGQEQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_HISS2      EQVIDHLGTIAKSGTKEFLAALGQEQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_PASMU      DEVIDHLGTIAKSGTKEFLSALGQDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_ACTSZ      EQATEHLGTIAKSGTKEFLTALGQDQAKD-----SQ-LIGQFGVGFYSAFIVADKVEVRS
HTPG_MANSM      EQAVDHLGTIAKSGTKEFLSALGNDQAKD-----SQ-LIGQFGVGFYSAFIVADKVEVRS
HTPG_ACTP2      EQVIDHLGTIAKSGTKEFLNSLGTDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKT
HTPG_ECOLI      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECOL5      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECOHS      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECOL6      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SHIBS      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SHISS      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECO57      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECOLC      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECOUT      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECOK1      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ECO24      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SHIFL      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SHIDS      DEVIDHLGTIAKSGTKSFLESLGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SALPB      DEVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SALPA      DEVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SALTY      DEVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SALCH      DEVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SALTI      DEVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_CITK8      DDVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_CROS8      DEVIDHLGTIAKSGTKAFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_KLEP7      EEVIDHLGTIAKSGTKAFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_ENT38      DEVIDHLGTIAKSGTKSFLESMGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_PECAS      DEVIDNLGTIAKSGTKSFLESMGSDQVKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_YERPA      DEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_YERPS      DEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_YERPN      DEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_YERPP      DEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_YERPE      DEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_YERE8      EEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SERP5      EEVIENLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_PHOLL      DEVIDNLGTIAKSGTKAFLESIGSDQAKD-----SQ-LIGQFGVGFYSAFIVSDKVTVRT
HTPG_SODGM      EEVIDNLGTIAKSGTKAFLESMGSDQLKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_BAUCH      TEVIDNLGTIAKSGTKAFLETIDVKNSKN-----NQ-LIGQFGVGFYSAFIVAQKVIVRT
HTPG_VIBCH      DEVIENLGTIAKSGTAEFFSKLSQEQSKN-----SQ-LIGQFGVGFYSAFIVADAVTVRT
HTPG_VIBC3      DEVIENLGTIAKSGTAEFFSKLSQEQSKN-----SQ-LIGQFGVGFYSAFIVADAVTVRT
HTPG_VIBPA      NDVIEHLGTIAKSGTAEFFSKLSEEQSKD-----SQ-LIGQFGVGFYSAFIVADAVTVRT
HTPG_VIBCB      DDVIEHLGTIAKSGTAEFFSKLSDDQSKD-----SQ-LIGQFGVGFYSAFIVADAVTVCT
HTPG_VIBVY      EEVISHLGTIAKSGTAEFFSKLSQEQSKD-----SQ-LIGQFGVGFYSAFIVADAVTVRT
HTPG_VIBVU      EEVISHLGTIAKSGTAEFFSKLSQEQSKD-----SQ-LIGQFGVGFYSAFIVADAVTVRT
HTPG_ALIF1      EDVIEHLGTIAKSGTADFFSKLSEDQSKD-----SQ-LIGQFGVGFYSAFIVADAVTVRT
HTPG_PHOPR      DDVIEHLGTIAKSGTKDFFSKLSNDESKD-----SQ-LIGQFGVGFYSSFIVAKSVTVNT
HTPG_AERHH      DQVIEHLGTIAKSGTAEFFKNLSGDQGRD-----SQ-LIGQFGVGFYSAFIVADKVTVVS
HTPG_AERS4      DQVIEHLGTIAKSGTAEFFKNLSGDQGRD-----SQ-LIGQFGVGFYSAFIVADKVTVVS
HTPG_PSEHT      DEVISSLGTIAKSGTAEFFKNLTGDQSKD-----SQ-LIGQFGVGFYSAFIVADLVTVRT
HTPG_COLP3      DEVIEHLGTIAKSGTAEFFSQLSGDQASD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_PSEA6      ASVIEHLGTIAKSGTSEFFSNLSGDQAKD-----SQ-LIGQFGVGFYSAFIVAEKVVVRS
HTPG_IDILO      DDVMNNLGTIAKSGTAEFFGQLSGDEAKD-----SK-LIGQFGVGFYSAFIVADEVTVRT
HTPG_PSYIN      DEVIEHLGTIAKSGTSDFFEQLSGDQVKD-----SQ-LIGQFGVGFYSSFIVADKVTVNT
HTPG_SHEPA      DGVIEHLGTIAKSGTADFFKKLSGDESKD-----SQ-LIGQFGVGFYSSFIVADRVTVRT
HTPG_SHEHH      DGVIEHLGTIAKSGTAEFFKNMSGDESKD-----SQ-LIGQFGVGFYSSFIVADRVTVRT
HTPG_SHESH      DTVIEHLGTIAKSGTADFFKNLSGDESKD-----SQ-LIGQFGVGFYSSFIVADKVTVRT
HTPG_SHELP      DGVIEHLGTIAKSGTAEFFKNLSGDESKD-----SQ-LIGQFGVGFYSAFIVADKVTVRT
HTPG_SHEPC      DGVIEHLGTIAKSGTAEFFKNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHESW      DGVIEHLGTIAKSGTAEFFKNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHESM      DGVIEHLGTIAKSGTAEFFKNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHESR      DGVIEHLGTIAKSGTAEFFKNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHESA      DGVIEHLGTIAKSGTAEFFKNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEON      DGVIEHLGTIAKSGTAEFFKNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEB9      DGVIEHLGTIAKSGTADFFKNLSGESSKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEB8      DGVIEHLGTIAKSGTADFFKNLSGESSKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEB5      DGVIEHLGTIAKSGTADFFKNLSGESSKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEDO      DSVIEHLGTIAKSGTKEFFNNLSGEANKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEFN      DSVIEHLGTIAKSGTKEFFSNLSGEASKD-----SQ-LIGQFGVGFYSAFIVAKKVTVRT
HTPG_SHEAM      DGVIEHLGTIAKSGTAEFFKNLSGDSAKD-----SQ-LIGQFGVGFYSAFIVAKRVEVFT
HTPG_BUCAI      EDTIENLGTIAKSGTKSFLQSLEQKQ-NK-----KNELIGEFGVGFYSSFIVSEKVSVRT
HTPG_BUCAP      QDVVENLGTIAKSGTKSFIKSLEKKEKNV-----KNELIGEFGVGFYSSFIVSKKVSVRT
HTPG_BUCBP      EDIINNLGTIAKSGTKEFIKTLNKN-NKI-----KNDLIGQFGVGFYSSFIVSEKVIVKT
HTPG_BUCCC      KEVIKNLGTIAKSGTKSFLNKIQNIEKKE-----KNDFIGQFGVGFYSSFIVSNSVSVYT
HTPG_WIGBR      KEVIENLGTIAKSGTKSFIKSIEKSNSEK-----NNQLIGKFGVGFYSVFIVSEKVLVLT
HTPG_LEGPH      EEAVENLGTIAKSGTKEFISQLTGEQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKS
HTPG_LEGPC      EEAVENLGTIAKSGTKEFISQLTGEQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKS
HTPG_LEGPL      EEAVENLGTIAKSGTKEFISQLTGEQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKS
HTPG_LEGPA      EEAVENLGTIAKSGTKEFISQLTGEQAKD-----SQ-LIGQFGVGFYSAFIVADKVTVKS
HTPG_PSEAE      EDVVTHLGTIAKSGTADFLKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADKVDVYS
HTPG_PSEA7      EDVVTHLGTIAKSGTADFLKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADKVDVYS
HTPG_PSEMY      DEVIAHLGTIAKSGTADFLKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADKVDVFT
HTPG_PSEPF      DDVITHLGTIAKSGTADFMKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADKVDVYS
HTPG_PSEF5      EDVITHLGTIAKSGTADFMKNLTGDQKKD-----SH-LIGQFGVGFYSAFIVADQVEVFS
HTPG_PSEU2      EDVITHLGTIAKSGTADFMKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADQVEVFS
HTPG_PSE14      EDVITHLGTIAKSGTADFMKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADQVEVFS
HTPG_PSESM      EDVITHLGTIAKSGTADFMKNLSGDQKKD-----SH-LIGQFGVGFYSAFIVADQVEVFS
HTPG_PSEPK      EDVIAHLGTIAKSGTADFMKNLTGDQKKD-----SH-LIGQFGVGFYSAFIVADKVDVYS
HTPG_XANC5      EEAVSHLGTIAKSGTADFLKHLSGDQKKD-----AN-LIGQFGVGFYSAFIVADQVDVYS
HTPG_XANAC      EDAVSHLGTIAKSGTADFLKHLSGDQKKD-----AN-LIGQFGVGFYSAFIVADQVDVYS
HTPG_XANOM      EDAVSHLGTIAKSGTADFLKHLSGDQKKD-----AN-LIGQFGVGFYSAFIVADQVDVYS
HTPG_XANOR      EDAVSHLGTIAKSGTADFLKHLSGDQKKD-----AN-LIGQFGVGFYSAFIVADQVDVYS
HTPG_XANCP      EDAVSHLGTIAKSGTADFLKHLSGDQKKD-----AN-LIGQFGVGFYSAFIVADQVDVYS
HTPG_XANC8      EDAVSHLGTIAKSGTADFLKHLSGDQKKD-----AN-LIGQFGVGFYSAFIVADQVDVYS
HTPG_XYLFA      DEAIAHLGTIAKSGTADFLKTLSGDQRKD-----AN-LIGQFGVGFYSAFIVADHVDVYS
HTPG_XYLFT      DEAIAHLGTIAKSGTADFLKALSGDQRKD-----AN-LIGQFGVGFYSAFIVADHVDVYS
HTPG_SACD2      DEVIANLGTIARSGTAQFMANLSGDQKKD-----SQ-LIGQFGVGFYSAFIVADKVEVLT
HTPG_MARHV      DDVIANLGTIAKSGTAEFLKQLSGDEKKD-----SK-LIGQFGVGFYSAFIVADKVEVFT
HTPG_HAHCH      DEVVTNLGTIAKSGTAEFLSTLTGDQKQD-----SR-LIGQFGVGFYSAFIVADKVEVYT
HTPG_MARMS      EEAITNLGTIAKSGTSAFLEQLSGDQKKD-----SQ-LIGQFGVGFYSAFIVADKVTVET
HTPG_CHRSD      DEVIQNLGTIARSGTAEFLQQLSGEKQKD-----AK-LIGQFGVGFYSGFIVSDEITVRT
HTPG_ALCBS      NEVVDNLGTIARSGTEKFLANLSGDQKKD-----AQ-LIGQFGVGFYSAFIVAETVTVET
HTPG_RUTMC      AEVNKNIGTIANSGTKKFLKSLDEKQTKD-----SN-LIGQFGVGFYSSFIVADKVELIT
HTPG_VESOH      VEVNKNIGTIANSGTKKFLKSLNETQAQD-----SN-LIGQFGVGFYSSFIVSDKVEIIT
HTPG_HYDCU      DEVIANIGTIANSGTKKFLENMTGDQAKD-----SH-LIGQFGVGFYASFIVADKVTLTT
HTPG_FRAT1      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_FRATT      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_FRATW      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_FRATN      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_FRATF      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_FRATH      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_FRAP2      EEVIENLGTIAKSGTKKFLESLTGDKSKD-----NE-LIGQFGVGFYSSFIVADKVTVRT
HTPG_PELLD      EELIANLGTVARSGTLGFMQALRQEKKE-----LDGNLIGQFGVGFYSVFMVTDDVTVET
HTPG_CHLPM      DELIANLGTVAKSGTLGFMQSLQEQKKE-----LDGNLIGQFGVGFYSVFMVTENVTVET
HTPG_CHLCH      EELIANLGTVAKSGTLGFMQSLKEQQQQ-----LDGNLIGQFGVGFYSVFMVTEEVTVET
HTPG_CHLPD      EELILNLGTVARSGTLGFLQALKEQQKE-----LDGNLIGQFGVGFYSVFMVTDEVTVET
HTPG_CHLTE      EELISNLGTVASSGTLGFMEALKEQQKEG--QRLDANLIGQFGVGFYSVFMVTDEVTVET
HTPG_DESHY      EDLIENIGTIAHSGSKAFVQRLAEAGDK-----KDVNLIGQFGVGFYSAFMVADKVSLTS
HTPG_DESPS      QELVNNLGVIAHSGSGSFYAELAEAV-K-----KDVNLIGQFGVGFYAAFMAGNKVRVQT
HTPG_DESAG      QELIDNLGTIASSGSERFLKELAE----K--GEQASNIIGRFGVGFYAVFMVADSVTVTT
HTPG_DESVH      QELMDNLGTIARSGSEQFVADLAAAENAK--DADAASIIGRFGVGFYAVFMVADRVEVTS
HTPG_BACFR      EEIDKYINQIAFSGANDFLEKYKNDA---------NAIIGHFGLGFYSAFMVSKKVEIIT
HTPG_BACFN      EEIDKYINQIAFSGANDFLEKYKNDA---------NAIIGHFGLGFYSAFMVSKKVEIIT
HTPG_BACTN      EEIEKYINQIAFSGANDFLEKYKDDA---------NAIIGHFGLGFYSAFMVAKKVEIIT
HTPG_PORGI      EEVEKYINQIAFSSAEEFLEKYKDDK---------AAIIGHFGLGFYSAFMVSERVDVIT
                      :. :* *.:  :                   .**.**:***: ::    : : :

HTPG_BACSU      KALG--SEEAYKWESA----GADGYTIEPCEKDS-----------VGTDIILKIKENTED
HTPG_BACVZ      KALG--SDEAYVWESE----GAAGYTIAPCDKET-----------IGTEITLKIKENTED
HTPG_BACLD      KAHG--SDEAHQWESA----GADGYTIEPAAKES-----------AGTDVILKLKENTDD
HTPG_BACHD      KALG--EESGYQWEST----GADGYTILPIAKES-----------VGTEIRLKLKENSED
HTPG_BACSK      RSID--SDQAYKWESD----GTDGYTIEPAEKED-----------VGTVITLHIKENTDD
HTPG_OCEIH      KSID--SDAAFKWESK----GSDGYSITEADKQD-----------IGTTITLYIKENQEE
HTPG_CLOBH      KAFG--SNEAYKWNSK----GAEGYTIEPCEKET-----------YGTEIILKIKDNTEE
HTPG_CLOB1      KAFG--SNEAYKWNSK----GAEGYTIEPCEKET-----------YGTEIILKIKDNTEE
HTPG_CLOBL      KAFG--SNEAYKWNSK----GAEGYTIEPCEKEA-----------YGTEIILKIKDNTEE
HTPG_ALKMQ      KALG--SDQGYKWESI----GAEGYTIEPYEKES-----------VGTEIILKLKENTED
HTPG_ALKOO      KSID--SESGYKWEST----GVDGYTIEPWDKDT-----------VGTEIVLRIKEDTED
HTPG_CLOP1      KAFG--ADKAYKWESD----GVDGYTISEAEKDS-----------FGTDIILHLKANDED
HTPG_CLOPE      KAFG--ADKAYKWESD----GVDGYTISEAEKDS-----------FGTDIILHLKANDED
HTPG_CLOPS      KAFG--ADKAYKWESD----GVDGYTISEAEKDS-----------FGTDIILHLKANDED
HTPG_CLOAB      RSVD--SEEAYKWESK----GVEGYTIEKCEKET-----------PGTEIVLKIKENTDD
HTPG_CLOTE      HSID--SDEAYKWESK----GVEGYEIEKCEKDE-----------LGTEIILKIKENTDD
HTPG_FUSNN      KSPY--SENGVKWISS----GDGNYEIEEIAKQD-----------RGTKITLHLKDGDE-
HTPG_RHIME      RRAG--TDKAWHWASD----GKGSYTVSAVDLADAPA--------RGTRITLHLMDEAKT
HTPG_RHIEC      RRAG--SEEAWKWSSD----GKGSYSVEAANLVEAPA--------RGTRIVLHLMEDAKT
HTPG_NITWN      RRAG--AREAWRWSSD----GKGTFTVTPVDESEAPA--------RGTRVTLHLTEDATG
HTPG_NITHX      RRAG--AGEAWRWSSD----GKGTFTVTPADESEAPA--------RGTRVMLHLTEDAKG
HTPG_AZOC5      RRAG--ADTANIWSSD----GKGAYTVGEIDVAQAPA--------RGTRVVLHLNEDGKA
HTPG_RHILO      RLAG--SEEAWRWSSD----GKGSYEIAPAPLEAAPR--------RGTRVVLHLMDDAVS
HTPG_RHOP2      RRAG--SAEAWTWSSS----GGAGFEIAPASEEAAARI------ERGTEIVLHLKPDAAK
HTPG_RHOPS      RRAG--SGEVWTWSSS----GGAGFEIAPASEEAAARV------VRGTEIVLHLKPDAAK
HTPG_RHOPA      RRAG--SDDVWTWTSA----GGAGFEIAPASEEAAARV------ERGTEIVLHLKPDASK
HTPG_RHOP5      RRAG--STEAWTWTSS----GGAGFEIAPASAEEAERI------VRGTEIVLHLKPEAAK
HTPG_RHOPB      RRAR--SAEAWTWSSS----GGAGFEIAPASEEDAARV------TRGTEIVLHLKKDAAK
HTPG_BRADU      RRAG--ESDVWSWTSS----GGSGFEIARASEEDAARV------TRGTEIVLHLKDDAKK
HTPG_GLUOX      RKAG--SDEAWTWSSD----GKGAFTLTPASRS-----------TPGTDIVLHMKDDADE
HTPG_MAGSA      RKAG--EAKGWKWVSD----GKGEFTVSPAEDAA-----------RGAAITLKLREGETE
HTPG_RHORT      RRAG--EAQGWRWSSD----GKGSFSVSEVEGAG-----------RGAAITLHLREDARD
HTPG_ROSDO      RKAG--EDESWLWSSD----GKGEFSIEPGERAQ-----------SGTTVTLHLKKDAKE
HTPG_RICRS      RKAG--EDKVHIWESD----GLGEYTVSDS-DKEFTR---------GTEIILHIKKEEDT
HTPG_RICRO      RKAG--EDKVHIWESD----GLGEYTVSDS-DKEFTR---------GTEIILHIKKEEDT
HTPG_RICCN      RKAG--EDKVHIWESD----GLGEYTVSDS-DKEFTR---------GTEIVLHIKKEEDT
HTPG_RICFE      RKAG--EDKVHVWESD----GLGEYIVSES-DKEFTR---------GTEIVLHIKKEEDT
HTPG_RICAH      RKAG--EDTVHVWESD----GLGEYIVSDS-DKEFTR---------GTEIILHIKKEEDI
HTPG_RICCK      RKAG--EDKVYVWESD----GLGEYIVSNS-GKEFTR---------GTAIVLNIKKEEDN
HTPG_RICBR      RKAG--EDKVYVWESE----GEGEYIVSSS-DREFSR---------GTEIALHIKKEEDS
HTPG_RICB8      RKAG--EDKVYVWESE----GEGEYIVSNS-DREFSR---------GTEIALHIKKEEDS
HTPG_RICTY      RKAG--ENKVYTWESD----GLGEYIVADS-EQEFAR---------GTEIVLYIKKAETT
HTPG_RICPR      RKAG--ESKVHTWESD----GLGEYIVADS-EQEFTR---------GTEIVLYIKKSETT
HTPG_ORITB      KKAG--EAQAYQWSSK----GEGEYYIEDC-EADFIR---------GTKITLHIKPEYDN
HTPG_EHRCJ      RKAG--ESIGYQWRSA----GDGEFIISQLEDGQFPR---------GTKITLILKTEESE
HTPG_EHRCR      RKAG--ESIGYQWKSH----GDGEFTISQLEDNQISR---------GTKITLILKPEESE
HTPG_EHRRW      CKAG--ESVGYQWKSS----GDGEFVISQLESDQVSR---------GTRITLALKPEECE
HTPG_EHRRG      CKAG--ESVGYQWKSS----GDGEFVISQLESDQVSR---------GTRITLALKPEECE
HTPG_WOLPM      RKAG--EEESWIWQSK----GDGEYSISKS-DNQVPR---------GTKITLIMHPEENE
HTPG_WOLTR      RKAG--EEESWVWRST----GDGEYSISKL-DNQIPC---------GTKITLVMRPEENE
HTPG_ANAPZ      CRAG--ESVGYRWRSS----GDGGFTIEKL-GEDVPR---------GTKITLTLKEDESG
HTPG_ANAMM      CKAG--EKVGHRWQSS----GDGVFSVSTI-EGDVSR---------GTKVILTLREDEFD
HTPG_NEOSM      RKAG--TKKGYIWGSR----GRDSFYVDEL-GESVSR---------GTKIRIYLKDNSEE
HTPG_TREDE      KKAG--ENDVWKWTSD----GKGAYDLEKVDDTAFPIIDGVPEGANGTCVILHLN-NEDS
HTPG_TREPA      KKAA--ENTVWKWTSE----GQNAYTLDEVDAAAFPVLEGVAEGSAGTCVVLHLS-QENS
HTPG_HELPH      KKVT--NHQAYAWVSD----GKGKFEISECV-----------KEEQGTEITLFLK-EEDS
HTPG_HELPJ      KKVT--SHQAYAWVSD----GKGKFEISECV-----------KEEQGTEITLFLK-EEDS
HTPG_HELPY      KKVN--SDQAYAWVSD----GKGKFEISECV-----------KDEQGTEITLFLK-DEDS
HTPG_HELAH      KKVT--SEQAYAWVSD----GKGKFEINECI-----------KDEQGTEITLFLK-DEDA
HTPG_HELHP      KKAG--EEKAYAWVSE----GKGEYEIGECV-----------KESQGTQITLYLR-EEDA
HTPG_WOLSU      KKAG--EESAYAWLSE----GKGDYEITPCS-----------KESHGTEIKLFLK-EEEK
HTPG_CAMJJ      KKAL--DDKAYLWSSD----ANG-YEIDDAN-----------KEEQGTSITLYLK---DD
HTPG_CAMJ8      KKAL--DDKAYLWSSD----ANG-YEINDAN-----------KEEQGTSITLYLK---DD
HTPG_CAMJR      KKAL--DDKAYLWSSD----ANG-YEINDAS-----------KEEQGTSITLYLK---DD
HTPG_CAMJE      KKAL--DDKAYLWSSD----ANG-YEIDDAN-----------KEEQGTSITLYLK---DD
HTPG_CAMJD      KKAL--DDKAYLWSSD----ANG-YEINDAS-----------KEEQGTSITLYLK---DD
HTPG_CAMHC      KKPL--SDEAFSWKSD----AND-YTIEKAE-----------KADFGTQITLYLK---DD
HTPG_SULNB      KKAG--EEQAYMFSTD----GTGEYEVKPVT-----------KDEHGTVIYIKLK-EDEK
HTPG_ARCB4      KKAG--EEQAYKWSST----GTGEFDLTPCT-----------KESNGTVIYIKLKDEEAG
HTPG_BORBP      KKAL--ESDAYIWFSD----GKTGYEIEKAK-----------KEESGTEIKLYLN-KEGL
HTPG_BORBU      KKAL--ESDAYIWSSD----GKTGYEIEKAK-----------KEESGTEIKLYLN-KEGL
HTPG_BORAP      KKAL--ESDAYIWSSD----GKTGYEIEKAK-----------KEDPGTEIKLYLN-KEGL
HTPG_SULDN      KKAA--TEQAYLWISK----GDGEFEIEKTT-----------RESHGTTIVMHLN-DDES
HTPG_MYCTA      RKAG--ESAATRWESS----GEGTYTIESVEDA-----------PQGTSVTLHLKPEDAE
HTPG_MYCBO      RKAG--ESAATRWESS----GEGTYTIESVEDA-----------PQGTSVTLHLKPEDAE
HTPG_MYCBP      RKAG--ESAATRWESS----GEGTYTIESVEDA-----------PQGTSVTLHLKPEDAE
HTPG_MYCTU      RKAG--ESAATRWESS----GEGTYTIESVEDA-----------PQGTSVTLHLKPEDAE
HTPG_MYCA1      RKAG--ESEATKWESS----GEGTYTIESVENA-----------PQGTSVTLHLKPEDTE
HTPG_MYCPA      RKAG--ESEATKWESS----GEGTYTIESVENA-----------PQGTSVTLHLKPEDTE
HTPG_MYCUA      RKAG--ESEATKWESS----GEGTYTIESVEGA-----------PQGTSVTLHLKPEDAE
HTPG_MYCLE      RKAG--ETAATRWSSD----GEATYTIESVDEA-----------PQGTSVTLHLKPEDFE
HTPG_MYCGI      RKAG--ESEATRWEST----GEGSYTIETVDQAGG-------EVPQGTSVTLHLKPEDRE
HTPG_MYCVP      RKAG--ESEATRWESS----GEGTYTIETVDQAGG-------EVPQGTSVTLHLKPEDRE
HTPG_RHOJR      RKAG--ESEATRWESS----GEATYTIEAVDDA-----------PQGSSVTLHLKPEDAE
HTPG_NOCFA      RKAG--ETGGTRWESSA---GSSTYTIEDLAEA-----------PQGTAVSLHLKPADEE
HTPG_SALTO      REAG--ATDGTRWESS----GEGTYTIASATDA-----------PQGTAVTLHLKPADSE
HTPG_SALAI      RQAG--EADGTHWESS----GEGTYTIAPATDV-----------PQGTAVTLHLKPVDSE
HTPG_FRACC      GKAG--ESGGTRWESD----GAGTYVIETVDDA-----------PRGTAVTVHLKPEDSE
HTPG_STRCO      RHAG--ETEGTRWTSR----GEGTYTLERIGEA-----------PQGTAVTLHLKPADVE
HTPG_GEOSL      RRAGHDKAAGVRWEST----GDGTYTVEECAKET-----------RGTEITLHLKE----
HTPG_GEOMG      RRAGQDKAAGVRWEST----GDGTYTVEEAVKET-----------RGTEITLHLKE----
HTPG_GEOUR      RKAG-DKNAACRWEST----GDGSYTIEDCEKET-----------RGTDITLHLKD----
HTPG_PELPD      RKGG-TASDGCRWESI----GDGSYTIEECSLDR-----------RGTEIVLHLKD----
HTPG_BDEBA      QKAG--SNDGTVWESM----GDGTYSLDSVPRPEG----------TGTTITLHMKDFKEE
HTPG_MYXXD      RAAG-QGQSAWRWTSE----AKGSFTVEPAERA-----------ARGTSITLHLKE----
HTPG_METFK      RRAG--SNEAVRWEST----GEGDYTLEPAEKES-----------RGTDIVLHLREGEDE
HTPG_THIDA      RRAGLTAEHGVRWESE----GAGDYTLETVEKPQ-----------RGTEIVLHLREGEDE
HTPG_CHRVO      RRAG--EAEAVRWESH----GEGEYTLESVEKAE-----------RGTEIVLHLKEGEDE
HTPG_DECAR      RRAGVEANQAVCWESG----GEGDYTVEMVEKAT-----------RGTDVTLHLREGEDE
HTPG_AROAE      RRAGLAAAEGVKWECAMTGDAAGEYTVEAIEKAA-----------RGTEITLHLREGQED
HTPG_NITEC      RRAGLTTEHGVRWESS----GEGEYTLETVEKRD-----------RGTEVVLHLREDEDE
HTPG_NITEU      RRAGLTIEHGVRWESG----GEGEYTLETVEKPD-----------RGTEIVLHLREGEDE
HTPG_NITMU      RRAGLTHEHGVRWESG----GEGDYTLETIDKPG-----------RGTEVTLHLREGEDE
HTPG_BORBR      RRAGLAANEAIRWESD----GQGEFSIAPAEKAG-----------RGTDVVLHLRADEDE
HTPG_BORPA      RRAGLAANEAIRWESD----GQGEFSIAPAEKAG-----------RGTDVVLHLRADEDE
HTPG_BORPE      RRAGLAANEAIRWESD----GQGEFSIAPAEKAG-----------RGTDVVLHLRADEDE
HTPG_BORA1      RRAG--SDEAIRWESD----GQGEFSIASAEKAT-----------RGTDVVLHLRADEDE
HTPG_BURPS      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURMA      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURM7      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURP1      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURM9      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURMS      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURP0      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURP6      RRAGLPASEGVRWESA----GEGDFQVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURTA      RRAGLPASEGVRWESA----GEGDFSVDTIERAA-----------RGTTITLHLREGEDE
HTPG_BURCA      RRAGLPANEAVRWESA----GEGDFTIDAIERAQ-----------RGTTITLHLREGEDD
HTPG_BURCH      RRAGLPANEAVRWESA----GEGDFTIDAIERAQ-----------RGTTITLHLREGEDD
HTPG_BURCM      RRAGLPANEAVRWESA----GEGDFTIDAIERAQ-----------RGTTITLHLREGEDE
HTPG_BURL3      RRAGLPASEAVRWESA----GEGDFTIDAIERAQ-----------RGTTITLHLREGEDE
HTPG_PARXL      RRAGLPASEGVRWESA----GEGDFAVEQIERAA-----------RGTTITLHLRADEDE
HTPG_CUPNH      RRAGLGAEDAVRWEST----GDGEFTIDAIARNE-----------RGTTITLHLREGEDD
HTPG_CUPPJ      RRAGVAADEAVRWEST----GDGEFTVDAITRAE-----------RGTTITLHMREGEDD
HTPG_CUPMC      RRAGLAADEAVRWESA----GDGEFSIDAINRAE-----------RGSTITLHLREGEDD
HTPG_RALSO      RRAGVPAAEGVRWESA----GDGEFTVDAIERAE-----------RGTTITLHLREGEDD
HTPG_ACISJ      RRAGLPASEGVRWASG----GAGDFEVEAIERAA-----------RGTSVILHLREDAEE
HTPG_VEREI      RRAGLPASEGVRWASG----GTGDFEVETIDRPA-----------RGTSVILHLRDSAEE
HTPG_RHOFT      RRAGMKASEGVRWISG----GAGDFEVETIERAA-----------RGTSVILHLRDDAMD
HTPG_POLNA      RRAGLPAAQGVRWVSE----GTGEFDVSETLRAE-----------RGTSIILHLKDDAAD
HTPG_POLSJ      RRAGLPATQGVRWSSE----GTGEFEVSEMERAE-----------RGTSIILHLKDDARD
HTPG_METPP      RRAGLKAEEGVRWSSA----GTGDFEVENLVRAQ-----------RGTSVTLHLRDGEDE
HTPG_PSYCK      RKAGEPADKGVRWVSD----GTGSFTVEPITKET-----------RGTAITLHLKEQYSE
HTPG_PSYA2      RKAGDAAENGVRWVSD----GTGSFTVENISKTE-----------RGSSITLHLKEQYSE
HTPG_ACIAD      RRAGLPANDGVRWISG----GTGDFEVQQITKDS-----------RGTSIILHLRDDALD
HTPG_ALKEH      RKAGLGAEHGVRWSSD----GKGAYTLENEEVAE-----------RGTRVVLTLPESQSE
HTPG_HALHL      RKAGAAAAEGVRWSSD----GQGAYTVDTVERAE-----------RGTAVVLHLPEAQQE
HTPG_NITOC      RRAGFGPEHGVRWESG----GAGDYTIETIEKAT-----------RGTVVTLHLREGEDE
HTPG_MAGMM      RKAGAGAEQGVRWISA----GDGSYTLENMEKAE-----------RGTRITLHMREDEKE
HTPG_METCA      RKAGVPAEEGARWESS----GEGSYTLETLTRPE-----------RGTRVTLHLREGEDE
HTPG_COXBR      RRAGMKADQGVEWEST----GEGEYTLKNIDKPT-----------RGTEVVLHLKESEEE
HTPG_COXBU      RRAGMKADQGVEWEST----GEGEYTLKNIDKPT-----------RGTEVVLHLKESEEE
HTPG_COXBN      RRAGMKADQGVEWEST----GEGEYTLKNIDKPT-----------RGTEVVLHLKESEEE
HTPG_HAEIN      RAAGEEADKAVLWESA----GEGEYSVADIEKKS-----------RGTDVILHLREDEKE
HTPG_HAEIE      RAAGEEADKAVLWESA----GEGEYSVADIEKKS-----------RGTDVILHLCEDEKE
HTPG_HAEI8      RAAGEEADKAVLWESA----GEGEYSVADIEKKS-----------RGTDVILHLREDEKE
HTPG_HAEIG      RAAGEEADKAVLWESA----GEGEYSVADIEKKS-----------RGTDVILHLREDEKE
HTPG_AGGAC      RAAGEPADKGVLWESA----GEGDYTVADIEKKS-----------RGTDVILHLRDDEKE
HTPG_HAES1      RAAGEPIDKAVLWESA----GEGEYSVADIEKKE-----------RGTEITLHLREEEKE
HTPG_HISS2      RAAGEPIDRAVLWESA----GEGEYSVADIEKRE-----------RGTEITLHLREEEKE
HTPG_PASMU      RAAGVSADKAVLWESA----GEGEYSVADIDKKE-----------RGTEITLHLREDEKA
HTPG_ACTSZ      RAAGVPAEQGVLWTSA----GEGEYSVEDIEKKE-----------RGTEITLFLREDEKE
HTPG_MANSM      RAAGVAADKGVLWASA----GEGEYSVENIEKKD-----------RGTEITLFLREDEKE
HTPG_ACTP2      RAAGET--QAVLWESA----GEGDYTVADIEKAT-----------RGTDVILHLREEEKE
HTPG_ECOLI      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECOL5      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECOHS      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECOL6      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_SHIBS      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_SHISS      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECO57      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECOLC      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECOUT      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECOK1      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_ECO24      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_SHIFL      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_SHIDS      RAAGEKPENGVFWESA----GEGEYTVADITKED-----------RGTEITLHLREGEDE
HTPG_SALPB      RAAGDKPENGVFWESA----GEGEYTVADITKND-----------RGTEITLHLREGEDE
HTPG_SALPA      RAAGDKPENGVFWESA----GEGEYTVADITKND-----------RGTEITLHLREGEDE
HTPG_SALTY      RAAGDKPENGVFWESA----GEGEYTVADITKND-----------RGTEITLHLREGEDE
HTPG_SALCH      RAAGDKPENGVFWESA----GEGEYTVADITKND-----------RGTEITLHLREGEDE
HTPG_SALTI      RAAGDKPENGVFWESA----GEGEYTVADITKND-----------RGTEITLHLREGEDE
HTPG_CITK8      RAAGDKPENGVFWESA----GEGEYTVADITKDD-----------RGTEITLHLREGEDE
HTPG_CROS8      RAAGVSADEAVFWESE----GEGEYTVADISKAD-----------RGTEITLHLREGEDE
HTPG_KLEP7      RAAGDKPENGVFWESA----GEGEYTVADITKAD-----------RGTEITLHLREGEDD
HTPG_ENT38      RAAGDSAENGVFWESH----GEGEYTVDDITKAD-----------RGTEITLHLREGEDD
HTPG_PECAS      RAAGANADQGVYWESA----GEGDYTIADITKDD-----------RGTEITLHLREGEDE
HTPG_YERPA      RAAGAPADTGVFWESA----GEGDYTIADITKDE-----------RGTEITLHLREGEDE
HTPG_YERPS      RAAGAPADTGVFWESA----GEGDYTIADITKDE-----------RGTEITLHLREGEDE
HTPG_YERPN      RAAGAPADTGVFWESA----GEGDYTIADITKDE-----------RGTEITLHLREGEDE
HTPG_YERPP      RAAGAPADTGVFWESA----GEGDYTIADITKDE-----------RGTEITLHLREGEDE
HTPG_YERPE      RAAGAPADTGVFWESA----GEGDYTIADITKDE-----------RGTEITLHLREGEDE
HTPG_YERE8      RAAGAPADAGVFWESA----GEGDYTIADITKED-----------RGTEITLHLREGEDE
HTPG_SERP5      RAAGAAADQGVFWESI----GEGDYTIADVSKED-----------RGTEITLHLREGEDE
HTPG_PHOLL      RAAGASIDQGVFWESA----GEGDYTIADIEKET-----------RGTEITLHLREGEDE
HTPG_SODGM      RAAGAKPDGGVFWESA----GEGDYTIADITKPE-----------RGTEITLHLREGEDD
HTPG_BAUCH      RAAGASADEGVHWEST----GEGDYIIAAINKPE-----------RGTEITLFLREGEDE
HTPG_VIBCH      RAAGSAPADAVQWYSK----GEGEYTVETINKES-----------RGTDIILHLREEGKE
HTPG_VIBC3      RAAGSAPADAVQWYSK----GEGEYTVETINKES-----------RGTDIILHLREEGKE
HTPG_VIBPA      RAAGLPADEAVQWHSA----GEGEYTIENITKES-----------RGTDIILHMRDEGKE
HTPG_VIBCB      RAAGLAADEAVQWQSA----GEGDYTVETITKDS-----------RGTDIVLHMREEGKE
HTPG_VIBVY      RAAGLNADQAVLWHSA----GEGEYTVEDITKES-----------RGTDIILHMREDGKE
HTPG_VIBVU      RAAGLSADQAVLWHSA----GEGEYTVEDITKES-----------RGTDIILHMREDGKE
HTPG_ALIF1      RAAGSEKDQGVQWHSE----GEGDYTIEDITKES-----------RGTDIILHMREEGKE
HTPG_PHOPR      RAAGEAADKGVSWTSE----GEGDYTVEDINKTT-----------RGTDIILHLRDDEAE
HTPG_AERHH      RAAGTAPEQGVQWESE----GEGSFTVADVTKAG-----------RGTDVILHLRAEEDE
HTPG_AERS4      RAAGTAPEQGVQWESE----GEGSFTVADVTKEG-----------RGTDVILHLRAEEEE
HTPG_PSEHT      RKAGE--TTAYEWESQ----GEGEYTLQEIEKEG-----------RGTDIILHLREEEKE
HTPG_COLP3      RKAGDSATDGVEWISA----GEGEFTTAKIEKTN-----------RGTDIILHLKEDESE
HTPG_PSEA6      RAAGDDASKGVEWTSE----GEGEFTVADIEKAD-----------RGTEITLFLREDEKE
HTPG_IDILO      RSALDKDARGVEWRSQ----GEGDFEIADIDKAR-----------RGTDIILHLKDDADE
HTPG_PSYIN      RKAGEPASQGTCWIST----GESDYTVADIEKAG-----------RGTEITLHLRDDETE
HTPG_SHEPA      RAAGHSADEAVLWESA----GEGDFTVETISKQT-----------RGTEITLHLRDDEKE
HTPG_SHEHH      RAAGHSADEAVLWESA----GEGDFTVETITKQS-----------RGTEITLHLRDDEKE
HTPG_SHESH      RAAGHGSDEGVQWESA----GEGDFTVDTIVKET-----------RGTEIVLHLREEEKE
HTPG_SHELP      RAAGHAADEAVQWESA----GEGEFTVENIVKES-----------RGTEIILHLREEEKE
HTPG_SHEPC      RAAGHKADEAVLWESE----GEGSFTVETITKAS-----------RGTEITLHLRDEEKE
HTPG_SHESW      RAAGHKADEAVLWESE----GEGSFTVETITKAS-----------RGTEITLHLRDEEKE
HTPG_SHESM      RAAGHKANEAVLWESE----GEGSFTVDTITKAS-----------RGTEITLHLRDEEKE
HTPG_SHESR      RAAGHKANEAVLWESE----GEGSFTVDTITKAS-----------RGTEITLHLRDEEKE
HTPG_SHESA      RAAGHKANEAVLWESE----GEGSFTVDTITKAS-----------RGTEITLHLRDEEKE
HTPG_SHEON      RAAGHKANEAVLWESE----GEGSFTVETITKAT-----------RGTEITLHLRDDEKE
HTPG_SHEB9      RAAGHKADEAVLWESE----GEGNFTVDTITKAS-----------RGTEITLHLRDEEKE
HTPG_SHEB8      RAAGHKADEAVLWESE----GEGNFTVDTITKAS-----------RGTEITLHLRDEEKE
HTPG_SHEB5      RAAGHKADEAVLWESE----GEGNFTVDTITKAS-----------RGTEITLHLRDEEKE
HTPG_SHEDO      RAAGHPANEGVLWESE----GEGSFNVETITKNS-----------RGTEIVLHLRDEEKE
HTPG_SHEFN      RAAGHAANEGVLWESE----GEGSFNVESITKNE-----------RGTEIVLHLRDEETE
HTPG_SHEAM      RAAGHSADEGVKWESE----GEGNFSVETITKAE-----------RGTKIVLHLRDEEKE
HTPG_BUCAI      RFAGLESNKGILWESS----GEGEYNITNIVKKT-----------RGTEITLFLKKEEEE
HTPG_BUCAP      RFAGSKSNLGVLWESS----GEGEYNITDIKKKT-----------RGTEITLFLKKEEEE
HTPG_BUCBP      RFAGLKENQGVIWTSD----GKGTYEVNEINKKE-----------RGTEVTLYLTKDHYE
HTPG_BUCCC      RHAKEKKNIGTLWISE----GKGKYSVEKISKEE-----------HGTIVELSLKSSEKE
HTPG_WIGBR      RSFKENEKNGVLWESS----GKGEYTISNIIKKD-----------VGTEITIFLKESEKE
HTPG_LEGPH      RRAGLQPEDGIVWESK----GDGEFTIGYEKKST-----------RGTEITLHLKPENDE
HTPG_LEGPC      RRAGLQPEDGIVWESK----GDGEFTIGYEKKST-----------RGTEITLHLKPENDE
HTPG_LEGPL      RRAGLQPEDGIVWESK----GDGEFTIGYEKKST-----------RGTEITLHLKPENDE
HTPG_LEGPA      RRAGLQPEDGIVWESK----GDGEFTIGYEKKLT-----------RGTEITLHLKPENDE
HTPG_PSEAE      RRAGQPASEGVHWSSK----GEGEFDVATIDKPE-----------RGTRIVLHLKKGEEE
HTPG_PSEA7      RRAGQPASEGVHWSSK----GEGEFDVATIDKPE-----------RGTRIVLHLKKGEEE
HTPG_PSEMY      RRAGLSAAEGVHWSSK----GEGEFEVATVEKAE-----------RGTRIVLHLKSGEEE
HTPG_PSEPF      RRAGTAASEGVHWSSK----GEGEFEVATIDKPE-----------RGTRIVLHLKSGEEE
HTPG_PSEF5      RRAGLPASEGVHWSSK----GEGEFEVATIDKAE-----------RGTRIVLHLKSGEDE
HTPG_PSEU2      RRAGTPASEGVHWSSK----GEGEFEVATVDKAD-----------RGTRIVLHLKNGEEE
HTPG_PSE14      RRAGTPANEGVHWSSK----GEGEFEVATVDKAD-----------RGTRIVLHLKNGEEE
HTPG_PSESM      RRAGSPSSEGVHWSSK----GEGEFEVANVDKAE-----------RGTRIVLHLKNGEEE
HTPG_PSEPK      RRAGQPAAEGVHWSSK----GEGEFEVATIDKPQ-----------RGTRIVLHLKKDEQE
HTPG_XANC5      RRAGLPASEGVHWSSR----GEGEFEIASVDKPE-----------RGTRIVLHLKEGEES
HTPG_XANAC      RRAGLPASEGVHWSSR----GEGEFEIASVDKPE-----------RGTRIVLHLKEGEES
HTPG_XANOM      RRAGLPAREGVHWSSR----GEGEFEVASVDKPE-----------RGTRIVLHLKDGEDT
HTPG_XANOR      RRAGLPAREGVHWSSR----GEGEFEVASVDKPE-----------RGTRIVLHLKDGEDT
HTPG_XANCP      RRAGLPASDGVHWSSR----GEGEFEVASVDKPE-----------RGTRIVLHLKDGEDS
HTPG_XANC8      RRAGLPASDGVHWSSR----GEGEFEVASVDKPE-----------RGTRIVLQLKEGEES
HTPG_XYLFA      RRAGLTAAEGVHWSSK----GEGNFEVATIDKPQ-----------RGTRVVLHLKENEQH
HTPG_XYLFT      RRAGLTAAEGVHWSSK----GEGNFEVATIDKPQ-----------RGTRVVLHLKENEQH
HTPG_SACD2      RRAGSEPSEGVRWVSE----GEAEYSIENIEKAA-----------RGTTIILHLKKDQEE
HTPG_MARHV      RKAGEPADNGVHWESK----GDGEFTIEPVSREQ-----------RGTEIVLHLKPEDKE
HTPG_HAHCH      RRAGLKPDEAVHWESS----GEGDFSIETVTKEE-----------RGTRIVLHLKDEEKE
HTPG_MARMS      RRAGVAADQAVRWVSD----GSGEFTIENIEKDS-----------RGTRIILHLKAGEKE
HTPG_CHRSD      RRVDQ--EQGVQWHSR----GEGEFDIADIDKPE-----------RGTEIVLHLKEDAKE
HTPG_ALCBS      RKAGEAVNNGVRWESD----GKGEFTVETVPRDE-----------QGTAVILHLRDDAKD
HTPG_RUTMC      RKAGSKSKKGTKWTST----GKGKYSIERVNCLN-----------FGTSVTLHIKKDEKE
HTPG_VESOH      RKAGSKSKKGTKWAST----GKGKYSIESIDRPD-----------FGTSVILHIKKDEKE
HTPG_HYDCU      RKAGDDKSEGTRWESA----GEGEYTLETVEKET-----------KGTEITLHLKEDMDE
HTPG_FRAT1      RKAGQDKSQATKWVSD----AQNGFTVETITKEK-----------RGTEVILHIKKEHLD
HTPG_FRATT      RKAGQDKSQATKWVSD----AQNGFTVETITKEK-----------RGTEVILHIKKEHLD
HTPG_FRATW      RKAGQDKSQATKWVSD----AQNGFTVETITKEK-----------RGTEVILHIKKEHLD
HTPG_FRATN      RKAGQDKSQATKWVSD----AQNGFTVETITKEK-----------RGTEVILHIKKEHLD
HTPG_FRATF      RKAGQDKSQATKWVSD----AQNGFTVEIITKEK-----------RGTEVILHIKKEHLD
HTPG_FRATH      RKAGQDKSQATKWVSD----AQNGFTVEIITKEK-----------RGTEVILHIKKEHLD
HTPG_FRAP2      RKAGQDKSQATKWVSD----AQNGFTVETITKEK-----------RGTEITLHIKEDQLD
HTPG_PELLD      RSARA-GSEGLRWRSS----GQGTYTIEKID-----------KKEPGTRISFTLKDEHKE
HTPG_CHLPM      RSAQE-GSEGLRWQSS----GQGTYTIEKVE-----------KKERGTRISFTLKEEYKE
HTPG_CHLCH      RSFHS-NAQGYRWRSS----GQGTYTIEQID-----------KATRGTRISFKLKEEHQE
HTPG_CHLPD      RSSGA-DSAGYRWRSG----AAGTFTIERIE-----------KEQRGTKISFALKDEFKE
HTPG_CHLTE      KSIES-GLQGWRWKSS----GQGSYTIEPVE-----------REARGTRISFILKEEFRE
HTPG_DESHY      RSYEP-DAQGYRWESD----GRGSYSISEEM-----------DLPRGTSITLHLKEDAHS
HTPG_DESPS      RSWD--GSQGHEWLSE----GAGSFTITPLD-----------GLARGTRIVVELKDDAHE
HTPG_DESAG      RSALD-ASGAWRWTSD----GLGSFELEEAL-D---------APERGTRIDIRLKEDAGD
HTPG_DESVH      RSYIE-GEAAHTWTSD----GLGEFTVEEATGD---------IPQRGTVIKAHLREDAAE
HTPG_BACFR      KSYKE-GAQAVKWTCD----GSPEFTLEEVEKAD-----------RGTDIVLYIDDDCKE
HTPG_BACFN      KSYKE-GAQAVKWTCD----GSPEFTLEEVEKAD-----------RGTDIVLYIDDDCKE
HTPG_BACTN      KSYRD-EAQAIKWTCD----GSPEFTIEEVDKAD-----------RGSDIILYIDDDCKE
HTPG_PORGI      RSFRE-DATAVKWSCD----GSPEYTLEPADKAD-----------RGTDIVMHIDEENSE
                            :       .   :                     *: :   :      

HTPG_BACSU      DSYDEFLEEYRLKAIIKKYSDFIRYPIKMDTTINKPKEGSENEF----------------
HTPG_BACVZ      ESYDEFLENYRIKAIVKKYSDFIRYPIKMEETVNKPKEGSENEF----------------
HTPG_BACLD      ENYDEYLDVHRLKAIIKTYSDFIRYPIKMDVAVNKPKEGAENEF----------------
HTPG_BACHD      ESYDEFLEEYRLTSIIKKYSDFIRYPIKMDVTKRELKEGTEDEY----------------
HTPG_BACSK      ESYDEYLEEYRIKAIIKKYSDFIRYPIKMNVTVSKPKEDNEDEY----------------
HTPG_OCEIH      ENYDEFLDTFTLQQIIKKYSDFIRYPIKMDVTESKLKEGSEDEY----------------
HTPG_CLOBH      ENYDEFLEEYTLKSIIKKYSDFIRYPIKMDLTKTKPKEDNKEEF----------------
HTPG_CLOB1      ENYDEFLEEYTLKSIIKKYSDFIRYPIKMDLTKTKPKEDNKEEF----------------
HTPG_CLOBL      ENYDEFLEEYTLKSIIKKYSDFIRYPIKMDLTKTKPKEDNKEEF----------------
HTPG_ALKMQ      EKYEDYLEAYRLKTIIKKYSDFIRYPIKMDIETSKPKEGAEGEY----------------
HTPG_ALKOO      ENYSEYLEEYRLRNIIKKYSDFIRYPIKMDIHNKRLKENSEDDY----------------
HTPG_CLOP1      ENYDEFLEEYKLKSLIKKYSDFIRYPIKLDVTKSRVKEGTENEH----------------
HTPG_CLOPE      ENYDEFLEEYKLKSLIKKYSDFIRYPIKLDVTKSRVKEGTENEH----------------
HTPG_CLOPS      ENYDEFLEEYKLKSLIKKYSDFIRYPIKLDVTKSRVKEGTENEH----------------
HTPG_CLOAB      EKYDEFLDEYKLRSLIKKYSDFIKYPIKMMTKKTRPKKDNDKET----------------
HTPG_CLOTE      ENYDEFLEEYNIKNLIKKYSNFIKYPIKMNMKKTKLKEGTKDEY----------------
HTPG_FUSNN      --YNEFLEDWKIKDLVKKYSNYIRYEI---------------------------------
HTPG_RHIME      -----FTSRWTVERIVKEQSGHVPVPISIVEKPGA-------------------------
HTPG_RHIEC      -----YTSRWTVERIVKEQSGHVPVAIRIVDKPGG-------------------------
HTPG_NITWN      -----YTDRLKIEQMIKEQSGHVPVPIALIEKPGA-------------------------
HTPG_NITHX      -----YTDRLKLEQIVREQSGHVPVPIVLVEQPGA-------------------------
HTPG_AZOC5      -----YADRFRIERIVKEQSGHVPVPIYIVEKLDA-------------------------
HTPG_RHILO      -----YTGSYRLEQLAKSQSGHVPVPITLIEKPGA-------------------------
HTPG_RHOP2      -----YLEAYQIERIVSEYSDNIQFPIELVPEDG--------------------------
HTPG_RHOPS      -----YLEAYQIERIVSEYSDNIQFPIELVPEEG--------------------------
HTPG_RHOPA      -----YLEDWQIERIVTEYSDNIQFPILLMPEEG--------------------------
HTPG_RHOP5      -----YLEAYQIERIVSAYSDNIQFPIELVPEEG--------------------------
HTPG_RHOPB      -----YLEPYEIERVVGAYSDNIQFPIELVPEEG--------------------------
HTPG_BRADU      -----YLETYEIERIVGAYSDNILFPIELVPEEG--------------------------
HTPG_GLUOX      -----FLDSWRLRSIIRKWADHISWPITLRETKEDGT-----------------------
HTPG_MAGSA      -----FLDAFRLKSIVKRYSDHIAIPVTLKDADKD-------------------------
HTPG_RHORT      -----FLDEHRLREIVKTYSDHIAIPVDYAGKEGE-------------------------
HTPG_ROSDO      -----FLEESRIRHIIKTYSEHISFPVRLD------------------------------
HTPG_RICRS      -----FLDHFRLKHIVKSYSDHIAVPIYFFDEAGNN------------------------
HTPG_RICRO      -----FLDHFRLKHIVKSYSDHIAVPIYFFDEAGNN------------------------
HTPG_RICCN      -----FLDHFRLKHIVKSYSDHIAVPIYFFDEAGNN------------------------
HTPG_RICFE      -----FLDHFRLKHIVKSYSDHIAVPIYFFDEAGNN------------------------
HTPG_RICAH      -----FLDHFRLKHIVKSYSDHVAVPIYFFDEAGNN------------------------
HTPG_RICCK      -----FLDHFRLKHIVKSYSDHIAVPIYFFDENGNS------------------------
HTPG_RICBR      -----FLDHFRLKHIVKSYSDHIAVPIYFFDEGDNN------------------------
HTPG_RICB8      -----FLDHFRLKHIVKSYSDHIAVPIYFFDEGDNN------------------------
HTPG_RICTY      -----FLDHFRLKHIVKSYSDHIAVPIYFCDEASNN------------------------
HTPG_RICPR      -----FLDHFRLKHIVKSYSDHIAVPIYFCDEAGNN------------------------
HTPG_ORITB      -----YLDHFQIKDIIKTYSDHISVPIYYVGVDGK-------------------------
HTPG_EHRCJ      -----FVDKFRIEHIVTTYSYHINYPVYFLNDAGE-------------------------
HTPG_EHRCR      -----FTDRFRIEHIITTYSYHINYPVYFLNDKGE-------------------------
HTPG_EHRRW      -----FVDKFRIEHIVTTYSYHINYPVYFLNDKGE-------------------------
HTPG_EHRRG      -----FVDKFRIEHIVTTYSYHINYPVYFLNDKGE-------------------------
HTPG_WOLPM      -----FLDKFRVENIVTTYSDHINFPVEFIDEEGK-------------------------
HTPG_WOLTR      -----FLDKFRIENIVTTYSDHINFPVEFIDEEGK-------------------------
HTPG_ANAPZ      -----FLDKFRIEHVVTTYSDHLGYPVYFLDEKGE-------------------------
HTPG_ANAMM      -----FLDKFRIEHIVTTYSDHVGYPIYLIASDGT-------------------------
HTPG_NEOSM      -----FLDKFKLEHVVVTNSNHIAFPIYLIDEKGE-------------------------
HTPG_TREDE      E----YATRWRIEEIIKTYSDHIAFPIYLHFTEKQYDDKGKVKS----------------
HTPG_TREPA      E----FATRWRLEEVIKKYSDHIAFPIYLHYLQKEYDKDGAVTD----------------
HTPG_HELPH      H----FASRWEIDGIVKKYSEHIPFPIFLTYTDTKFEGEGDHKK----------------
HTPG_HELPJ      H----FASRWEIDSVVKKYSEHIPFPIFLTYTDTKFEGEGDNKK----------------
HTPG_HELPY      H----FASRWEIDSVVKKYSEHIPFPIFLTYTDTKHEGEGDNQK----------------
HTPG_HELAH      N----FASRWEIDSIVKKYSEHIPFPIFLTYTDTKMEGEGDHKK----------------
HTPG_HELHP      H----FASRWEIEGIIHKYSEHIAFPIYLAFVESKFEGEGENKK----------------
HTPG_WOLSU      E----FASRWRLEEIIKKYSDHIPFPIFLHYTQKKNDQE---------------------
HTPG_CAMJJ      E----FANAYKIESIIEKYSNHIQFPIFMEKEEFTPAKEGEEEG----------------
HTPG_CAMJ8      E----FANTYKIESIIEKYSNHIQFPIFMEKEEFTPAKEGEEEG----------------
HTPG_CAMJR      E----FANTYKIESIIEKYSNHIQFPIFMEKEEFTPAKEGEEEG----------------
HTPG_CAMJE      E----FANAYKIESIIEKYSNHIQFPIFMEKEEFTPAKEGEEEG----------------
HTPG_CAMJD      E----FAHAYKIENIIEKYSNHIQFPIFMEKEEFTPAKEGEEEG----------------
HTPG_CAMHC      E----FLDSYRLENIIKKYSNHIPYPIFLQKEKYVASQKEGEEG----------------
HTPG_SULNB      E----FLDKWRVQEVVKKYSNHIAYPIILNYTEEETTGEGDEKE----------------
HTPG_ARCB4      E----FASKYRIKNIVEKYSNHIAYPIFLNYDEEVSEALSEEDEKAGKKPE---------
HTPG_BORBP      E----YANKWKIQEIIKKYSNHINYPIYIKYSEPI-MKDGKQEG----------------
HTPG_BORBU      E----YANKWKIQEIIKKYSNHINYPIYIKYSEPI-MKDGKQEG----------------
HTPG_BORAP      E----YANKWKIQEIVKKYSNHINYPIYIKYNEPI-MKDGKQEG----------------
HTPG_SULDN      E----FLDSYRIEGIIKKYSNHIPFAIFMDKDKFIPAKKDEDGKEIEP------------
HTPG_MYCTA      DDLHDYTSEWKIRNLVKKYSDFIAWPIRMDVERRTPA---SQEEGG-----------EGG
HTPG_MYCBO      DDLHDYTSEWKIRNLVKKYSDFIAWPIRMDVERRTPA---SQEEGG-----------EGG
HTPG_MYCBP      DDLHDYTSEWKIRNLVKKYSDFIAWPIRMDVERRTPA---SQEEGG-----------EGG
HTPG_MYCTU      DDLHDYTSEWKIRNLVKKYSDFIAWPIRMDVERRTPA---SQEEGG-----------EGG
HTPG_MYCA1      DELHDYTSEFKIKSLVKKYSDFIAWPIRMEVERRTPA---TEE---------------GG
HTPG_MYCPA      DELHDYTSEFKIKSLVKKYSDFIAWPIRMEVERRTPA---TEE---------------GG
HTPG_MYCUA      DELYDYTADWKLRHLIKKYSDFIAWPIRMEVEKRVPA---PHEEGE-----------EPG
HTPG_MYCLE      DELHDYTSEWKIRELVKKYSDFIAWPIRMEVERRAPA---TSDGEG-----------ADG
HTPG_MYCGI      DELHDYTSEWKIRELVKQYSDFIAWPVRMDVERRTPA---SEE---------------GG
HTPG_MYCVP      DELHDYTSEWKIRELVKQYSDFIAWPIRMEVERRTPA---PED---------------GG
HTPG_RHOJR      DHLHDYTSERKIKELVKRYSDFIAWPIRMNVERTVPA---EGD----------------G
HTPG_NOCFA      DHLYDYTQEWKLREIVKKYSDFIAWPIRMQVERTVTE---GEG--------------EDK
HTPG_SALTO      DNLHDYATEWTVRQIVKRYSDFIAHPIRMAVEQPGTD-----------------------
HTPG_SALAI      DNLHDYAAEWTIRQIVKRYSDFIAHPIRMAVERPGSD-----------------------
HTPG_FRACC      DRLYDYTDENKIREIVKRYSDFIAWPIRLVSAPAAKDRDSNDDGTA-----------ESG
HTPG_STRCO      NQLHDYTSAWKIKEIVKRYSDFITWPVRLLPEPGGDG--------------------SDG
HTPG_GEOSL      -EMKEYLDEWKIRSIVRKYSDYVQYPIVMDVTRTEVPKG-VNGEEI-----------EGA
HTPG_GEOMG      -EMKEYLDEWKIRSIVRKYSDYVQYPVVMDVTRTEVPKG-VNGEEI-----------EGA
HTPG_GEOUR      -EMKEYLDEWKIRSIIKKYSDYVQYPVVMDVTRDEPAKG-VDGEVI-----------EGG
HTPG_PELPD      -EFKEYLEEWKIRSIVKKYSDYIQYPVVMDITRTETPKG-VDGEEI-----------EGA
HTPG_BDEBA      DEVQNFTDKWVLKSLVKKYSDFIAHPIKM-------------------------------
HTPG_MYXXD      -DQKEFLGEWRLRSLITQYSDYVGHPIKLQVSKTTGT---------------------GD
HTPG_METFK      -----FLNDWKLKSIIRKYSDHITLPIVMKK--SEWKD---------------------G
HTPG_THIDA      -----FLSDWKIKSVIRTYSDHITLPIVMKK--TEWKD---------------------G
HTPG_CHRVO      -----LLNDWKLKGIIRKYSDHISIPIEMKKGNSYGEN---------------------G
HTPG_DECAR      -----FLGGWKLKSIIRKYSDHITLPIVMKKEDWKD-----------------------G
HTPG_AROAE      -----LLSGWKLRGLIRKYSDHIVQPILMKKEEWDKDK---------------------N
HTPG_NITEC      -----LLSSFQLRSIIRKYSDHITLPIIMKKEVWDDES---------------------K
HTPG_NITEU      -----LLSSFQLRSIIRKYSDHITLPIVMKKEVWDDES---------------------K
HTPG_NITMU      -----LLNGWRLRSIIRKYSDHITLPIVMKKEEWSQEK---------------------N
HTPG_BORBR      -----LLNGWKLREILRRYSDHISLPIRMAKEDWDAEK---------------------G
HTPG_BORPA      -----LLNGWKLREILRRYSDHISLPIRMAKEDWDAEK---------------------G
HTPG_BORPE      -----LLNGWKLREILRRYSDHISLPIRMAKEDWDAEK---------------------G
HTPG_BORA1      -----FLNGWKLREVLRRYSDHISLPILMRKEEWDADK---------------------D
HTPG_BURPS      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURMA      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURM7      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURP1      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURM9      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURMS      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURP0      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURP6      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURTA      -----LLSSYRLKSIVQKYSDHVALPILMKKEEWDQEK---------------------G
HTPG_BURCA      -----LLSSHRLKSIIQKYSDHIALPILMRKEEWDQEK---------------------G
HTPG_BURCH      -----LLSSHRLKSIIQKYSDHIALPILMRKEEWDQEK---------------------G
HTPG_BURCM      -----LLSSHRLKSIIQKYSDHIALPILMQKEEWDQEK---------------------G
HTPG_BURL3      -----LLSSHRLQSIIQKYSDHIALPILMQKEEWDQEK---------------------G
HTPG_PARXL      -----LLSSHRLKSIIQKYSDHVALPILMKKEEWDAEK---------------------S
HTPG_CUPNH      -----FLSAWRLKGIIQKYSDHISLPIRMPKEVWDAES---------------------S
HTPG_CUPPJ      -----FLSAWRLKSIIQKYSDHISLPIRMPKEVWDADT---------------------S
HTPG_CUPMC      -----FLSSYRLQNIIRKYSDHISLPIRMPKEEWDAEA---------------------Q
HTPG_RALSO      -----FLSAWRLKSIVQKYSDHISLPIAMRKESWDEEK---------------------K
HTPG_ACISJ      -----FLNAWKIKQVIGKYSDHISLPILMEKEEWKE-------SEK--------EG-EPG
HTPG_VEREI      -----YLNNWKLKSIISRYSDHISLPILMEKQEWKDGELINPGDEK--------GGRQPG
HTPG_RHOFT      -----YCSAWKLKSIINKYSDHISLPILMEKEEWKDGELINPSDEK--------GGRQPG
HTPG_POLNA      -----YLNAWKLKGIINKYSDHISLPILMPKEEWKEG-----------------ENDQPG
HTPG_POLSJ      -----YLNAWKLKGIINKYSDHISLPILMQKEEWKEG-----------------ENGQPG
HTPG_METPP      -----FLSAWKLKSVIGRYSDHISLPILMRGQVWDAE---------------------KS
HTPG_PSYCK      GEES-YLDRGKIKQLVNKYSDHISLPIQMRKEVWQEDE---VEEGS--------DTPANG
HTPG_PSYA2      GEDG-YLDRSKIKRLVNKYSDHISLPIQMRKEIWQEDE---VEEGD--------DTPANG
HTPG_ACIAD      -----YLDAWKVKQIINKYSDHISLPIEMQKEVWQEEE---VAEG---------EEPKGG
HTPG_ALKEH      -----YLDDWRLKGIIRRYSDHIDVPIQMPAQAEDKDE----------------PEDEAE
HTPG_HALHL      -----FCDDMRLRQIIRKYSDHISVPIEMPVRNADQG-------------------DDAD
HTPG_NITOC      -----FLDGWRLRHIVTRYSDHIDLPIEIKREIGDEEK----------------------
HTPG_MAGMM      -----FLDAWRLRSIVRKFSDHVTWPVKMLEELPPAPP-------A--------KEGEEP
HTPG_METCA      -----FLDGWKLRAIIRKFSDHISLPIEMKRETGEP------------------KEGEE-
HTPG_COXBR      -----FLDSLRLRAIITKYSDHILLPIVMKKIKTSGAD--------------------DE
HTPG_COXBU      -----FLDPLRLRAIITKYSDHILLPIVMKKIKTSGAD--------------------DE
HTPG_COXBN      -----FLDPLRLRAIITKYSDHILLPIVMKKIKTSGAD--------------------DE
HTPG_HAEIN      -----FLNEWRLREIIGKYSDHIGLPVEMLTKEYD---DEG-------------------
HTPG_HAEIE      -----FLNEWRLREIIGKYSDHIGLPVEMLTKEYD---DEG-------------------
HTPG_HAEI8      -----FLNEWRLREIIGKYSDHIGLPVEMLTKEYD---DEG-------------------
HTPG_HAEIG      -----FLNEWRLREIIGKYSDHIGLPVEMLTKEYD---DEG-------------------
HTPG_AGGAC      -----FLNEWRLRGIIGKYSDHIGLPVEMLTKEYE---DEG-------------------
HTPG_HAES1      -----FANEWRVREIIGKYSDHIGLPVEILAKEYD---EEG-------------------
HTPG_HISS2      -----FANEWRVREIIGKYSDHIGLPVEILAKEYD---EEG-------------------
HTPG_PASMU      -----FLNDWRLREIIGKYSDHIGLPVEILAKEYD---DEG-------------------
HTPG_ACTSZ      -----FLNEWRLREIIGKYSDHIGLPVEILTKEFD---EEG-------------------
HTPG_MANSM      -----FLNEWRLREIIGKYSDHIGLPVEILTKEYD---EEG-------------------
HTPG_ACTP2      -----FLSEWRLREIIGKYSDHIGLPVEIQTTEYN---EEG-------------------
HTPG_ECOLI      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECOL5      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECOHS      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECOL6      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SHIBS      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SHISS      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECO57      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECOLC      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECOUT      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECOK1      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ECO24      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SHIFL      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SHIDS      -----FLDDWRVRSIISKYSDHIALPVEIEKCE-----EKD-------------------
HTPG_SALPB      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SALPA      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SALTY      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SALCH      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_SALTI      -----FLDDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_CITK8      -----FLDDWRVRSIISKYSDHIALPVEIEKQE-----EKD-------------------
HTPG_CROS8      -----FLNDWRVRSIISKYSDHIALPVEIETRE-----EKD-------------------
HTPG_KLEP7      -----FLNDWRVRSIISKYSDHIALPVEIEKRE-----EKD-------------------
HTPG_ENT38      -----FLNDWRVRSIISKYSDHIALPVEIEKRE-----EQD-------------------
HTPG_PECAS      -----FLDDWRVRSVISKYSDHIALPVEIESQT-----ESEEEG----------------
HTPG_YERPA      -----YLDDWRLRSVISKYSDHIALPVEIQVKN-----EEDG------------------
HTPG_YERPS      -----YLDDWRLRSVISKYSDHIALPVEIQVKN-----EEDG------------------
HTPG_YERPN      -----YLDDWRLRSVISKYSDHIALPVEIQVKN-----EEDG------------------
HTPG_YERPP      -----YLDDWRLRSVISKYSDHIALPVEIQVKN-----EEDG------------------
HTPG_YERPE      -----YLDDWRLRSVISKYSDHIALPVEIQVKN-----EEDG------------------
HTPG_YERE8      -----YLDNWRLRSVISKYSDHIALPVEIESKN-----EEDG------------------
HTPG_SERP5      -----YLDAWRLRSVIGKYSDHIALPVEIETKN-----EEDG------------------
HTPG_PHOLL      -----FLNDWRLRSVISKYSDHIALPVEIETKNKS---EEEGE-----------------
HTPG_SODGM      -----FLDDWRLKSVIGKYSDHIVLPVEIETRSKS---EEEGS-----------------
HTPG_BAUCH      -----FLDDWRIKNTIGKYSDHITLPIEIATNS-----ENK-------------------
HTPG_VIBCH      -----FLSEWRLRDVISKYSDHIGIPVYIQTSVMD---EEG--K----------------
HTPG_VIBC3      -----FLSEWRLRDVISKYSDHIGIPVYIQTSVMD---EEG--K----------------
HTPG_VIBPA      -----FLNEWRLRDVISKYSDHIGIPVSIQTVVRD---EDG--K----------------
HTPG_VIBCB      -----FLNEWRLRDVISKYSDHIGIPVSIQTSVRD---DEG--K----------------
HTPG_VIBVY      -----FLNEWRLRDVIGKYSDHIGIPVSIQTRVRD---EEG--K----------------
HTPG_VIBVU      -----FLNEWRLRDVIGKYSDHIGIPVSIQTRVRD---EEG--K----------------
HTPG_ALIF1      -----FLNEWRLKEVIGKYSDHIGIPVSIWTVEKD---EEG--K----------------
HTPG_PHOPR      -----FLNEHRLRDIIGKYSDHIGIPVHILVTEND---DEG--K----------------
HTPG_AERHH      -----FLDDWRLRSVVSKYSDHISVPVEMYKEGTP---DSVGEG----------EEDGET
HTPG_AERS4      -----FLDDWRLRAVVAKYSDHISVPVEMFKEGTP---DR--------------EEDGET
HTPG_PSEHT      -----FADEWRLRSIVTKYSDHISTPVQMYKAEVP---ESEG-------------EDGEK
HTPG_COLP3      -----YADDWRLKSIVTKYSDHISVSVEMLTAEVP---AVEAVAEVTDEKDNVTRPAADA
HTPG_PSEA6      -----FADDWRLRSIVSKYSDHISIPVMMYKEEVP---ESDG-------------PDGEK
HTPG_IDILO      -----FLDENRLRGIINKYSEHLSIPVQMWKEPVP---ESED-------------DEGNK
HTPG_PSYIN      -----FLNDYKLRGIVSKYSDHISIPVEMFKEATE---ESEG-------------SDGEK
HTPG_SHEPA      -----FADDYRLRSIITKYSDHISVPVEMFEAGTP---AVEATE-----------DT-EA
HTPG_SHEHH      -----FADDYRLRSIITKYSDHISVPVEMYEEGTP---AVEATE-----------EGGEA
HTPG_SHESH      -----FADDYRLRSIITKYSDHISVPVEMWEEGTP---AIEATE-----------EQ-EA
HTPG_SHELP      -----FASDYRLRSIITKYSDHISVPVEMWQEGTP---AQEATE-----------EGGEA
HTPG_SHEPC      -----FADDWRLRSIITKYSDHISVPVEMWQEGTP-----ERDG-----------PDGEK
HTPG_SHESW      -----FADDWRLRSIITKYSDHISVPVEMWQEGTP-----ERDG-----------PDGEK
HTPG_SHESM      -----FADEWRLRSIITKYSDHISVPVEMWQEGTP-----ERDG-----------PDGEK
HTPG_SHESR      -----FADEWRLRSIITKYSDHISVPVEMWQEGTP-----ERDG-----------PDGEK
HTPG_SHESA      -----FADEWRLRSIITKYSDHISVPVEMWQEGTP-----ERDG-----------PDGEK
HTPG_SHEON      -----FADDWRLRSIITKYSDHISIPVEMWQEGTP-----ERDG-----------PDGEK
HTPG_SHEB9      -----FADDWRLRSIITKYSDHISVPVEMWQEGTP-----ESDG-----------ADGEK
HTPG_SHEB8      -----FADDWRLRSIITKYSDHISVPVEMWQEGTP-----ESDG-----------ADGEK
HTPG_SHEB5      -----FADDWRLRSIITKYSDHISVPVEMWQEGTP-----ESDG-----------ADGEK
HTPG_SHEDO      -----FADDWRLRSIITKYSDHISVPVEMFEAGKD-----AQEG-----------EDGET
HTPG_SHEFN      -----FADDYRLRSIITKYSDHISVPVQMWNEGTP-----ESDG-----------PDGEK
HTPG_SHEAM      -----FADDWRLRSIITKYSDHISIPVEMYQEGTP-----ERDG-----------PDGEK
HTPG_BUCAI      -----FLETWRIKNIISKYSDHITIPIHIQDYDKK---N---------------------
HTPG_BUCAP      -----FLELWRIEGIVSKYSDHITVPVKIQKYDEK---N---------------------
HTPG_BUCBP      -----FLETWKIQNTVSKYSDHISIPIELNTYDEK---E---------------------
HTPG_BUCCC      -----FLEIWKIKNIIKKYSDHISIPIEIENYDEK---T---------------------
HTPG_WIGBR      -----FCDELNIKNIVLKYSNHINFPIKLKTKITK---DNKILT---------------P
HTPG_LEGPH      -----FLSDWRIRGIISKYSDHICWPIVMKKLSEE---GKE-------------------
HTPG_LEGPC      -----FLSDWRIRGIISKYSDHICWPIVMKKLSEE---GKE-------------------
HTPG_LEGPL      -----FLSDWRIRGIISKYSDHICWPIVMKKLSEE---GKE-------------------
HTPG_LEGPA      -----FLSDWRIRGIISKYSDHICWPILMKKLSEE---GKE-------------------
HTPG_PSEAE      -----FADGWRLRNVIKKYSDHIALPIELPKE-FH---GEEADK----------------
HTPG_PSEA7      -----FADGWRLRNVIKKYSDHIALPIELPKE-FH---GEEAEK----------------
HTPG_PSEMY      -----FADGWRLRNIVKKYSDHIALPIELPKE-HY---GEEKDK----------------
HTPG_PSEPF      -----FADGWRLRNIIKKYSDHIALPIELPKE-VA---AAEGEE----------------
HTPG_PSEF5      -----FADGWRLRNIIKKYSDHIALPIELPKE-AA---AAEGEE----------------
HTPG_PSEU2      -----FADGYRLRNIIKKYSDHIALPIELPKEQAP---AAEGEE----------------
HTPG_PSE14      -----FADGYRLRNIIKKYSDHIALPIELPKEQAP---AAEGEE----------------
HTPG_PSESM      -----FADGYRLRNIIKKYSDHIALPIELPKEQAP---AAEGEE----------------
HTPG_PSEPK      -----FADGWRLRNVVKKYSDHIALPIQLPKE-QA---ATEGEE----------------
HTPG_XANC5      -----FADGWTLRGILKKYSDHIGLPIEMRKE-HY---GEAADK----------------
HTPG_XANAC      -----FADGWTLRGILKKYSDHIGLPIEMRKE-HY---GEAADK----------------
HTPG_XANOM      -----FADGWTLRGILKKYSDHIGLPIEMRKE-HY---GEAADK----------------
HTPG_XANOR      -----FADGWTLRGILKKYSDHIGLPIEMRKE-HY---GEAADK----------------
HTPG_XANCP      -----FADGWTLRNILKKYSDHIGLPIEMRKE-HY---GEDADK----------------
HTPG_XANC8      -----FADGWTLRNILKKYSDHIGLPIEMRKE-HY---GEDADK----------------
HTPG_XYLFA      -----FAEGWTLRSTLKKYSDHIGLPIEMVKEEHH---GKEEEKDA--------------
HTPG_XYLFT      -----FAEGWTLRSTLKKYSDHIGLPIEMLKE-HH---GKEEEKDT--------------
HTPG_SACD2      -----FADGWRLRSIIKKYSDHISLPVEMPKEAAP---GEDKEE----------------
HTPG_MARHV      -----FADGWKLRSLVKKYSDHISFPVVMKSESEE--EDKKGEE----------------
HTPG_HAHCH      -----FANGWRLRSLVKKYSDHISFPVEMIKENMDVGEEEEGKEKA--------------
HTPG_MARMS      -----FADNFRLRHLVTKYSDHISIPVEMEKPVYPEMDEEGNPKPVDE------------
HTPG_CHRSD      -----FADAERLKHLVRTYSDHIEVPVRMPKVEKA--HDEEGNEIEG-------------
HTPG_ALCBS      -----FLDDFKIRQVIGQYSDHVAFPIVLETP-------QEGDK----------------
HTPG_RUTMC      -----FLDDYRLRGIISKYSDHITVPIMM--IKASED----------------------G
HTPG_VESOH      -----FLDDYRLRNIISKYSDHITVPIMM--VKVSED----------------------N
HTPG_HYDCU      -----FLDDFRLKSIITTYSDHINFPIKMWQVKLDEE----------------------G
HTPG_FRAT1      -----LLEYHVLKGLVNKYSDCINTSIQMKKVEYDKD----------------------G
HTPG_FRATT      -----LLEYHVLKGLVNKYSDCINTSIQMKKVEYDKD----------------------G
HTPG_FRATW      -----LLEYHVLKGLVNKYSDCINTPIQMKKVEYDKD----------------------G
HTPG_FRATN      -----LLEYHVLKGLVNKYSDCINTPIQMKKVEYDKD----------------------G
HTPG_FRATF      -----LLEYHVLKGLVNKYSDCINTPIQMKKVEYDKD----------------------G
HTPG_FRATH      -----LLEYHVLKGLVNKYSDCINTPIQMKKVEYDKD----------------------G
HTPG_FRAP2      -----LLDYHLLKSLVNKYSDCINTPIQMKKVEHDKD----------------------G
HTPG_PELLD      -----FAEEYRVEHIIKKYSNFVDFPIYLET-----------------------------
HTPG_CHLPM      -----FAEEYRVEQVIKKYSNFVDFPIYLGE-----------------------------
HTPG_CHLCH      -----FAEEYRVEQIIKKYSNFVDFPIYLGE-----------------------------
HTPG_CHLPD      -----FSEAYRIEQIIRKYSNFVDFPIFLGD-----------------------------
HTPG_CHLTE      -----FAQEYRVEQIIKKYSNFVEYPIYIGS-----------------------------
HTPG_DESHY      -----FAQADTVKRIIKQYSSFVPYPVYVGE-----------------------------
HTPG_DESPS      -----YAQDWKIKNVIEQYSSFVSFPIKLKG-----------------------------
HTPG_DESAG      -----FLKKDHLKDVIRRHSNFIPFPVSVEG-----------------------------
HTPG_DESVH      -----FLEKYRIEGILRKHSQFISFPIRVDG-----------------------------
HTPG_BACFR      -----FLEESRISALLKKYCSFLPVPIAFGKKKEWKD----------------------G
HTPG_BACFN      -----FLEESRISALLKKYCSFLPVPIAFGKKKEWKD----------------------G
HTPG_BACTN      -----FLEEARVSELLKKYCSFLPVPIAFGKKKEWKD----------------------G
HTPG_PORGI      -----FLKKEKIEGLLGKYCKFLTVPIIFGKKQEWKD----------------------G
                           :       .  :   :                                 

HTPG_BACSU      --EEVQEEQTVNSMVPIWRKNKSELTDEDYEKFYAEKHYGFDKPLTHVHISVDGAVRYNA
HTPG_BACVZ      --EEVQEEQTVNSMVPIWRKNKSELTDEDYEAFYAEKHYGFDKPLTHVHISVDGAVRYNS
HTPG_BACLD      --EEVQEEQTVNSMVPIWRKNKSELKDEDYEAFYKEKHYGFDKPLAHIHTSVDGAVRYHA
HTPG_BACHD      --EDVIEEQTINSMVPIWRKNKNELKDEDYTNFYHEKRYGFDQPLKHIHISVDGAVRYNA
HTPG_BACSK      --AEYQEEQTINSMVPIWRKNKSELKDSDYEQFYQDKRYGFDKPLEHIHVSVDGAIRYNA
HTPG_OCEIH      --EDVVEEQTINTMVPIWKKNKSELTDDDYTNFYQEKRYGFDKPLKHVHINVDGSIRYNA
HTPG_CLOBH      --EEYKEEETINSMVPIWRKNKNELKAEDYENFYAEKHYGFDKPIKYIHTSVDGVVSYNA
HTPG_CLOB1      --EEYKEEETINSMVPIWRKNKNELKAEDYENFYAEKHYGFDKPIKYIHTSVDGVVSYNA
HTPG_CLOBL      --EEYKEEETINSMVPIWRKNKNELKAEDYENFYAEKHYGFDKPIKYIHTSVDGVVSYNA
HTPG_ALKMQ      --EEIVEEQVVNSMVPMWRRNKNELTKEDYDLFYSEKHYGFDKPLKHIHISADGAVRYNA
HTPG_ALKOO      --EDYVEEQTINSMVPIWRKNKNELTKEDYDNFYMEKRYGFDKPVKHIHISADGAVRYNA
HTPG_CLOP1      --EEYVEEETVNSMVPLWRRNKNELTDDDYNNFYVEKRFGFDKPLRHMHISVDGMISYNS
HTPG_CLOPE      --EEYVEEETVNSMVPLWRRNKNELTDDDYNNFYVEKRFGFDKPLRHMHISVDGMISYNS
HTPG_CLOPS      --EEYVEEETVNSMVPLWRRNKNELTDDDYNNFYVEKRFGFDKPLRHMHISVDGMISYNS
HTPG_CLOAB      --EEYLEDETLNSMVPIWRKNKNELKQEDYDNFYMDKHFGFEKPLKTIHSNVEGVVSYNT
HTPG_CLOTE      --EDYFEDETLNSMVPIWKKNKNEVKTEDYERFYIDKHFGYDKPLKSIRSKVEGVVSYTA
HTPG_FUSNN      ----YFGDEVINSTKPIWKKDKKELKDDDYNEFYKATFHDWNDPLLHINLKVQGNIEYNA
HTPG_RHIME      ------EPAQVADGTALWTKQKSEISKDDYTDFYRGVAGQYDEPALTVHFRAEGRHEYTA
HTPG_RHIEC      ------EPVQITDGTALWTKSKSEVSKEDYTDFYRGLSGQYDEPALTVHFRAEGRHEYTA
HTPG_NITWN      ------EPAEIADGAALWTRPRGEISASEYADFYRSVAGQFDEPALTVHFRAEGRQEFTA
HTPG_NITHX      ------APTEIADGAALWTKPRGEIGTSEYVDFYRSVAGHFDEPALTVHFRAEGRQEFTA
HTPG_AZOC5      ------EPEEIADGVALWTKSKSDISAEDYADFYRSVAGQFDQPALTVHFRAEGRHEYTA
HTPG_RHILO      ------EARDIADGTALWVRPKSEIKPEEYTDFYRSVAGQYDEPAATIHFRAEGRQEYSV
HTPG_RHOP2      ------EPRQINSASALWQRSKSELTEEDYKQAYKQVAGAFDEPAMTLHYRAEGRQSYAV
HTPG_RHOPS      ------EPRQINSASALWQRSKSELTEEDYNQAYKQIAGAFDEPAMTLHYRAEGRQSYAV
HTPG_RHOPA      ------EPRQINSASALWQRSKSELSEDDYKQAYKQIAGAFDDPAMTLHYRAEGRQSYAV
HTPG_RHOP5      ------EARQINSASALWQRSKSELAAEDYKQAYKSIANAFDDPAMTLHYRAEGRYSYAV
HTPG_RHOPB      ------EPRQINSASALWQRSKSELTAEDYSQAYKQIAGAFDEPAMTLHYRAEGRYSYAV
HTPG_BRADU      ------EPRQINSASALWQRSKSELSAEDYKKAYQQIASAFDDPAMTLHYRAEGRYSYAV
HTPG_GLUOX      -----TEDQAANEGTALWSKPKSEITPEQYAEFYRHISHAFDEPYATLHWRAEGVTEFTA
HTPG_MAGSA      -------EETINSASALWTRSKSEITPEQYKEFYHHVAHAFDEPWSTLHYKAEGAIEYTG
HTPG_RHORT      -------PERLNEASALWTRPRDQITDEQYAEFYHHVAHGFETPWHTLHYRAEGKLEYTA
HTPG_ROSDO      -------TEALNSASAIWTRAPKEITEEQHTEFYHHVSNAFDKPWHVLHNRVEGTVNHTS
HTPG_RICRS      -------EIQLNSASALWTRPKSEITEEQYKEFYKSLSYAIDDPWITMHNKNEGAIEFTN
HTPG_RICRO      -------EIQLNSASALWTRPKSEITEEQYKEFYKSLSYAIDDPWITMHNKNEGAIEFTN
HTPG_RICCN      -------EIQLNSASALWTRPKSEITEEQYKEFYKSLSYAIDDPWITMHNKNEGAIEFTN
HTPG_RICFE      -------EIQLNSASALWTRSKSEITEEQYKEFYKSLSYAIDDPWITLHNKNEGAIEFTN
HTPG_RICAH      -------EIQLNSASALWTRPKSEITEEQYKEFYKSLSYAVDDPWITMHNKNEGAIEFTN
HTPG_RICCK      -------EIQLNSASALWTRPKLEITEEQYKEFYKSLSYTIDDPWITLHNKNEGAIEFTN
HTPG_RICBR      -------EIQLNSASALWTRSKSEITEEQYKEFYKSLSYAVDDPWVTMHNKNEGAIEFTN
HTPG_RICB8      -------EIQLNSASALWTRSKSEITEEQYKEFYKSLSYAVDDPWVTMHNKNEGAIEFTN
HTPG_RICTY      -------EIQLNSASALWTRPKSEITEEQYKEFYKSLSYSVDDPWVTLHNKNEGAIEFTN
HTPG_RICPR      -------EIQLNSASALWTRPKSEITEDQYKEFYKSLSYAVDDPWVTLHNKNEGAIEFTN
HTPG_ORITB      -------EQQVNSSSALWTRSKSDITDEQYEEFYRNIAYAIDKPWVTIHNKSEGVIEFTN
HTPG_EHRCJ      -------EEKLNSDAAIWTKSKDEISAQEHQNFFRSVAHVGGEPWMILHNKNEGVIEYTN
HTPG_EHRCR      -------EEKLNSDAAIWTKSKGEISAEEHQNFFRTVAHVGGEPWMILHNKNEGVVEYTN
HTPG_EHRRW      -------EERLNSEAAIWTKAKDEISAEEHQNFFRTVAHVGGEPWMILHNKNEGVIEYTN
HTPG_EHRRG      -------EERLNSEAAIWTKAKDEISAEEHQNFFRTVAHVGGEPWMILHNKNEGVIEYTN
HTPG_WOLPM      -------SEKLNSKAAIWTKPKNDVTQEEHNDFFRSVAHVGGEPWMILHNKNEGAIEYTN
HTPG_WOLTR      -------SEKLNSKAAIWTKLKNDVTQEEHNDFFRGVAHVGGEPWMILHNKNEGAIEYTN
HTPG_ANAPZ      -------EEKLNSGIAIWTKPKAEVTAAEHLEFFRSVAHIGSEPWMVIHNKNEGAIEYTN
HTPG_ANAMM      -------EEKLNSGVAIWTKPKDEISESEHMEFFRSISHIGSNPWMVIHNKNEGTIEYIN
HTPG_NEOSM      -------KDQINSASAIWTKNKTEITDEEHQNFFRDVAHVGGKPWMIIHNKNEGSTEYIN
HTPG_TREDE      ---EASKTEQINDAGAIWQKPKSELKEEDYFNFYKSLSHDSQEPLLYVHTKAEGTQEYTT
HTPG_TREPA      ---TQKKVDQVNDAGALWKRPKSELKEEDYHRFYQTLTRDSTPPLLYVHTKAEGTQEYVT
HTPG_HELPH      -EVKEEKCDQINQASALWKMNKSELKDKDYKDFYQSFAHDNSEPLSYIHNKVEGSLEYTT
HTPG_HELPJ      -EVKEEKCDQINQASALWKMNKSELKEKDYKDFYQSFAHDNSEPLSYIHNKVEGSLEYTT
HTPG_HELPY      -EIKEEKCEQINQASALWKMNKSELKDKDYKEFYQSFAHDNSEPLSYIHNKVEGSLEYTT
HTPG_HELAH      -EVKEEKCEQINQASALWKMNKSELKDKDYKEFYKSFAHDNSEPLSYIHNKVEGSLEYTT
HTPG_HELHP      -EIKENKQSQINTAKALWKIPKAELKDTDYKEFYATLSHDNNEPMRWIHTKVEGNLEYTT
HTPG_WOLSU      ----ESKEEQVNKAFALWRISKNELKEEDYKEFYKSLSHDSHDPLAWVHIKVEGSQEYTT
HTPG_CAMJJ      --KTELKISQINKANALWRMQKSSLKAEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNS
HTPG_CAMJ8      --KTELKISQINKANALWRMQKSSLKVEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNS
HTPG_CAMJR      --KTELKISQINKANALWRMQKSSLKAEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNS
HTPG_CAMJE      --KTELKISQINKANALWRMQKSSLKAEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNS
HTPG_CAMJD      --KTELKISQINKANALWRMQKSSLKAEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNS
HTPG_CAMHC      --HYESEISQVNKANALWRLPKSNLKEQDYFDFYKQISHDSSDPLLYIHTKAEGVHEYTT
HTPG_SULNB      -TKTVQKSEQINEATALWTLPKSELKEEDYIEFYKTISHGDDEPLTYLHNKVEGANEFTT
HTPG_ARCB4      -KKIERKHEQINAATALWMQPKAKLKEQDYNDFYKSISHDSSDPMLTIHTKTEGVNEYTT
HTPG_BORBP      ---IEEKEEKLNETTALWTKNKSEIKAEEYNEFYKNTTFDYENPLMHVHTKAEGNLEYTN
HTPG_BORBU      ---IEEKEEKLNETTALWTKNKSEIKAEEYNEFYKNTTFDYENPLMHIHTKAEGNLEYTN
HTPG_BORAP      ---IEEKEEKLNETTALWTKNKSEIKTEEYNEFYKNTTFDYENPLMYIHTKAEGNLEYTN
HTPG_SULDN      -SRNEVENIQINRANALWTISKNEISDEEYKDFYSSIAHSSEEPLAWMHNKAEGAIEYTT
HTPG_MYCTA      EETVTIETETLNSMKALWARPKEEVSEQEYKEFYKHVAHAWDDPLEIIAMKAEGTFEYQA
HTPG_MYCBO      EETVTIETETLNSMKALWARPKEEVSEQEYKEFYKHVAHAWDDPLEIIAMKAEGTFEYQA
HTPG_MYCBP      EETVTIETETLNSMKALWARPKEEVSEQEYKEFYKHVAHAWDDPLEIIAMKAEGTFEYQA
HTPG_MYCTU      EETVTIETETLNSMKALWARPKEEVSEQEYKEFYKHVAHAWDDPLEIIAMKAEGTFEYQA
HTPG_MYCA1      EETVTREVETLNSMKALWARPKDEVSEEEYKEFYKHIAHAWDDPLEVIAMKAEGTFEYQA
HTPG_MYCPA      EETVTREVETLNSMKALWARPKDEVSEEEYKEFYKHIAHAWDDPLEVIAMKAEGTFEYQA
HTPG_MYCUA      EETVVLETETLNSMKALWARPKDEVSADEYNEFYKHIAHAWDDPMEVIAMKAEGTFEYQA
HTPG_MYCLE      EEQVTIETQTINSMKALWTKSKDEVSEDEYKEFYKHIAHAWDDPLEVIAMKAEGTFEYQA
HTPG_MYCGI      EETVTVETQTLNSMKALWARPRDEVSDEEYTEFYKHVAHAWDEPLETIAMRAEGTFEYQA
HTPG_MYCVP      EESVTVETETLNSMKALWARPRDEVSDEEYTEFYKHVAHAWDEPLEVIAMKAEGTFEYQA
HTPG_RHOJR      EDEVTTTSETINSMKALWARSKDDVSEDEYKEFYKHIAHAWDDPLEVIPMKAEGTFEFQA
HTPG_NOCFA      QEKTIVEEQTLNSRKALWTRPRGEVSDEEYKEFYKHVSHAWDEPLEIIPLKAEGTFEYQA
HTPG_SALTO      GGESTTEVQTLNSMKALWARSRDEVEPAEYHEFYKHVSHDWADPLEVVHMRGEGTFEYEA
HTPG_SALAI      DSEPTTEVQTLNSMKALWARPRDEVEPAEYHEFYKHVSHDWADPLEVVHMRGEGTFEYEA
HTPG_FRACC      AGAENAGDRPLNSMKALWARPQSEVDKAEYDQFYQHLSHDWTGPLEVIHMKGEGTFEYEA
HTPG_STRCO      EGAEAREAETLNSMKALWARPRDEVSDDEYHELYKHIAHDWRDPLETIRLQAEGTFEYQA
HTPG_GEOSL      GTIEKTEEETLNSMKAIWTRSKSEVTEEEYEEFYKHVSHDFEKPLKTIHYSAEGTSEFKA
HTPG_GEOMG      GTIEKTVEETLNSMKAIWARAKSEVTEEEYEEFYKHVSHDFEKPLKTIHYSAEGVSEFKA
HTPG_GEOUR      GTIEKTTEETLNSMKAIWTRAKSEISEEEYEEFYKHISHDYDKPFRTIHYSAEGTSEFKA
HTPG_PELPD      GTIEKTVEETLNSMKAIWARPKSEVTEEEYQEFYKHISHDFENPFNTIHFSAEGISEFKA
HTPG_BDEBA      --MGETEEETLNSQKALWLKSPSEVTKEEYKEFYQHLTHDWNEPLRTVHYRAEGTMEFNA
HTPG_MYXXD      EAKTETSLEVVNKASALWQRSKSEITDEQYQEFYKHLTHDWEAPLAWTHFKADGNTQFTG
HTPG_METFK      EQVPTDEDETVNKASALWARNKSDISEQEYQEFYKHVSHDFENPLTWSHNRVEGKQEYIS
HTPG_THIDA      VETPTDEDETVNKASALWARPKKDISDDEYNEFYKHVAHDFEPPLAWSHNRVEGKQEYIS
HTPG_CHRVO      EVIVSDEMEAVNSASALWTRSKNDISEEQYQEFYKHVAHDFTAPLAWSHARVEGRQEYTE
HTPG_DECAR      EQVMTEEDETVNQANALWVRSKSDITEEQYKEFYKHVAHDFEDPLAWTHARVEGKQEYTQ
HTPG_AROAE      EQVTTDEDETVNQANALWTRSRNDITEEEYKGFYKHVGHDFDEPLAWTHARVEGRHEYTQ
HTPG_NITEC      AYKISDEEETVNQASAIWARPKNEITQEQYDEFYKHVAHDFEPPLAHVHARVEGKQEYIQ
HTPG_NITEU      SYRLSDEDETINQASAIWARPKNEITQEQYDEFYKHVAHDFEPPLAHVHARVEGKQEYIQ
HTPG_NITMU      ENTVTEEDETINQASALWARPKNEISEEQYNEFYKHVAHDFEPPLAYVHARVEGKQEYTQ
HTPG_BORBR      EQVKGDELETVNQANALWTRNKSDITDEQYREFYKTVSHDYDDPLAWTHNRVEGRSEYTQ
HTPG_BORPA      EQVKGDELETVNQANALWTRNKSDITDEQYREFYKTVSHDYDDPLAWTHNRVEGRSEYTQ
HTPG_BORPE      EQVKGDELETVNQANALWTRNKSDITDEQYREFYKTVSHDYDDPLAWTHNRVEGRSEYTQ
HTPG_BORA1      EQVTRDEWETVNQANALWTRSKSEISDEQYREFYKTVSHGFDEPLAWTHNRVEGRSEYTQ
HTPG_BURPS      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURMA      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURM7      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURP1      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURM9      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURMS      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURP0      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURP6      EMVEKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURTA      EMVEKDEDETVNQASALWTRAKSDVTEEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQ
HTPG_BURCA      EMVLKDEDETVNQASALWTRSKSDVTDEQYTQFYQHIAHDHQDPLTWTHNRVEGRSEYTQ
HTPG_BURCH      EMVLKDEDETVNQASALWTRSKSDVTDEQYTQFYQHIAHDHQDPLTWTHNRVEGRSEYTQ
HTPG_BURCM      EMVLKDEDETVNQASALWTRSKSDITDEQYTQFYQHVAHDHQDPLTWTHNRVEGRSEYTQ
HTPG_BURL3      EMVLKDEDETVNQASALWTRSKSEVSDEQYTQFYQHIAHDHQDPLTWTHNRVEGRSEYTQ
HTPG_PARXL      AMVTKDEDETVNQASALWTRSKSDITDEQYKQFYQHLSHDHQDPLTWTHNRVEGRSEYTQ
HTPG_CUPNH      TYQRTAEWESVNQASALWTRAKSDITDEQYTAFYQHIAHDNEAPLAWTHNRVEGRSEYTQ
HTPG_CUPPJ      AYKRTDEWESVNQASALWTRPKSDITDEQYIAFYQHIAHDNEAPLSWTHNRVEGRSEYTQ
HTPG_CUPMC      QQKVTGEWESVNQASALWTRSKSDITDEQYQAFYQHIAHDHEAPLAWTHNRVEGRSEYTQ
HTPG_RALSO      EMVAQDEWETINQASALWARPRADVTDEQYIAFYQHIAHEQGQPLAWTHNRVEGRSEYTQ
HTPG_ACISJ      QMVKTGEWETVNKASALWTRPKKDITDEQYQDFYKSISHDFENPLTWSHNRVEGNTEYTQ
HTPG_VEREI      AMVKTGDWETVNQASALWARPKKDVSDAQYAEFYKTISHDPLAPLTWAHNRVEGSTEYTQ
HTPG_RHOFT      GMVKTGEWETVNKGNAIWARAKKDITPEQYTEFYKQISHDFEAPLAYTHNRVEGSTEYTQ
HTPG_POLNA      EMAFTGEWETVNQAAALWTRPKKDITPEHYAEFYKQISYDSEAPLATTHNRVEGATEYTQ
HTPG_POLSJ      EMVVTGEWETVNQAAALWTRAKKDITPEQYDEFYKQISYDSQAPLATTHNRVEGGTEYTQ
HTPG_METPP      EYVTQDAWETVNKAAALWARPKSEITDAEYKSFYEQFSHDSTPPLAYTHNRVEGRSEYIQ
HTPG_PSYCK      QMVLTDEWETINKASALWTRSASEIEDEEYIDFYKNITYDMDAPLAWTHNRVEGRVQYTQ
HTPG_PSYA2      QMVLTDEWETINKASALWTRTASDVEDDEYVDFYKNITYDMDAPLTWTHNRVEGRVQYTQ
HTPG_ACIAD      QYVKTDEWEVINSASALWTRSKNEISEEQYIEFYKNLTHDFDAPLAWSHNRVEGNTEYTQ
HTPG_ALKEH      KAEAAETWETVNNTNALWMRPKSEISDDDYKAFYKHVAHDFDDPMVWLHNHVEGRQSYTS
HTPG_HALHL      SEAEAPQWEIVNRASALWMRPKSEISEEDYQELYKHVAHDFDDPLTWIHNHVEGRQSYVS
HTPG_NITOC      SEENGEEWEQINKATALWTLPKNDIKEEEYQAFYKHVAHDFEDPLAWTHNRVEGKLEYTS
HTPG_MAGMM      EPPKTPEWETVNKASALWTLSKNDITEDEYKEFYKHVGHDFEDPMEWVHARMEGRMEYTL
HTPG_METCA      --APAEVWETVNSASALWAKNRDEITDEAYDEFYKHVSHDFQEPLARVHSRVEGTNEYTL
HTPG_COXBR      DKNETPEEEVVNRANALWVLPKDKIKDEEYKELYKHIAHDFEDPLAWVHNKVEGKLEYTT
HTPG_COXBU      DKNETPEEEVVNRANALWVLPKDKIKDEEYKELYKHIAHDFEDPLAWVHNKVEGKLEYTT
HTPG_COXBN      DKNETPEEEVVNRANALWVLPKDKIKDEEYKELYKHIAHDFEDPLAWVHNKVEGKLEYTT
HTPG_HAEIN      -KECGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFVDPVTWAHNKVEGNQAYTS
HTPG_HAEIE      -KECGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFADPVTWAHNKVEGNQAYTS
HTPG_HAEI8      -KECGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFVDPVTWAHNKVEGNQAYTS
HTPG_HAEIG      -KECGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFSDPVTWAHNKVEGNQAYTS
HTPG_AGGAC      -KEIGEKWEKINKSDALWTRSKNEISDEEYKEFYKHLSHDFADPLLWAHNKVEGNQEYTS
HTPG_HAES1      -KETGIKWEKINKAQALWTRSKGEISDEEYKEFYKHLSHDFADPLLWTHNKVEGNQEYTS
HTPG_HISS2      -KETGIKWEKINKAQALWTRSKGEISDEEYKEFYKHLSHDFADPLLWTHNKVEGNQEYTS
HTPG_PASMU      -KETGIKWEKINKAQALWTRAKNEISEEEYQEFYKHLSHDFTDPLLWAHNKVEGNQEYTS
HTPG_ACTSZ      -KESDVKWEKINKAQALWTRAKGEISDEEYQEFYKHISHDFADPLVWQHNKVEGNQEYTS
HTPG_MANSM      -KESGVKWEKINKAQALWTRSKAEISDDEYKEFYKHISHDFADPLSWMHNKVEGNQEYTS
HTPG_ACTP2      -KASGQKWEKINKAQALWTRSKNEISDEEYQEFYKHLSHDYNDSLIWAHNKVEGKQEYTS
HTPG_ECOLI      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_ECOL5      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_ECOHS      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_ECOL6      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_SHIBS      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_SHISS      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_ECO57      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_ECOLC      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_ECOUT      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNEPLTWSHNRVEGKQEYTS
HTPG_ECOK1      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNEPLTWSHNRVEGKQEYTS
HTPG_ECO24      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_SHIFL      -GETVISWAKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_SHIDS      -GETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTS
HTPG_SALPB      -GETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_SALPA      -GETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_SALTY      -GETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_SALCH      -GETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_SALTI      -GETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_CITK8      -GETIVSWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_CROS8      -GETIVSWEKINKAQALWTRSKGEVSDDEYKAFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_KLEP7      -GETVISWEKINKAQALWTRSKSEVNDDEYKEFYKHIAHDYSDPLTWSHNRVEGKQEYTS
HTPG_ENT38      -GETVVSWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTS
HTPG_PECAS      -GESTVSWEKINKAQALWTRSKSEVSDDEYNEFYKHISHDFTDPLSWSHNRVEGKQEYTS
HTPG_YERPA      ----TVTWEKINKAQALWTRGKAEISDDEYKAFYKHIAHDFTDPLSWSHNRVEGKQEYTS
HTPG_YERPS      ----TVTWEKINKAQALWTRGKAEISDDEYKAFYKHIAHDFTDPLSWSHNRVEGKQEYTS
HTPG_YERPN      ----TVTWEKINKAQALWTRGKAEISDDEYKAFYKHIAHDFTDPLSWSHNRVEGKQEYTS
HTPG_YERPP      ----TVTWEKINKAQALWTRGKAEISDDEYKAFYKHIAHDFTDPLSWSHNRVEGKQEYTS
HTPG_YERPE      ----TVTWEKINKAQALWTRGKAEISDDEYKAFYKHIAHDFTDPLSWSHNRVEGKQEYTS
HTPG_YERE8      ----TVTWEKINKAQALWTRGKAEITDDEYKAFYKHIAHDFTDPLIWSHNRVEGKQEYTS
HTPG_SERP5      ----TVTWEKINKAQALWTRSKADVTDEEYKEFYKHIAHDFTDPLSWSHNRVEGKQEYTS
HTPG_PHOLL      --EDTVTWEKINKAQALWTRGKSEITDEEYKEFYKHISHDFTDPLIWSHNRVEGKQEYTS
HTPG_SODGM      -DEEVVTWEKINKAQALWTRNKADISDDEYKEFYKHLSHDFSEPLSWSHNRVEGKQEYTS
HTPG_BAUCH      -NNNIITWEQINKAQALWTRNKVDVSDQEYKDFYKHLYHDSNDPISWSHNRVEGQQEYTS
HTPG_VIBCH      -ATEETKWEQINKAQALWTRAKSEVTDEEYKEFYKHVSHDFADPLVWSHNKVEGKNDYTS
HTPG_VIBC3      -ATEETKWEQINKAQALWTRAKSEVTDEEYKEFYKHVSHDFADPLVWSHNKVEGKNDYTS
HTPG_VIBPA      -ETDEKKWEQINKAQALWTRNKADISDEEYQEFYKHVSHDFADPLVWSHNRVEGKNDYTS
HTPG_VIBCB      -ETGEKKWEQINKAQALWTRNKSEISEEEYQEFYKHVSHDFADPLTWSHNRVEGKNDYTS
HTPG_VIBVY      -ETEEVKWEQINKAQALWTRNKSDISDEEYQEFYKHVSHDFADPLLWSHNRVEGKNDYTS
HTPG_VIBVU      -ETEEVKWEQINKAQALWTRNKSDISDEEYQEFYKHVSHDFADPLLWSHNRVEGKNDYTS
HTPG_ALIF1      -DK-EGKWEQVNKAQALWTRSKSDIEDAEYQEFYKHVSHDFADPLTWSHNKVEGKNDYTS
HTPG_PHOPR      -PT-GSKWEQINKAQALWTRNKSEITEEEYKEFYNHVSHDFAEPLTWSHNRVEGTQDYTS
HTPG_AERHH      IVGTPGEWEQVNRATALWTRNPKEIKDEEYQEFYKHVAHDFEDPLLWGHNRVEGAQEYTS
HTPG_AERS4      VVGTPGEWEQVNRATALWTRNPKEIKDEEYQEFYKHVAHDFEDPLLWGHNRVEGAQEYTS
HTPG_PSEHT      IPAVPGEWESINRATALWTRDKSELSDDEYKEFYKHVSLDWEDPLSWAHNKVEGKTEYTS
HTPG_COLP3      VDAIPALWEPVNKATALWTREKADITDEEYKEFYKHVSHDFGDPLLWEHNRVEGKTEYTS
HTPG_PSEA6      VPAQPAKWEAVNKATALWTRDKSEVSDEEYKEFYKHISHDFADPLVWSHNKVEGKTEYNS
HTPG_IDILO      VEGQPGEWETVNSGQALWTREKSDITDEEYKEFYKTVAHDFDEPLLWSHNKVEGTTEYTN
HTPG_PSYIN      VPATEATWEAVNKATALWSCSKSELKDEEYKEFYKHIANDFEDPLTWSHNKVEGEQAYTS
HTPG_SHEPA      VAATEGSWKPMNKATALWTRNKSDVSDEEYQEFYKHISHDFTDPLLWSHNRVEGKQEYTS
HTPG_SHEHH      IPATEGHWKLMNKATALWTRNKSDVSDEEYQEFYKYISHDFTDPLLWSHNRVEGKQEYTS
HTPG_SHESH      VAATDGQWQSMNKATALWTRNKSDVSKEEYEEFYKHISHDFTDPLLWSHNRVEGKQEYTS
HTPG_SHELP      IPATEGHWKAMNKATALWTRNKSDVTDEEYQEFYKHISHDFADPLLWSHNRVEGKQEYTS
HTPG_SHEPC      IPATEGYWKVMNKATALWMRNKSEISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHESW      IPATEGYWKVMNKATALWMRNKSEISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHESM      IPATEGYWKVMNKATALWMRNKSEISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHESR      IPATEGYWKVMNKATALWMRNKSEISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHESA      IPATEGYWKVMNKATALWMRNKSEISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHEON      IPATEGYWKAMNKATALWMRNKSEITDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHEB9      IPATEGQWKVMNKATALWMRSKADISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHEB8      IPATEGQWKVMNKATALWMRSKADISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHEB5      IPATEGQWKVMNKATALWMRSKADISDEEYQEFYKHISHDYTDALLWSHNRVEGKQEYTN
HTPG_SHEDO      IAAVEGQWKPMNKATALWTRNKSDISDEEYQEFYKHISHDYTDALKWSHNRVEGKQEYTS
HTPG_SHEFN      VAATEGEWKVMNKATALWTRNKSDITEEEYQEFYKHISHDYSDALKWSHNRVEGKQEYTS
HTPG_SHEAM      IPATEGQWKAMNKATALWTRSKSDVSDEEYKEFYKHISHDFADPLDWSHNKVEGNQEYTS
HTPG_BUCAI      ---KTYFWEQINKAKALWTLNKSSITEEEYKDFYKHLTNDQNDPLIWSHNHVEGNQEYIS
HTPG_BUCAP      ---KIYFWEKINKAKALWTQNKATISEKEYQEFYKHLTNDQNNPLFWSHNHVEGINEYIS
HTPG_BUCBP      ---KTYFWKQINQAEAIWTRPKSEITELQYKNFYKKIANDTNDPLTWTHNKVEGNQEYTI
HTPG_BUCCC      ---KTISWEKINKAQALWTINKNNITKKKYQDFYKYLTNDSEKPLLWSHNKVEGTQEYIN
HTPG_WIGBR      EEKKSYTWKQINTGKSLWSKKKSEIKDIEYKEFYKNFFNDNYDPLIWSHNHVEGKQEYVS
HTPG_LEGPH      ----SKEFETVNKATALWTLQKSEISEEDYKQLYKHISHDYMDPLTWSHNHVEGKHEYIT
HTPG_LEGPC      ----SKEFETVNKATALWTLQKSEISEEDYKQLYKHISHDYMDPLTWSHNHVEGKHEYIT
HTPG_LEGPL      ----SKEFETVNKATALWTLQKSEIGEEDYKQLYKHISHDYMDPLTWSHNHVEGKHEYIT
HTPG_LEGPA      ----SKEFETVNKATALWTLQKSEISEEEYKQLYKHISHDYMDPLTWSHNHVEGKHEYIT
HTPG_PSEAE      --PAEPEWETVNRASALWTRPRAEVKDEEYQEFYKHVAHDFENPLSWSHNKVEGKLEYTS
HTPG_PSEA7      --PAEPEWETVNRASALWTRPRAEVKDEEYQEFYKHVAHDFENPLSWSHNKVEGKLEYTS
HTPG_PSEMY      --PAEVEWETVNRASALWTRPRAEVKDEEYQEFYKHVAHDFENPLTWSHNKVEGKLEYTS
HTPG_PSEPF      --KPEVEWETVNRASALWTRPRTEVKDEEYQEFYKHIAHDFENPLSWSHNKVEGKLEYSS
HTPG_PSEF5      --KPALEWETVNRASALWTRPRTEIKDEEYQEFYKHIAHDFENPLSWSHNKVEGKLEYSS
HTPG_PSEU2      --PAALEWETVNRASALWTRPRTEVKDEEYQEFYKHVAHDYENPLSWSHNKVEGKLEYTS
HTPG_PSE14      --VPALEWETVNRASALWTRPRTEVKDEEYQEFYKHVAHDYENPLSWSHNKVEGKLEYTS
HTPG_PSESM      --APAQEWETVNRASALWTRPRTEVKDEEYQEFYKHVAHDYENPLSWSHNKVEGKLEYTS
HTPG_PSEPK      --QPAEEWETVNRASALWTRSRTEVKDEEYQEFYKHIGHDFENPLAWSHNKVEGKLEYNS
HTPG_XANC5      --PAEPEWEAVNRASALWTRPKSEIKDEEYQEFYKHIAHDAGNPLAWSHNKVEGKLEYTS
HTPG_XANAC      --PAEPEWEAVNRASALWTRPKSEIKDEEYQEFYKHVAHDAGNPLAWSHNKVEGKLEYTS
HTPG_XANOM      --PAEPEWEAVNRASALWTRPKSEIKDEEYQEFYKHIAHDAGNPLAWSHNKVEGKLEYTS
HTPG_XANOR      --PAEPEWEAVNRASALWTRPKSEIKDEEYQEFYKHIAHDAGNPLAWSHNKVEGKLEYTS
HTPG_XANCP      --PAEPEWEVVNRASALWTRPKSEIKDEEYQEFYKHVAHDAGNPLAWSHNKVEGKLDYTS
HTPG_XANC8      --PAEPEWEVVNRASALWTRPKSEIKDEEYQEFYKHVAHDAGNPLAWSHNKVEGKLDYTS
HTPG_XYLFA      --PKEAEWEAVNKASALWTRPKNDIKDEEYQEFYKHISHDMTNPLAWSHNKVEGKLEYTS
HTPG_XYLFT      --PQEAEWEAVNKASALWTRPKNDIKDEEYQEFYKHISHDMTNPLAWSHNKVEGKLEYTS
HTPG_SACD2      --KAEVEYEVINTAKALWARSRSDVTDEEYKEFYKHVSHDYTDPLSWSHNRVEGKLDYTS
HTPG_MARHV      --------ETVNDATALWTLPRTEIKDEEYKEFYKHIAHDFEDPLTWSHNKVEGKLDYTS
HTPG_HAHCH      --EPAPEFESVNEATALWTLPRNEIKDEDYKEFYKHIAHDFSDPLLWAHNRVEGKLDYTS
HTPG_MARMS      --NKAPEYEAVNSAKALWTRPRNEVTDEEYQEFYKHISHDYQEPLKWSHNKVEGKLEYSS
HTPG_CHRSD      --SETVTWETVNEATALWVRPKEEISDDEYKAFYKHVAHDFSDPLTWSHNKVEGKLEYTS
HTPG_ALCBS      ----DTKTETLNSATALWQRPRSEVTDEEYQSFYKHISHDFQDALTWSHNKVEGKLEYTS
HTPG_RUTMC      KDIE---YERINKANAFWSQDKRDLKQENYDEFYKSLTYDFEAPLTQLHNRVEGNIDYTS
HTPG_VESOH      KDIE---YERINKANAFWAQDKQDLKQKDYDEFYKSLTYDLEAPLTQLHNRVEGNIDYTS
HTPG_HYDCU      KETEEKSLEQVNKATAIWTQPKSELSDEDYNNFYQTISHDYENPLAHIHNKVEGTLEYTS
HTPG_FRAT1      KQTVKDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_FRATT      KQTVKDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_FRATW      KQTVKDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_FRATN      KQTVKDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_FRATF      KQTVKDEYETVNNTKAIWLRSKGEVTNEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_FRATH      KQTVKDEYETVNNTKAIWLRSKGEVTNEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_FRAP2      KQIIKDEYETVNNTKAIWLRSKDEVTDEEYQEFYKYISHDFADALMWIHNKVEGNLEYNS
HTPG_PELLD      --------KQLNSITALWQRPKSELKQEEVNEFYKFISNDFNEPLDYLHVSVEGAVSFKA
HTPG_CHLPM      --------KQLNSVTALWQRPKSELQEGDVHEFYKFISNDFEDPLDYLSVSVEGAVSFKA
HTPG_CHLCH      --------RQLNSMTALWQRPKSELKDEEVNEFYKFVASDFNDPLDYLSISVEGMVSFKA
HTPG_CHLPD      --------NQINTISALWQRSKNEVSDEERNEFYKFLSNDFNPPLDSLHLSVEGKVCFKA
HTPG_CHLTE      --------RQINSMTALWQRPKSELKQEEVNEFYKFIANDFKDPLDYLHVSVEGAVSFKA
HTPG_DESHY      --------EKINTVQALWTKNKNEISEEEYKEFYKYIANAYDEPLMRMHFSSDAPINLNA
HTPG_DESPS      --------EVVNTVQALWSRSKSEISDEEYNEFYKFIGNATEDPSYRLHFSADAPLSIKS
HTPG_DESAG      --------EHVNTTPALWREPRFQVTEEQYKDFYTFLTFDTQAPMDTIHLSIDAPVQFTS
HTPG_DESVH      --------EQVNTTPALWREPKFSITDEQYADFYKHLTFDTEAPLRTLHVSVDAPVQFTG
HTPG_BACFR      KQVETAEDNVINDTIPLWTKKPSELSDEDYKKFYRELYPMSDEPLFWIHLNVDYPFHLTG
HTPG_BACFN      KQVETAEDNVINDTIPLWTKKPSELSDEDYKKFYRELYPMSDEPLFWIHLNVDYPFHLTG
HTPG_BACTN      KQIETTEDNIINDTTPLWTRKPSELSDEDYKSFYTKLYPMSDEPLFWIHLNVDYPFHLTG
HTPG_PORGI      KMQDTDEDNQINDTHPAWTKKPADLKDEDYKEFYRSLYPMSEEPLFWIHLNVDYPFNLTG
                               . *      :        :         .        :       

HTPG_BACSU      ILFVPENMPFDYYSKEYEK---GLELYSNGVLIMNKCADLLPDHFSFVKGMVDSEDLSLN
HTPG_BACVZ      ILFIPENMPFDYYTKEFEK---GLELYSNGVLIMNKCADLLPDHFSFVKGMVDSEDLSLN
HTPG_BACLD      ILFIPENIPFNYYTKEFEK---GLELYSNGVLIMEKCPDLLPDHFSFVKGMVDSEDLSLN
HTPG_BACHD      ILFIPENIPFDYYTKEFEK---GLELYSNGVLIMEKCPDLLPDYYSFVKGMVDSEDLSLN
HTPG_BACSK      ILFIPEHTPFDYYSKEYEK---GLELYANGVLIMEKCAELLPDYFSFVKGMVDSEDLSLN
HTPG_OCEIH      ILFIPESAPFNYYTRDYEK---GLELYSNGVLIMDKCADLLPDYFSFVKGMVDSEDLSLN
HTPG_CLOBH      ILFIPETTPYDFYTKEYEK---GLELYSSGVLIMNKCGDLLPDYFGFVKGIVDSEDLSLN
HTPG_CLOB1      ILFIPETTPYDFYTKEYEK---GLELYSSGVLIMNKCGDLLPDYFGFVKGIVDSEDLSLN
HTPG_CLOBL      ILFIPETTPYDFYTKEYEK---GLELYSSGVLIMNKCGDLLPDYFGFVKGIVDSEDLSLN
HTPG_ALKMQ      ILFIPEKIPYDFYTKEYEK---GLELYSSGVLIMNKCSDLLPDYFSFVKGMVDSEDLSLN
HTPG_ALKOO      ILFIPERTPFDYYTKEYEK---GLELYSNGVLIMNKCSDLLPDYFSFVKGMVDSEDLSLN
HTPG_CLOP1      ILYIPENIPYDYYTKEYEK---GLELYSNGVLIMEKCSELLPDYFGFVKGIVDSQDLSLN
HTPG_CLOPE      ILYIPENIPYDYYTKEYEK---GLELYSNGVLIMEKCSELLPDYFGFVKGIVDSQDLSLN
HTPG_CLOPS      ILYIPENIPYDYYTKEYEK---GLELYSNGVLIMEKCSELLPDYFGFVKGIVDSQDLSLN
HTPG_CLOAB      LLFIPASAPYDFYTKEFEK---GLELYSNGVMIMQKCGDLLPDYFSFVQGLVDSPDLSLN
HTPG_CLOTE      LLFIPSTTPYDFYTRNFEK---GLELYSNGVLIMEKCADLLPDYFSFVQGLVDSEDLSLN
HTPG_FUSNN      LLFIPKKLPFDYYTKNFKR---GLQLYTKNVFIMEKCEDLIPEYFNFISGLVDCDSLSLN
HTPG_RHIME      LAFVPGSKPFDLFDPDRKG---RMKLYVKRVFITDEA-ELLPRYLRFVRGLVDTADLPLN
HTPG_RHIEC      LAFVPGTQPFDMFDPERKG---RMKLYVKRVFITDDA-ELMPRYLRFVRGLIDTADLPLN
HTPG_NITWN      LLFVPQTRPFDLFEPDKKR---QLKLYVRRVFITEDA-DLLPRYLRFVRGVVDSADLPLN
HTPG_NITHX      LLFVPQTRSFDLFETDRKG---PIKLYVKRVFITDDA-DLLPRYLRFVRGVVDSADLPLN
HTPG_AZOC5      LVFVPSTKPFDLFEPERTG---RVKLYVKRVFITDDA-ELLPRYLRFVRGVVDSADLPLN
HTPG_RHILO      LAFVPGSRPFDLFDQDRKG---RMKLYVRRVFITDDA-DLLPRYLRFVRGLVDSADLPLN
HTPG_RHOP2      LLFAPSTKPFDLFEPERKG---RVKLYVRRVFITADA-DLLPPYLRFLRGVIDSEDLPLN
HTPG_RHOPS      LLFAPATKPFDLFEPERKG---RIKLYVRRVFITADA-DLLPPYLRFLRGVIDSEDLPLN
HTPG_RHOPA      LLFAPSTKPFDLFEPERKG---KIKLYVRRVFITSEA-ELLPPYLRFLRGVIDSEDLPLN
HTPG_RHOP5      MLFAPSTKPFDLFEPQRKG---HVKLYVRRVFITDDA-DLLPAYLRFIRGVIDSEDLPLN
HTPG_RHOPB      LLFAPSTKPFDLFEPARKG---RVKLYVRRVFITDEA-DLLPSYLRFIRGVIDSEDLPLN
HTPG_BRADU      LLFAPSTKPFDLFEPSRKG---RVRLYVRRVFITDDA-DLLPGYLRFIRGVVDSEDLPLN
HTPG_GLUOX      LLFLPSARPFDFMEQSRES---RIHLHVRRMFITDEA-ELVPNWMRFVQGVVDTEDLPLN
HTPG_MAGSA      LLFIPSSKPLDIFHPDRKQ---HVKLYVRRVFITDDCEELLPPYLRFVRGVVDSQDLPLN
HTPG_RHORT      LLFVPGQQPFDLFTQDRKP---RVKLYVNRVFITDDCEELLPSYLRFVRGVVDSSDLPLN
HTPG_ROSDO      LLYVPSMAPFDLYEAERKS---HVKLYVNRVFISDNTRDLIPAYLRFLRGVVDSQDLSLN
HTPG_RICRS      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICRO      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICCN      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICFE      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICAH      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICCK      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICBR      LLFIPSSKTYDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICB8      LLFIPSSKTYDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICTY      LLFIPSSKTFDLFHPDRKR---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_RICPR      LLFIPSSKTFDLFHPDRKK---RVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLN
HTPG_ORITB      LLFIPSSKTFDLFHPDRKS---RVKLYIKKVFITDENVALIPKYMRFLRGVVDSEDLSLN
HTPG_EHRCJ      LLYIPSIKPFDLFHPDRKC---SVKLYVNKVFITEDNVQIIPQYLRFLKGIIDSSDLPLN
HTPG_EHRCR      LLYIPSIKPFDLFHPDRKC---SVKLYVNKVFITEDNVQIIPQYLRFLKGIIDSSDLPLN
HTPG_EHRRW      LLYIPSIKPFDLFHPDRKC---SVKLYVNKVFITEDNVQIIPQYLRFLKGIIDSSDLPLN
HTPG_EHRRG      LLYIPSIKPFDLFHPDRKC---SVKLYVNKVFITEDNVQIIPQYLRFLKGIIDSSDLPLN
HTPG_WOLPM      LLYVPSIKPFDLFHPDRRC---SVKLYVNKVFITEDNVQIIPQYLRFLKGIVDSPDLPLN
HTPG_WOLTR      LLYVPSIKPFDLFHPDRRC---SVKLYVNKVFITEDNVQIIPQYLRFLKGVVDSPDLPLN
HTPG_ANAPZ      LLYIPSVKPFDLFHPDRRC---SVKLYVNRVFITEDNVQIIPQYLRFIRGVIDSSDLPLN
HTPG_ANAMM      LLYVPSVKPFDLFHPDRRC---SVKLYVNRVFITEDNVQVIPQYMRFLRGVIDSSDLPLN
HTPG_NEOSM      LLYVPSIKPFDLYNPDRRA---SVKLYIKKVFITEENVQLIPQYLRFLKGVVDCADLPLN
HTPG_TREDE      LFYVPSKAPFDMFHADYRP---GVKLFVKRVFITDDEKELLPTYLRFVRGVIDSEDLPLN
HTPG_TREPA      LFYVPAKAPFDLFHADYKP---GVKLFVKRVFITDDEKELLPVYLRFVRGVIDSEDLPLN
HTPG_HELPH      LFYIPSKAPFDMFRVDYKS---GVKLYVKRVFITDDDKELLPSYLRFVKGVIDSEDLPLN
HTPG_HELPJ      LFYIPSKAPFDLFRVDYKS---GVKLYVKRVFITDDDKELLPSYLRFVKGVIDSEDLPLN
HTPG_HELPY      LFYIPSTAPFDMFRVDYKS---GVKLYVKRVFITDDDKELLPSYLRFVKGVIDSEDLPLN
HTPG_HELAH      LFYIPSVAPFDMFRVDYKS---GVKLYVKRVFITDDDKELLPSYLRFIKGVIDSEDLPLN
HTPG_HELHP      LFYIPQKAPFDLFRVDYQS---GVKLYVKRVFITDDDKELLPPYLRFVRGVIDSEDLPLN
HTPG_WOLSU      LFYLPSKAPFDLYRVDYRS---GVKLYVKRVFITDDDKELLPSYLRFVRGIIDSEDLPLN
HTPG_CAMJJ      LFFIPQNAPFDLFRVDYQS---GLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLN
HTPG_CAMJ8      LFFIPQNAPFDLFRVDYQS---GLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLN
HTPG_CAMJR      LFFIPQNAPFDLFRVDYQS---GLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLN
HTPG_CAMJE      LFFIPQNAPFDLFRVDYQS---GLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLN
HTPG_CAMJD      LFFIPQNAPFDLFRVDYQS---GLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLN
HTPG_CAMHC      LFFVPSVQPFDLFRVDYQS---GVKLYVKRVFITDDAKELLPPYLRFVRGIIDIEDLPLN
HTPG_SULNB      LFYIPKKAPMDLYRADYQP---GVKLYVKRVFITDDDKELLPPYLRFVRGIIDSEDLPLN
HTPG_ARCB4      LFYIPKIAPMDMYRADFQS---GVKLYVKRVFITDDEKELLPTYLRFVRGIIDSEDLPLN
HTPG_BORBP      LFYIPSKAPYDLYYPNTKP---GVKLFINRIFITDSEGSLLPNYLRFIKGIIDCQDLPLN
HTPG_BORBU      LFYVPSKAPYDLYYPNTKP---GVKLFINRIFITDSEGSLLPNYLRFIKGIIDCQDLPLN
HTPG_BORAP      LFYIPSKAPYDLYYPNTKP---GVKLFINRIFITDSEGSLLPNYLRFIKGIIDCQDLPLN
HTPG_SULDN      LFYIPSKAPMDMYRVDYQT---GIKLYINRVFITDDEKELMPTYLRFLRGVIDSKDLPLN
HTPG_MYCTA      LLFIPSHAPFDLFDRDAHV---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCBO      LLFIPSHAPFDLFDRDAHV---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCBP      LLFIPSHAPFDLFDRDAHV---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCTU      LLFIPSHAPFDLFDRDAHV---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCA1      LLFIPSHAPFDLFNRDAHT---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCPA      LLFIPSHAPFDLFNRDAHT---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCUA      LLFIPSHAQHDLFNRDAVF---GIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN
HTPG_MYCLE      LLFIPSHAPFDLFNSDAKI---GMQLYVKRVFIMSDCDQLMPMYLRFVKGVVDAEDMSLN
HTPG_MYCGI      LLFIPSHAPFDLFQQNATV---GVQLYVKRVFIMGDCDQLMPPYLRFVKGVVDAQDMSLN
HTPG_MYCVP      LLFIPSHAPFDLFNQNAAV---GVQLYVKRVFIMGDCDQLMPPYLRFVKGVVDAQDMSLN
HTPG_RHOJR      LLFIPSHAPFDLFMRDGKT---GVQLYVKRVFIMDDCDQLMPEYLRFVKGVVDAQDLSLN
HTPG_NOCFA      LLFLPSQAPFDLFTREHKR---GVQLYVKRVFIMDNCEELMPEYLRFVKGVVDAQDLSLN
HTPG_SALTO      LLFLPTHAPLDLFSPQGRR---GVQLYVKRVFIMDDCEALMPGYLRFVKGVVDAHDLSLN
HTPG_SALAI      LLFLPTHAPLDLFSPQGRR---GVQLYVKRVFIMDDCEALMPGYLRFVKGVVDAHDLSLN
HTPG_FRACC      LLFIPSRAPLDLFTRDARR---GVQLYVKRVFIMDDCAELLPNYLRFVRGVVDTHDLSLN
HTPG_STRCO      LLFVPSHAPHDLFTQGYQR---GVQLYVKRVFIMDDCEELLPPHLRFVKGVVDAQDLSLN
HTPG_GEOSL      LLYLPAHKPFDLFMPERKK---GVQLYVRRVFITDSCEQLLPDYLRFVKGVVDSSDLPLN
HTPG_GEOMG      LLYLPAHKPFDLFMPERKK---GVQLYVRRVFITDSCEQLIPDYLRFVKGVVDSSDLPLN
HTPG_GEOUR      LIYIPSHKPFDLFMRDHKK---GVHLYVKRVFITDNCEALLPDYLRFMKGVVDSSDLPLN
HTPG_PELPD      LIYLPAKKPFDLFMADRKK---GLQLYVKRVFITDRCEELLPDYLRFVKGVVDSSDLPLN
HTPG_BDEBA      LLYVPGKKPWNYNMRDMEY---GLSLYIKRVFIMADCKDLLPPYLRFVKGLVDSSDLSLN
HTPG_MYXXD      LLFVPKQPPFDLDAQQ-QR---GVRLFVKRVFIMDRCEELVPQWLRFVRGVIDSDDLPLN
HTPG_METFK      LLYIPSKAPFDLYDRERQH---GIKLYVKRVFIMDDAEQLMPQYLRFVRGVIDSADLPLN
HTPG_THIDA      LLYVPSHAPFDLYDREKRH---GIKLYVRRVFIMDDAEQLMPQYLRFVRGVIDSADLPLN
HTPG_CHRVO      LLYIPSRAPFDLYDRERKQ---GVKLYVRRVFIMEDTEKLMPHYLRFVRGVIDSNDLPLN
HTPG_DECAR      LLYIPARAPFDLWDRNARH---GIKLYVRRVFIMDDAEQLMPLYMRFVRGVVDSSDLPLN
HTPG_AROAE      LLYIPSHAPFDMWDRNARH---GIKLYVKRVFIMDDAEKLMPAYLRFVRGVVDSSDLPLN
HTPG_NITEC      LLYIPAHAPFDLFDREHRH---GLKLYIKRVFIMDDAEKLLPGYLRFVRGIIDSNDLPLN
HTPG_NITEU      LLYIPAHAPFDLFDREHRH---GLKLYVRRVFIMDDAEKLLPGYLRFVRGIIDSSDLPLN
HTPG_NITMU      LLYVPSRAPFDLYDRESRH---GIKLYVRRVFIMDDAKQLLPNYLRFVRGIIDSNDLPLN
HTPG_BORBR      LLYVPKHAPFDLWDRDARR---GVKLYVKRVFIMDDAEQLLPSYLRFVRGVIDSADLPLN
HTPG_BORPA      LLYVPRHAPFDLWDRDARR---GVKLYVKRVFIMDDAEQLLPSYLRFVRGVIDSADLPLN
HTPG_BORPE      LLYVPKHAPFDLWDRDARR---GVKLYVKRVFIMDDAEQLLPSYLRFVRGVIDSADLPLN
HTPG_BORA1      LLYVPRQAPFDLWDRDARR---GVKLYVKRVFIMDDAEQLLPAYLRFVRGVIDSADLPLN
HTPG_BURPS      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURMA      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURM7      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURP1      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURM9      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURMS      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURP0      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURP6      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURTA      LLFVPSHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLN
HTPG_BURCA      LLFVPAHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFVKGVVDSADLPLN
HTPG_BURCH      LLFVPAHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFVKGVVDSADLPLN
HTPG_BURCM      LLFVPAHAPFDLWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFVKGVVDSADLPLN
HTPG_BURL3      LLFVPSHAPFDMWNRDYRG---GLKLYVKRVFIMDDAEQLLPQYLRFVKGVVDSADLPLN
HTPG_PARXL      LLYVPTHAPFDMFNRDHRG---GLKLYVKRVFIMDDAEQLLPAYLRFVKGVVDSADLPLN
HTPG_CUPNH      LLYIPARAPFDLWDRNHKA---GLKLYVKRVFIMDDADQLLPGYLRWVKGVVDSADLPLN
HTPG_CUPPJ      LLYIPARAPFDLWDRNHKH---GLKLYVKRVFIMDDAEQLLPSYLRWVKGVIDSADLPLN
HTPG_CUPMC      LLYIPARAPFDLWDRNHKA---GLKLYVKRVFIMDDADQLLPAYLRWVKGVVDSADLPLN
HTPG_RALSO      LLYLPTNAPFDLWDRERRS---GLKLYVKRVFIMDDAEQLLPAYLRFVKGVIDSADLPLN
HTPG_ACISJ      LLYIPAKAPFDLWNRDKKA---GVKLYVKRVFIMDDAESLMPSYLRFVKGVIDSADLPLN
HTPG_VEREI      LLYIPAKAPFDLWNRDKKA---GVKLYVKRVFIMDDAEALLPTYLRFVKGVIDSADLPLN
HTPG_RHOFT      LLYLPSKAPMDLFNREKSA---GVKLYVKRVFIMDDAEALLPTYLRFVKGVVDSADLPLN
HTPG_POLNA      LLFIPAKAPMDMYNRDKAA---GVKLYVKRVFIMDDAQALLPTYLRFVKGVVDSSDLPLN
HTPG_POLSJ      LLFIPAKAPMDLFNRDKAA---GVKLYVRRVFIMDDAQALMPTYLRFVKGVVDSADLPLN
HTPG_METPP      LLYLPAKAPHDLWNRDRQG---GIKLYVKRVFIMDDAQALMPSYLRFVKGVIDSSDLPLN
HTPG_PSYCK      LLYIPKKAPVDLYTREQQH---GLKLYVKRVFIMDEAEQLLPMYLRFVKGVIDSADLPLN
HTPG_PSYA2      LLYIPKKAPVDLYTREQQH---GLKLYVKRVFIMDDAEQLLPMYLRFVKGVIDSADLPLN
HTPG_ACIAD      LLYIPAKASSDIFTREAKA---GIKLYVKRVFIMDDADNLIPNYLRFVKGVIDSADLPLN
HTPG_ALKEH      LLYIPKNPPFDLYEREPAH---GIKLYVRRVFIMEDTEKLMPRYLRFVRGLVDSDDLPLN
HTPG_HALHL      LLYIPKRPPFDLYEQKPAH---GVKLYVRRVFITEDTEHLLPRYLRFVRGVIDSDDLPLN
HTPG_NITOC      LLFIPPRAPFDLWERDRTQ---GIKLYVQRVFIMDDTEQLMPRYLRFVRGVVDSNDLPLN
HTPG_MAGMM      LLYIPGRAPFDLWDRDRRG---GLKLFVRRVFIMDTSEELLPRYLRFVRGVIDSADLPLN
HTPG_METCA      LLYIPKHAPFDLWDRDSKR---GVKLYVRKVFIMEDSDKLMPRYLRFVRGVIDSDSLPLN
HTPG_COXBR      LLYIPARAPFDLWNREGQR---GLKLYVKRIFIMDDAEHFMPMYLRFVKGIVDSNDLPLN
HTPG_COXBU      LLYIPARAPFDLWNREGQR---GLKLYVKRIFIMDDAEHFMPMYLRFVKGIVDSNDLPLN
HTPG_COXBN      LLYIPARAPFDIWNREGQR---GLKLYVKRIFIMDDAEHFMPMYLRFVKGIVDSNDLPLN
HTPG_HAEIN      LLYVPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFIPNYLRFMRGLIDSNDLPLN
HTPG_HAEIE      LLYVPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLN
HTPG_HAEI8      LLYVPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLN
HTPG_HAEIG      LLYVPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLN
HTPG_AGGAC      LLYVPSKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLN
HTPG_HAES1      LLYVPSKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLN
HTPG_HISS2      LLYVPSKAPWDLFNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLN
HTPG_PASMU      LLYVPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAQVFMPNYLRFMRGLLDSNDLPLN
HTPG_ACTSZ      LLYVPSKAPWDLFNREQKH---GLKLYVQRVFIMDDAEVFMPNYLRFMRGLLDSNDLPLN
HTPG_MANSM      LLYVPGKAPWDLFNREQKH---GLKLYVQRVFIMDDAEVFMPNYLRFMRGLLDSNDLPLN
HTPG_ACTP2      LLYVPAKAPWDLFNRDQKH---GLKLYVQRVFIMDDAEVFMPNYLRFMRGLLDTNDLPLN
HTPG_ECOLI      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECOL5      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECOHS      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECOL6      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_SHIBS      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_SHISS      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECO57      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECOLC      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECOUT      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECOK1      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_ECO24      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_SHIFL      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLN
HTPG_SHIDS      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLSLN
HTPG_SALPB      LLYIPSQAPWDLWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_SALPA      LLYIPSQAPWDLWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_SALTY      LLYIPSQAPWDLWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_SALCH      LLYIPSQAPWDLWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_SALTI      LLYIPSQAPWDLWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_CITK8      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_CROS8      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_KLEP7      LLYIPSQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_ENT38      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFTRGLIDSNDLPLN
HTPG_PECAS      LLYIPAHAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_YERPA      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDEAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_YERPS      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDEAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_YERPN      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDEAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_YERPP      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDEAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_YERPE      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDEAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_YERE8      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_SERP5      LLYIPAQAPWDMWNRDHKH---GLKLYVQRVFIMDEAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_PHOLL      MLYIPSQAPWDMWNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLN
HTPG_SODGM      LLYIPAKAPWDMWNREHKH---GLKLYVQRVFIMDDAEQFMPNYLRFVKGLIDSNDLPLN
HTPG_BAUCH      LLYIPASASWGIWNRDHKY---GLKLYIKRVLIMDHADYFLPNYLRFVKGIIDCNDLPLN
HTPG_VIBCH      LLYIPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAAQFMPSYLRFVRGLIDSNDLPLN
HTPG_VIBC3      LLYIPAKAPWDLFNREHKH---GLKLYVQRVFIMDDAAQFMPSYLRFVRGLIDSNDLPLN
HTPG_VIBPA      LLYIPSKAPWDMMNRDHKS---GLKLYVQRVFIMDDAEQFMPSYLRFVRGLIDSNDLPLN
HTPG_VIBCB      LLYIPAKAPWDMMNRDHKS---GLKLYVQRVFIMDDAEQFMPSYMRFVRGLIDSNDLPLN
HTPG_VIBVY      LLYIPSKAPWDMMNRDHKS---GLKLYVQRVFIMDDAEQFMPSYLRFVRGLIDSNDLPLN
HTPG_VIBVU      LLYIPSKAPWDMMNRDHKS---GLKLYVQRVFIMDDAEQFMPSYLRFVRGLIDSNDLPLN
HTPG_ALIF1      LLYIPAKAPFDMMNRDHKS---GLKLYVQRVFIMDDAEQFMPTYLRFVKGLIDSNDLPLN
HTPG_PHOPR      LLYVPSKAPWDMNNRDSKH---GLKLYVQRVFIMDDAQQFMPSYLRFMRGLIDSNDLPLN
HTPG_AERHH      LLYVPARAPFDLYNRDQKH---GLKLYVQRVFIMDDAEQFMPAYLRFVKGVLDSNDLPLN
HTPG_AERS4      LLYVPARAPFDLYNREQKH---GLKLYVQRVFIMDDAEQFMPTYLRFVKGVLDSNDLPLN
HTPG_PSEHT      LLYIPKKAPFDLWNRDRQS---GLKLYVQRVFIMDDAEQFMPSYLRFVKGLLDSNDLPLN
HTPG_COLP3      LLYVPTKAPFDMYNREKQH---GLKLFVQRVFIMDDAEQFMPTYLRFVKGLLDSNDLPLN
HTPG_PSEA6      LLYIPAKAPFDMWNRDQKH---GLKLYVQRVFIMDDAEQFMPTYLRFVKGLLDSNDLPLN
HTPG_IDILO      LLYIPKRAPWDLWNREQQH---GVKLYVKRVFIMDDAEQLMPTYLRFVRGLVDSNDLPLN
HTPG_PSYIN      LLYIPKRAPYDLWNREKAH---GLKLYVQRVFVMDDAEQFMPTYLRFVKGVLDSNDLPLN
HTPG_SHEPA      LLYIPAKAPWDMWNRDRKH---GLKLFVQRVFVMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEHH      LLYIPAKAPWDMWNRDRKH---GLKLFVQRVFVMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHESH      LLYIPSKAPWDMWNRDRKH---GLKLFVQRVFVMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHELP      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFVMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEPC      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHESW      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHESM      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHESR      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHESA      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEON      LLYIPSKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEB9      LLYIPAKAPWDMWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEB8      LLYIPAKAPWDMWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEB5      LLYIPAKAPWDMWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_SHEDO      LLYIPAKAPWDMWNRDHKH---GLKLFVQRVFIMDEAEQFLPNYLRFVRGLLDSNDLPLN
HTPG_SHEFN      LLYIPAKAPWDMWNRDHKH---GLKLFVQRVFIMDEAEQFLPTYLRFVRGLIDSNDLPLN
HTPG_SHEAM      LLYIPAKAPWDLWNRDRKH---GLKLFVQRVFIMDDAEQFMPSYLRFVQGLIDSNDLPLN
HTPG_BUCAI      LLYIPEKAAWDIWNRDNKH---GLKLYVKRVYIMDNSQAFLPNYLRFIKGLIDSSDLPLN
HTPG_BUCAP      LLFIPEKAAWDIWNRDNKS---GLKLYVKRVYIMDNSQAFLPNYLRFIRGLIDSNNLPLN
HTPG_BUCBP      LLFIPSKSAWDIWNRDNKH---GLKLYVKRVYIMDDAEQFLPNYLRFVKGIIDSNDLPLN
HTPG_BUCCC      LLYIPKKATWDIWHQENKH---GLKLYVKHVFIMDEATQFLPNYLRFVKGIIDSQDLPLN
HTPG_WIGBR      LLYIPRKASWDIWNREHKH---GLKLYVKKVFIMDQSSEFIPNYLRFIKGIIDSNDLPLN
HTPG_LEGPH      LLYIPAHAPFDLWQHEAKH---GLKLYVKRVFIMDEATQFLPRYLRFVKGIVDASDLPLN
HTPG_LEGPC      LLYIPAHAPFDLWQHEAKH---GLKLYVKRVFIMDEATQFLPRYLRFVKGIVDASDLPLN
HTPG_LEGPL      LLYIPAHAPFDLWQHEAKH---GLKLYVKRVFIMDEATQFLPRYLRFIKGIVDASDLPLN
HTPG_LEGPA      LLYIPAHAPFDLWQHEAKH---GLKLYVKRVFIMDEATQFLPRYLRFVKGIVDASDLPLN
HTPG_PSEAE      LLYVPGRAPFDLYHREAPR---GLKLYVQRVFIMDQADEFLPLYLRFIKGVVDSNDLSLN
HTPG_PSEA7      LLYVPGRAPFDLYHREAPR---GLKLYVQRVFIMDQADEFLPLYLRFIKGVVDSNDLSLN
HTPG_PSEMY      LLYVPGRAPFDLYHREAPK---GLKLYVQRVFIMDQADEFLPLYLRFIKGVVDSNDLSLN
HTPG_PSEPF      LLYVPARAPFDLYQREAPK---GLKLYVQRVFVMDQAESFLPLYLRFIKGVVDSNDLSLN
HTPG_PSEF5      LLYVPARAPFDLYQREAPK---GLKLYVQRVFVMDQAESFLPLYLRFIKGVVDSNDLSLN
HTPG_PSEU2      LLYVPARAPFDLYQREAPR---GLKLYVQRVFVMDQAESFLPLYMRFVKGVVDSNDLSLN
HTPG_PSE14      LLYVPARAPFDLYQREAPR---GLKLYVQRVFVMDQAESFLPLYMRFVKGVVDSNDLSLN
HTPG_PSESM      LLYVPARAPFDLYQREAPR---GLKLYVQRVFVMDQAESFLPLYMRFVKGVVDSNDLSLN
HTPG_PSEPK      LLYVPARAPFDLYQREAPR---GLKLYVQRVFIMDQAESFLPLYLRFIKGVVDSNDLSLN
HTPG_XANC5      LLFVPGRAPFDLYHRDSAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSSDLSLN
HTPG_XANAC      LLFVPGRAPFDLYHRDSAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSSDLSLN
HTPG_XANOM      LLFVPGRAPFDLYHRDSAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSSDLSLN
HTPG_XANOR      LLFVPGRAPFDLYHRDSAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSSDLSLN
HTPG_XANCP      LLFVPGRAPFDLYHRDSAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSADLSLN
HTPG_XANC8      LLFVPGRAPFDLYHRDSAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSADLSLN
HTPG_XYLFA      LLYVPTRAPFDLYHRNAAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSADLSLN
HTPG_XYLFT      LLYVPTRAPFDLYHRNAAK---GLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSADLSLN
HTPG_SACD2      LIYIPSKAPFDMYNREKPR---GVKLYVQRTFIMDDAEQFLPLYLRFIKGVVDSNDLSLN
HTPG_MARHV      LLYIPKRAPFDLYNREAPR---GLKLYVQRVFIMDDAEQFLPLYLRFTKGVIDSNDLSLN
HTPG_HAHCH      LLYVPAKAPYDLWNREAPR---GLKLYIQRVFIMDDAEQFLPLYLRFVKGVVDSNDLSLN
HTPG_MARMS      LLYIPSKAPYDLWNRDMQR---GLKLYVQRVFIMDEAEAFLPPYMRFVKGVVDSNDLSLN
HTPG_CHRSD      LLYVPGRAPFDLYQREGVR---GLKLYVQRVFIMDDAEQFLPLYLRFIKGVVDSKDLSLN
HTPG_ALCBS      LLYVPAQAPFDLYQREANR---GLKLYVQRVFIMDDAEQFLPQYLRFIKGVIDAPDLPLN
HTPG_RUTMC      LLFIPSKAPHDMWEPKRKG---GIKLYAKRVFIMEDNEALMPLYLRFVKGVIDTADLPLN
HTPG_VESOH      LLFIPSKSPFDIWEPKRKG---GIKLYAKRVFIMEDNEALMPLYLRFVKGVIDTADLSLN
HTPG_HYDCU      LLYLPKKAPFDLYDRDRRY---GLKLYVKRVFIMDDAEHLMPTYLRFVRGVIDSNDLPLN
HTPG_FRAT1      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_FRATT      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_FRATW      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_FRATN      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_FRATF      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_FRATH      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_FRAP2      LLYIPQNKPFDFWNRDKDY---GLSLYVRRVFIMENKE-LLPPYLRFVKGVIDSADLPLN
HTPG_PELLD      ILFLPKEAPMELLYRQGELENKGPQLYVKKVMIQHECRDLLPEYLRFIAGVVDTEDLSLN
HTPG_CHLPM      LLFLPQNAPMELLYRQGELENKGPQLYVKKVMIQNECRDLLPEYLRFIAGVVDTEDLSLN
HTPG_CHLCH      LLFLPKEAPPELMYRQSELENRGPQLYVKKVLIQNECRDLLPEYLRFIAGVVDTEDLSLN
HTPG_CHLPD      LLFLPEEAPPELMYRQGDLESRGPQLYVKKVLIQQECRDLLPEYLRFVAGVVDTEDLPLN
HTPG_CHLTE      LLFIPSEAPMELLYNQGALEKRGPQLYVKKVLIQHECRDLLPEYLRFVSGVVDTEDLPLN
HTPG_DESHY      LLFVPKSNMEKFGFGRMEA---GVNLYCKKVLIQEKAKDIVPEWLRFARGVVDSEELPLN
HTPG_DESPS      LLFVPKENFEVMGFGRVEP---GVNLYCQRILIDQHSENILPGWLRFLKGVVDSEDLPLN
HTPG_DESAG      LAFIPNFGNELFGYDRDKY---GLDLYVRRVLISKEYKALIPEYLSFLKGVVDTEDLPLN
HTPG_DESVH      LVFVPPHGQEVFSMGRDRW---GLDLYVRRVLIQRENKDLLPEYLGFLKGIVDTEDLPLN
HTPG_BACFR      ILYFPKVKSNIDLNKNKIQ------LYCNQVYVTDSVEGIVPDFLTLLHGVLDSPDIPLN
HTPG_BACFN      ILYFPKVKSNIDLNKNKIQ------LYCNQVYVTDSVEGIVPDFLTLLHGVLDSPDIPLN
HTPG_BACTN      ILYFPKVKSNIELNKNKIQ------LYCNQVYVTDSVEGIVPDFLTLLHGVIDSPDIPLN
HTPG_PORGI      ILYFPKIKNNLDLQRNKIQ------LYCNQVYVTDEVQGIVPDFLTLLHGVIDSPDIPLN
                : : *                    *.     :      .:*       *::*  .:.**

HTPG_BACSU      ISREMLQHDRQLKLIAKNISKKIKSELQSLLKKDR-------------------------
HTPG_BACVZ      ISREMLQHDRQLKLIAKNINKKIKAELKSLLKNKR-------------------------
HTPG_BACLD      ISREMLQHDRQLKLIAKNISKKIKNELKSLLKNDR-------------------------
HTPG_BACHD      ISREMLQHDRQLKLIAKNIKNKITSHLKTLLKDER-------------------------
HTPG_BACSK      ISREMLQHDRQLKLIAKNIKSKIKSQLKTMLKKEP-------------------------
HTPG_OCEIH      ISREMLQHDRQLKLIAKNIKKKVKQQLVSLLRDER-------------------------
HTPG_CLOBH      ISREILQHDRQLKLIAKNIKTKIKNELESLLKKER-------------------------
HTPG_CLOB1      ISREILQHDRQLKLIAKNIKTKIKNELESLLKKER-------------------------
HTPG_CLOBL      ISREILQHDRQLKLIAKNIKTKIKNELESLLKKER-------------------------
HTPG_ALKMQ      ISREMLQHDRQLKIIAKKIKEKIKSELELLLKNER-------------------------
HTPG_ALKOO      ISREMLQHDRQLKLIGKNIKNKIKNELMSLLKEDR-------------------------
HTPG_CLOP1      ISREMLQHDRQLSRIAKNIKTKIKNELESMMKNDR-------------------------
HTPG_CLOPE      ISREMLQHDRQLSRIAKNIKTKIKNELESMMKNDR-------------------------
HTPG_CLOPS      ISREMLQHDRQLSRIAKNIKTKIKNELESMMKNDR-------------------------
HTPG_CLOAB      ISRELLQHDRQLKFIAKKIKEKIKSELLSMAKNDR-------------------------
HTPG_CLOTE      ISRELLQHDRQLKLIAKNIKEKIKSELLSILKNKR-------------------------
HTPG_FUSNN      ISREILQQNAELQVISKNLEKKITSELEKILKNDR-------------------------
HTPG_RHIME      VSREMIQESPLLANIRKGLTNRVLTSIEKLAESDSEAF----------------------
HTPG_RHIEC      VSREMIQESPILAAIRKGVTNRVITAIEKLADGESETY----------------------
HTPG_NITWN      ISREMIQESPILAAIKKSITGRILSELEKLADKDAQAY----------------------
HTPG_NITHX      ISREMIQESPILAAIKKSITGRVLSELEKLAEKDAQAY----------------------
HTPG_AZOC5      LSREMLQDSAILAAIRKGVTGRVLTELEKLAQSDAEAY----------------------
HTPG_RHILO      VSREMIQESPLLASIRKGLTNRVLGDLAKLAENEAEAY----------------------
HTPG_RHOP2      LSREMLQNNPQLAQIRKAVTGKVIGELDSLADKQPEQF----------------------
HTPG_RHOPS      LSREMLQNNPQLAQIRKAVTGKVIGELESLADKKPEDF----------------------
HTPG_RHOPA      LSREMLQKNPQLAQIRTAVTGKVISELESLADKKPEDF----------------------
HTPG_RHOP5      LSREMLQNNPQLVQIRKAVTGKVIGELESLGEKDPENF----------------------
HTPG_RHOPB      LSREMLQNNPQLAQIRKAVTGKVIGELESLGDKDPEAF----------------------
HTPG_BRADU      ISREMLQNNPQLVQIRKAVATRVVSELEGLAEKDAENF----------------------
HTPG_GLUOX      VSREMLQATPVLARIRKAVTKRVLSEISKRAKEADSGF----------------------
HTPG_MAGSA      VSREMLQHNPVLSKIRTGLVKRILGELKKKSEDAEGKY----------------------
HTPG_RHORT      VSREMLQDDPRLRKIKGGLTKRLIDDLAKRARDDESAY----------------------
HTPG_ROSDO      VSREMLQSDPKLAKIKTSVTKKVLSELKKKAKKSPEDY----------------------
HTPG_RICRS      ISRESLQHNSVLEKIKNAITKRVLGELRKKKEESPEEY----------------------
HTPG_RICRO      ISRESLQHNSVLEKIKNAITKRVLGELRKKKEESPEEY----------------------
HTPG_RICCN      ISRESLQHNSVLEKIKNAITKRVLGELRKKKEESPEEY----------------------
HTPG_RICFE      ISRESLQHNSVLEKIKNAITKRVLGELKKKKEESPEEY----------------------
HTPG_RICAH      ISRESLQHNSVLEKIKNAITKRVLGELRKKKEESSEEY----------------------
HTPG_RICCK      ISRESLQHNSILDKIKNAITKRVLAELKKKKEESPEDY----------------------
HTPG_RICBR      ISRESLQHNNVLEKIKNAITKRVLGELKKKKEDSPDEY----------------------
HTPG_RICB8      ISRESLQHNNVLEKIKNAITKRVLGELKKKKEDSPDEY----------------------
HTPG_RICTY      ISRESLQHNNVLEKIKNAITKRVLGELRKKKEELPEEY----------------------
HTPG_RICPR      ISRESLQHNNVLEKIKNAITKRVLGELRKKKEELPEEY----------------------
HTPG_ORITB      ISRETLQHSPLIDKIQASITKRVITELEKQKTKDQGEY----------------------
HTPG_EHRCJ      ISRETLQNNKVIEKIKQSIVKRVLSELKKKAENDINDY----------------------
HTPG_EHRCR      ISRETLQNNKIIEKIKQSIVNRVLSELKKKAESDIKDY----------------------
HTPG_EHRRW      ISRETLQNNKIIEKIKRSLVKRVLSELKKKAESNIEDY----------------------
HTPG_EHRRG      ISRETLQNNKIIEKIKRSLVKRVLSELKKKAESNIEDY----------------------
HTPG_WOLPM      ISRETLQNNRVVEQIRKSLTKRAISELGKKAKENLEEY----------------------
HTPG_WOLTR      ISRETLQNNRVVEQIRKSLTKRVISELGKKAKENLEEY----------------------
HTPG_ANAPZ      ISRETLQNNRIVEKIKTSVTKKVLSALKEKAESDHESY----------------------
HTPG_ANAMM      ISRETLQNNMVIEKIKASVTRRVLTSLREKADSDPVSY----------------------
HTPG_NEOSM      ISRETLQYNNALVKIKKSLTNRVLNELKKRADSNPEEYI---------------------
HTPG_TREDE      VSREILQQNRILSNIKNASVKKLLGEFKKLAENDK-------------------------
HTPG_TREPA      VSREILQQNRVLAAIKSASVKKLLGEFKRLAECDG-------------------------
HTPG_HELPH      VSREILQQNKILANIRSASVKKILSEIERLSK-DE-------------------------
HTPG_HELPJ      VSREILQQNKILANIRSASVKKILSEIERLSK-DN-------------------------
HTPG_HELPY      VSREILQQNKILANIRSASVKKILSEIERLSK-DE-------------------------
HTPG_HELAH      VSREILQQNKILANIRSASVKKILGEIEKLSK-DN-------------------------
HTPG_HELHP      VSREILQQNKILANIKSASTKKILSEITNIAK-NE-------------------------
HTPG_WOLSU      VSREILQQNRILANIKSASTKKILAEIENLAK-DE-------------------------
HTPG_CAMJJ      VSREILQENQILKGVKEASVKKILGELEKLKNNDK-------------------------
HTPG_CAMJ8      VSREILQENQILKGVKEASVKKILGELEKLKNNDK-------------------------
HTPG_CAMJR      VSREILQENQILKGVKEASVKKILGELEKLKNNDK-------------------------
HTPG_CAMJE      VSREILQENQILKGIKEASVKKILGELEKLKNNDK-------------------------
HTPG_CAMJD      VSREILQENQILKGVKEASVKKILGELEKLKNNDK-------------------------
HTPG_CAMHC      VSREILQENRIMQTVKAASVKKILGELEKIKNSDK-------------------------
HTPG_SULNB      VSRELLQENRILANIKQNSVKKILGAIKKL---DS-------------------------
HTPG_ARCB4      VSREILQENRILANIKQGSVKKILAEIKKLSK-DE-------------------------
HTPG_BORBP      VSREILQQNKILSKIKSSSVKKILSELEKLSKKNP-------------------------
HTPG_BORBU      VSREILQQNKILSKIKSSSVKKILSELEKLSKKNP-------------------------
HTPG_BORAP      VSREILQQNKILSKIKSSSVKKILSELEKLSKKNP-------------------------
HTPG_SULDN      VSREILQSNAVMAKIKNASVKKVLSELAKMAKRDA-------------------------
HTPG_MYCTA      VSREILQQDRQIKAIRRRLTKKVLSTIKDVQSSRPE------------------------
HTPG_MYCBO      VSREILQQDRQIKAIRRRLTKKVLSTIKDVQSSRPE------------------------
HTPG_MYCBP      VSREILQQDRQIKAIRRRLTKKVLSTIKDVQSSRPE------------------------
HTPG_MYCTU      VSREILQQDRQIKAIRRRLTKKVLSTIKDVQSSRPE------------------------
HTPG_MYCA1      VSREILQQDRQIKAIRRRLTKKVLSTIKELQSERPD------------------------
HTPG_MYCPA      VSREILQQDRQIKAIRRRLTKKVLSTIKELQSERLD------------------------
HTPG_MYCUA      VSREILQQDRQIKAIRRRLTKKVLSTIKDLQSERPE------------------------
HTPG_MYCLE      VSREILQQNRQINAIRRRLTKKVLSAIKDLQAERPQ------------------------
HTPG_MYCGI      VSREILQQDRQIRAIRRRLTKKVLSTIAEMQAERPE------------------------
HTPG_MYCVP      VSREILQQDRQIRAIRRRLTKKVLSTITEMQTERPE------------------------
HTPG_RHOJR      VSREILQQDRQIRAIRRRLTKKVLTTIKDLKTERPD------------------------
HTPG_NOCFA      VSREILQQDRQIQMIRKRLVKKVLATVKDLQQAEDQS-----------------------
HTPG_SALTO      ISRELLQQDRQIQVVRRRLVKKILATVKELKANQPE------------------------
HTPG_SALAI      ISRELLQQDRQIQVVRRRLVKKVLATVKDLKANQPE------------------------
HTPG_FRACC      ISREILQQDRRIQLVRRRLVKKILASIRALQENDAE------------------------
HTPG_STRCO      VSREILQQDRHIRMIQRRLTKKVLSTVKDLRTSAPD------------------------
HTPG_GEOSL      VSREILQEDVQIKRIQKSLVSKILSTLSEMREKEAD------------------------
HTPG_GEOMG      VSREILQEDVQIKRIQKSLVSKIISTLSEMREKEAD------------------------
HTPG_GEOUR      VSREILQEDIQIKRIEKNLVGKILSTLVETKEKTPE------------------------
HTPG_PELPD      VSREILQEDVQIKRIQKSLVGKILSTLAEVKEKNFD------------------------
HTPG_BDEBA      VSRELLQQDRQVTQIRKNVTNKALSTLKDLLTKERS------------------------
HTPG_MYXXD      VSRELLQDSQVVRAIRKHVVKKSVDLLEKLAKDKPD------------------------
HTPG_METFK      VSREILQHSKDIEAIKTASVKRVLSMLEDLAENK--------------------------
HTPG_THIDA      VSREILQSSRDIDAIKNGSVKKVLGMLEDLAENQ--------------------------
HTPG_CHRVO      VSREILQESKDIDAIRAGCVKKVLGLLEDLSANQ--------------------------
HTPG_DECAR      VSREILQQSKDIDGIRSGCTRKVLGMLEDLAEND--------------------------
HTPG_AROAE      VSREILQESKDIDTIRSGCTKKVLGLLESLATSDE------------------------A
HTPG_NITEC      VSREILQESKDIDSIRAGSVKKVLGLIEDLATSDK------------------------S
HTPG_NITEU      VSREILQESKDIDSIRAGSVKKVLGLIEDLAMSDK------------------------S
HTPG_NITMU      VSREILQESKDIEAMRAGSVKKVLGLLDDLAQSET------------------------D
HTPG_BORBR      VSREILQESRDVRAIREGSAKRVLSLLEDMAENK--------------------------
HTPG_BORPA      VSREILQESRDVRAIREGSAKRVLSLLEDMAENK--------------------------
HTPG_BORPE      VSREILQESRDVRAIREGSAKRVLSLLEDMAENK--------------------------
HTPG_BORA1      VSREILQESRDVRAIREGSAKRILSLLEDLAENR--------------------------
HTPG_BURPS      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURMA      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURM7      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURP1      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURM9      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURMS      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURP0      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURP6      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURTA      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURCA      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURCH      VSREILQESRDVKAIREGVTKRALSMLEELANAED------------------------D
HTPG_BURCM      VSREILQESRDVKAIREGVTKRALSMLEELANAEE------------------------E
HTPG_BURL3      VSREILQESRDVKAIREGVTKRALSMLEELANAEE------------------------D
HTPG_PARXL      VSREILQESRDVKAIREGVTKRVLSMLEDLANSDN------------------------E
HTPG_CUPNH      VSRELLQESRDVKAIREGCTKRVLSMLETLADSEE------------------------E
HTPG_CUPPJ      VSRELLQESRDVKAIREGSTKRVLSMLESLADSEE------------------------E
HTPG_CUPMC      VSRELLQESRDVKAIREGCAKRVLSMLEAMADSED------------------------E
HTPG_RALSO      VSREILQESRDVKAIREGSTKRVLGMLESMADSDD------------------------A
HTPG_ACISJ      VSRELLQESRDVRLIRDGSVKRVLSMLEDLAKHDKHEAAA-----EGADGVQDVVSAEDK
HTPG_VEREI      VSRELLQESRDVRAIREGSTKRVLSMLEDLARHDRHDSPAPQP-AEGADRVSDVVDADDK
HTPG_RHOFT      VSRELLQESRDVKAIREGCTKRVLGMLEDLAKHDKLPAPSADGGTDTTAGVSDVLSEEDK
HTPG_POLNA      VSRELLQESRAVKAIREGCTKRVLSMIEDLANNE--------------------------
HTPG_POLSJ      VSRELLQESRAVKAIREGNTRRVLSMIEDLAAND--------------------------
HTPG_METPP      VSRELLQESRDVKAIREGSTKRVLGMLEEMAGSE------------------------DA
HTPG_PSYCK      VSRELLQESRDVKSIRDGNARRILTLLASLANSE------------------------DS
HTPG_PSYA2      VSREILQESRDVKSIRDGNARRILTLLASLANSE------------------------DA
HTPG_ACIAD      VSRELLQESRDVKTIREGNTRRVLTLLDGLAKSE------------------------DE
HTPG_ALKEH      VSRELLQHNPLLDKIRSASVKRILDRLEKMAKNEP-------------------------
HTPG_HALHL      ISREMLQHNPMISSLRSASVKRILDRLECMAKNEP-------------------------
HTPG_NITOC      ISREILQNNRVIDSIRAGSVKKILGLLEDMAKHEA-------------------------
HTPG_MAGMM      VSREILQQNRQVEAIKKGLVHKVLGMLEEMLKNDP-------------------------
HTPG_METCA      VSREILQENKQLEKIRGGAVKKVLGLLEDLANNEP-------------------------
HTPG_COXBR      ISRELLQSNEVINKIKAGCVKRILSLLEDLAKNDK-------------------------
HTPG_COXBU      ISRELLQSNEVINKIKAGCVKRILSLLEDLAKNDK-------------------------
HTPG_COXBN      ISRELLQSNEVINKIKAGCVKRILSLLEDLAKNDK-------------------------
HTPG_HAEIN      VSREILQDNKITAALRKALTKRSLQMLEKLAKDDA-------------------------
HTPG_HAEIE      VSREILQDNKITAALRKALTKRSLQMLEKLAKDDA-------------------------
HTPG_HAEI8      VSREILQDNKITAALRKALTKRSLQMLEKLAKDDA-------------------------
HTPG_HAEIG      VSREILQDNKITAALRKALTKRSLQMLEKLAKDDA-------------------------
HTPG_AGGAC      VSREILQDNKVTAALRKALTKRSLQMLEKLAKDDA-------------------------
HTPG_HAES1      VSREILQDNKVTAALRKALTKRSLQMLEKLAKDDE-------------------------
HTPG_HISS2      VSREILQDNKVTAALRKALTKRSLQMLEKLAKDDE-------------------------
HTPG_PASMU      VSREILQDNKVTSALRKALTKRALQMLEKLAKDDA-------------------------
HTPG_ACTSZ      VSREILQDNKTTAALRKALTKRSLQMLEKLAKDEA-------------------------
HTPG_MANSM      VSREILQDNKTTAALRKALTKRSLQMLEKLAKDEP-------------------------
HTPG_ACTP2      VSREILQENKITASLRAALTKRALQLLEKLAKDDQ-------------------------
HTPG_ECOLI      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECOL5      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECOHS      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECOL6      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_SHIBS      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_SHISS      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECO57      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECOLC      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECOUT      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECOK1      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_ECO24      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_SHIFL      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_SHIDS      VSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDA-------------------------
HTPG_SALPB      VSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_SALPA      VSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_SALTY      VSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_SALCH      VSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_SALTI      VSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_CITK8      VSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_CROS8      VSREILQDSSITRNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_KLEP7      VSREILQDSSVTRNLRTALTKRALQMLDKLAKDDA-------------------------
HTPG_ENT38      VSREILQDSTVTRNLRNALTKRTLQMLEKLAKDDA-------------------------
HTPG_PECAS      VSREILQDSRVTQNLRNALTKRVLQMLDKLAKDDA-------------------------
HTPG_YERPA      VSREILQDSRITQNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_YERPS      VSREILQDSRITQNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_YERPN      VSREILQDSRITQNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_YERPP      VSREILQDSRITQNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_YERPE      VSREILQDSRITQNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_YERE8      VSREILQDSRVTQNLRSALTKRVLQMLEKLAKDDA-------------------------
HTPG_SERP5      VSREILQDSRVTQNLRGALTKRVLQMLEKLAKDDA-------------------------
HTPG_PHOLL      VSREILQDNSITRNLRNALTKRALQMLDKLAKDDA-------------------------
HTPG_SODGM      VSREILQDSRVTQNLKGALTKRALSMLEKLAKDDA-------------------------
HTPG_BAUCH      ISREMLQHNRITQNLKNAITKRILSMLEKLATQNN-------------------------
HTPG_VIBCH      VSREILQDNKITQSLRQACTKRVLTMLERMASNDA-------------------------
HTPG_VIBC3      VSREILQDNKITQSLRQACTKRVLTMLERMASNDA-------------------------
HTPG_VIBPA      VSREILQDNKVTQSLRNACTKRVLTMLERMAKNDE-------------------------
HTPG_VIBCB      VSREILQDNKVTQSLRNACTKRVLTMLDRMAKNDT-------------------------
HTPG_VIBVY      VSREILQDNKVTQSLRGACTKRVLTMLERLAKNDT-------------------------
HTPG_VIBVU      VSREILQDNKVTQSLRGACTKRVLTMLERLAKNDT-------------------------
HTPG_ALIF1      VSREILQDNKVTQSLRSACTKRVLGMLEKMAKKDD-------------------------
HTPG_PHOPR      VSREILQDNKVTQALRKASTKRALTMLDRMAKNDA-------------------------
HTPG_AERHH      VSREILQDNKVTVSLRKACSKRVLTMLAKLAKDDA-------------------------
HTPG_AERS4      VSREILQDNKVTVSLRKACSKRVLTMLAKLAKDDA-------------------------
HTPG_PSEHT      VSREILQDNKVTQAIRKGCTSRIIKMLERMAKNKA-------------------------
HTPG_COLP3      VSREILQDNKVTQAIRKGCTKRVLKMLEKLGNKDA-------------------------
HTPG_PSEA6      VSREILQDNKITQAIRQGCTKRVLQMLERVAKNDS-------------------------
HTPG_IDILO      VSREILQDNKITRAMRNGSTKKVLQMLKKLAKDDK-------------------------
HTPG_PSYIN      VSREILQDTRVTAKLRSGCTKRVLDLLTKLAKKDD-------------------------
HTPG_SHEPA      VSREILQDNKVTTALRTAVTKRVLGMLEKLAKNDA-------------------------
HTPG_SHEHH      VSREILQDNKVTTALRTAVTKRVLGMLEKLAKNDA-------------------------
HTPG_SHESH      VSREILQDNKVTTALRTAVTKRVLGMLEKLAKNDA-------------------------
HTPG_SHELP      VSREILQDNKITTALRTAVTKRVLGMLEKLAKNDP-------------------------
HTPG_SHEPC      VSREILQDNHITKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHESW      VSREILQDNHITKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHESM      VSREILQDNHITKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHESR      VSREILQDNHITKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHESA      VSREILQDNHITKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHEON      VSREILQDNHITKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHEB9      VSREILQDNHVTKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHEB8      VSREILQDNHVTKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHEB5      VSREILQDNHVTKAMRTGITKRVLGMLEKLAKDDA-------------------------
HTPG_SHEDO      VSREILQDNQVTTAMRVGVTKRVLGMLEKLAKDEP-------------------------
HTPG_SHEFN      VSREILQDNQVTTAMRVGITKRVLGMLEKLAKDEP-------------------------
HTPG_SHEAM      VSREILQDNKVTRNLRQALTKRVLSMLEKLAKDDA-------------------------
HTPG_BUCAI      ISREILQDNSITEKLRKSLIKKSLSMLEKLAQKNN-------------------------
HTPG_BUCAP      VSREILQDNSITQNLKKALIKRSLKMLQTLSKKDN-------------------------
HTPG_BUCBP      VSREILQDHKLVYNLKKSLTKKVLQVLHSLSQN-V-------------------------
HTPG_BUCCC      ISREILQDSSITHILRKSLTKRILNILNNLSENNI-------------------------
HTPG_WIGBR      VSREILQNNENIYKIKINLTKKALLMLENLSKNHP-------------------------
HTPG_LEGPH      ISREILQDNKQVESIRAACTKRVLSMLEKMATNDK-------------------------
HTPG_LEGPC      ISREILQDNKQVESIRAACTKRVLSMLEKMATNDK-------------------------
HTPG_LEGPL      ISREILQDNKQVESIRAACTKRVLSMLEKMATNDK-------------------------
HTPG_LEGPA      ISREILQDNKQVESIRAACTKRVLSMLEKMATNDK-------------------------
HTPG_PSEAE      VSREILQKDPVIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSEA7      VSREILQKDPVIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSEMY      VSREILQKDPVIDSMKSALTKRVLDMLEKLAKDKP-------------------------
HTPG_PSEPF      VSREILQKDPIIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSEF5      VSREILQKDPIIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSEU2      VSREILQKDPIIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSE14      VSREILQKDPIIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSESM      VSREILQKDPIIDSMKSALTKRVLDMLEKLAKNEP-------------------------
HTPG_PSEPK      VSREILQKDPIIDSMKTALTKRVLDMLEKLAKNEP-------------------------
HTPG_XANC5      VSREILQSGPVVDSMKSALTKRSLDMLEKLAKDKP-------------------------
HTPG_XANAC      VSREILQSGPVVDSMKSALTKRSLDMLEKLAKDKP-------------------------
HTPG_XANOM      VSREILQSGPVVDSMKSALTKRSLDMLEKLAKDKP-------------------------
HTPG_XANOR      VSREILQSGPVVDSMKSALTKRSLDMLEKLAKDKP-------------------------
HTPG_XANCP      VSREILQSGPVVDSMKSALTKRALDMLEKLAKDKP-------------------------
HTPG_XANC8      VSREILQSGPVVDSMKSALTKRALDMLEKLAKDKP-------------------------
HTPG_XYLFA      VSREILQSGPVVDSMKAALSKRALDMLEKLAKDAP-------------------------
HTPG_XYLFT      VSREILQSGPVVDSMKTALSKRALDMLEKLAKDAP-------------------------
HTPG_SACD2      VSREILQQDPNIDSMRSALTKRVLDMLEKMAKKEP-------------------------
HTPG_MARHV      VSREILQNDSTVESIRTALTKRVLDMLSKLAKKGG-------------------------
HTPG_HAHCH      VSREILQNDKAVESMRSALTKRVLDMLSKLAADDA-------------------------
HTPG_MARMS      VSREILQNDHAVDSMRSALTKRVLDMLGKMAKNEP-------------------------
HTPG_CHRSD      VSRELLQKDPQVDKLKSALTKRSLDMLKKLAKDE--------------------------
HTPG_ALCBS      VSRELLQDYGPVQKIRSALTKRVLQMLKKLSNDD--------------------------
HTPG_RUTMC      VSREILQGNKVVDTIRKASVSRVLKELEKMAKNKPE------------------------
HTPG_VESOH      LSREILQDNKVIKAIRKASVKRILSVLEKMAKNKPE------------------------
HTPG_HYDCU      VSREILQSNRVVDKIRSASVKRVLDQLAKMAKAEDQS-----------------------
HTPG_FRAT1      VSREILQHNKVIDKIKKAITTKILSELKKLASKDK-------------------------
HTPG_FRATT      VSREILQHNKVIDKIKKAITTKILSELKKLASKDK-------------------------
HTPG_FRATW      VSREILQHNKVIDKIKKAITTKILSELKKLASKDK-------------------------
HTPG_FRATN      VSREILQHNKVIDKIKKAITTKILSELKKLASKDK-------------------------
HTPG_FRATF      VSREILQHNKVIDKIKKAITTKILSELKKLASKDK-------------------------
HTPG_FRATH      VSREILQHNKVIDKIKKAITTKILSELKKLASKDK-------------------------
HTPG_FRAP2      VSREILQHNKVIDKIKKAITTKILSELKKLASKDT-------------------------
HTPG_PELLD      VSREIVQSSPVMSKIRQILTGKILGWFEELATAQP-------------------------
HTPG_CHLPM      VSREVVQSSPVMAKIRQILTTKILGWFEELAVEQP-------------------------
HTPG_CHLCH      VSREMVQSSPVMAKIRQILTGKILGWFEMLAKEQP-------------------------
HTPG_CHLPD      VSREVVQSSKVMANIRQILTGKILSWFESMATDQP-------------------------
HTPG_CHLTE      VSRELVQASPVMAKIKQILTTKLLGWFDTIAKEEP-------------------------
HTPG_DESHY      ISRETMQDSALIAKLNKVVTSRFLKFLDDQAKNEP-------------------------
HTPG_DESPS      ISRQSLQDNALVSKIRRVVTKRFLKYLAEEATRDE-------------------------
HTPG_DESAG      ISRETLQENALIAKIRQTLVKQVLAHLAKLAESDA-------------------------
HTPG_DESVH      ISRETLQENVVVRKIGQTLTKQVLADLARLAADDA-------------------------
HTPG_BACFR      VSRSYLQSDSNVKKISTYISKKVSDRLQSIFKNDR-------------------------
HTPG_BACFN      VSRSYLQSDSNVKKISTYISKKVSDRLQSIFKNDR-------------------------
HTPG_BACTN      VSRSYLQSDSNVKKISTYITKKVSDRLQSIFKNDR-------------------------
HTPG_PORGI      VSRSYLQSDANVKKISSHITKKVADRLEEIFKNDR-------------------------
                :**. :*       :      :    .                                 

HTPG_BACSU      ---EKYETFYKSFGRQLKFGVYNDF-GANKDQLKDLLLFYSSK-----EKKLVSLDEYVS
HTPG_BACVZ      ---EKYESFYESFGRQLKFGVYNDF-GANKDVLKDLLLFYSSK-----EKKLVTLDEYVS
HTPG_BACLD      ---EKYESFYQSFGRQLKFGVYNDF-GAHKDLLKDLLLFYSSK-----EKKLVTLEEYVS
HTPG_BACHD      ---EKFEQFYRSFGRQLKYGVYSDF-GANKEDLQDLLLFYSST-----EKKMVTLDEYVS
HTPG_BACSK      ---DKYEKFYKAFGRQLKFGVYNDF-GANKDDLQDLLLFYSST-----EKKLVSLSDYVS
HTPG_OCEIH      ---ENYEKFFDAFGQQIKFGVYSDY-GQNKDELKDLLLFYSSK-----EKKLVTLEEYVS
HTPG_CLOBH      ---DKYEKFYESFGRQLKYGVYSDF-GSNKDILQDLLMFYSSK-----EKKMVTLAEYVS
HTPG_CLOB1      ---DKYEKFYESFGRQLKYGVYSDF-GSNKDILQDLLMFYSSK-----EKKMVTLAEYVS
HTPG_CLOBL      ---DKYEKFYESFGRQLKYGVYSDF-GSNKDILQDLLMFYSSK-----EKKMVTLAEYVS
HTPG_ALKMQ      ---ERYEEFYDSFGRQIKYGVYSDF-GQNKETLKDLLLFYSSK-----EKKMVTLDEYVG
HTPG_ALKOO      ---TQYEAFFEAFGRQLKYGIYSEF-GSNKDVLQDLLLFYSSK-----EKKLVTLDEYIS
HTPG_CLOP1      ---ESYEKFYKSFGRQLKYGVYDDF-GMNKDELKDLLMFYSSK-----EKKMVSLAEYVE
HTPG_CLOPE      ---ESYEKFYKSFGRQLKYGVYDDF-GMNKDELKDLLMFYSSK-----EKKMVSLAEYVE
HTPG_CLOPS      ---ESYEKFYKSFGRQLKYGVYDDF-GMNKDELKDLLMFYSSK-----EKKMVSLAEYVE
HTPG_CLOAB      ---ENYVKFFNSFGRQLKYGVYSDF-GSNKEVLQDLLMFYSST-----EKKLVTLDEYVS
HTPG_CLOTE      ---EDYIKFYNNFGRQLKYGVYSDF-GANKEVLQDLIMFYSST-----EKKLVTLDEYVS
HTPG_FUSNN      ---EKYVEFWKEFGRSIKAGVQDMF-GMNKEKLQDLLIFVSSH-----DDKYTTLKEYVD
HTPG_RHIME      ------AKIWENFGSVIKEGIYED--FERRGQLLALSRFRTTADDD----KPRALSDYVK
HTPG_RHIEC      ------LTFWKNFGPVLKEGIYED--YERRAQLMALARFHTSASPE----GHRSLAEYVK
HTPG_NITWN      ------GKIWEAFGPMFKEGIYDA--ADRRDTVLGLSRFRTTAGS------LRSLKDYVG
HTPG_NITHX      ------GKVWEAFGPMFKEGIYDA--ADRRDAILSLCRFRTTAGS------LRSLKDYVG
HTPG_AZOC5      ------AGIWSNFGAVLKEGLYED--YERRAQLLNLARFKTTTSGTAADTGWRTLKDYVA
HTPG_RHILO      ------AKVWENFGVVLKEGLYED--YERREQLLKLARFHSTASGE----GWRGLADYVA
HTPG_RHOP2      ------AKIWDAFGPVIKEGLYED--YERREKLLSLARFTTTAGEK------RSLAQYVE
HTPG_RHOPS      ------ARIWEAFGPVLKEGLYED--YERREKLLALARFTTTAGEK------RTLSQYVE
HTPG_RHOPA      ------TKIWDAFGPVLKEGLYED--FERREKLLSLARFTTTAGEK------RSLKQYVE
HTPG_RHOP5      ------AKIWDAFGPVIKEGIWED--YERREKLLALSRFTTTKGDN------RTLKNYVE
HTPG_RHOPB      ------GKIWDAFGLVIKEGIWED--YERRDKLLALSRFTTTKGEN------RTLKQYVE
HTPG_BRADU      ------AKIWDAFGAVLKEGIYED--FERREKLLALSRFTTTTGEK------RSLKQVVA
HTPG_GLUOX      ------NSFWENFGAVIKEGLWED--AEHRTEIAGFARFHSTYSDD-----LITLDDYIS
HTPG_MAGSA      ------DEFWAAFGPVLKEGIYED--FERKTDILELCRFRSTHGDG-----LTTLADYVA
HTPG_RHORT      ------LTFWENFGAVLKEGIYED--FERKEDLVALARFRTTASDT-----PVSLETVIG
HTPG_ROSDO      ------AGFWQNFGPVLKEGLIED--PALRDRILEICRFSSTKSGD-----VTSLADYIS
HTPG_RICRS      ------NKFWANFGGALKEGLCEA--TTNHEKLLEVCIFRSALH-----NKMISLDEYIA
HTPG_RICRO      ------NKFWANFGGALKEGLCEA--TTNHEKLLEVCIFRSALH-----NKMISLDEYIA
HTPG_RICCN      ------NKFWANFGGALKEGLCEA--TTNHEKLLEVCIFRSALH-----NKMISLDEYIA
HTPG_RICFE      ------NKFWANFGGALKEGLCEA--TTDHEKLLEVCIFRSALH-----NKMISLDEYIA
HTPG_RICAH      ------NKFWANFGGALKEGLCEA--TTDHEKLLEVCIFRSALH-----NKMISLDEYIA
HTPG_RICCK      ------NKFWSNFGGALKEGLCES--TTDHEKLLEVCIFRSALH-----NKMISLDEYIA
HTPG_RICBR      ------NNFWANFGGALKEGLCEA--TTDHEKLLEVCIFRSALH-----NKMISLDEYIK
HTPG_RICB8      ------NNFWANFGGALKEGLCEA--TTDHEKLLEVCIFRSALH-----NKMISLDEYIK
HTPG_RICTY      ------NKFWTNFGGALKEGLCEA--TTDHEKLLEVCIFRSALH-----NKMISIDEYIA
HTPG_RICPR      ------NKFWTNFGGALKEGLCEA--TTDHEKLLEVCIFRSALH-----NKMISIDEYIA
HTPG_ORITB      ------ETFWNNFGAVLKEGLCEG--TADVDKLLKICLFRSALQ-----DKFISLDEYIA
HTPG_EHRCJ      ------KKFWENFGSVLKEGLCESMNTEFREELLSACRFYSTNS-D---DSLISLEDYIE
HTPG_EHRCR      ------KKFWENFGSVLKEGLCESMNTEFREELMSACRFYSTYS-D---DSLISLEDYIE
HTPG_EHRRW      ------TKFWDNFGSVLKEGLCESMNTEFREELISVCRFYSTHS-N---DSLISLEDYIE
HTPG_EHRRG      ------TKFWDNFGSVLKEGLCESMNTEFREELISVCRFYSTHS-N---DSLISLEDYIE
HTPG_WOLPM      ------TKFWTNFGAVLKEGLCEAMPTDEREALLSICRFHSTG--D---EKLVSIDDYIS
HTPG_WOLTR      ------TKFWTNFGAVLKEGLCEAMPTEEREALLSICRFHSTG--D---KKLVSIDDYIS
HTPG_ANAPZ      ------SKFWENFGPVLKEGLCEAMDTESREGVLSVCKFHTSACAA---GELVSLADYIS
HTPG_ANAMM      ------KTFWENFGPVLKEGLCEAMDTESRESILSVCRFYSSNSKE---GELISLGDYIS
HTPG_NEOSM      ------SGFWNNFGAVLKEGLCEAMPTDERERLFALCRFYSLKK-----EKLISLDEYIQ
HTPG_TREDE      ---EKYNKFIAEFNRPLKEGLYSD--YEHREELADLVRFKTTSP-EVKEDEWTSFADYVS
HTPG_TREPA      ---KKYDEFITQYNRPLKEGLYSD--YEHREQLLELVRFRTLSE-SVPEDGWTSFAEYVS
HTPG_HELPH      ---KNYHKFYEPFGKVLKEGLYGD--FENKEKLLELLRFYSKD--KEK---LISLKEYRE
HTPG_HELPJ      ---KNYHKFYEPFGKVLKEGLYGD--FENKEKLLELLRFYSKD--KGE---WISLKEYKE
HTPG_HELPY      ---KNYHKFYEPFGKVLKEGLYGD--FENKEKLLELLRFYSKD--KEK---LISLKEYKE
HTPG_HELAH      ---ENYHKFYEPFGKVLKEGLYGD--FENKEKLLELLRFYSKD--KEK---LISLKEYKE
HTPG_HELHP      ---ADYKTFYEQFGKVLKEGLYGD--YENKEKILELLRFDSF---KSE---YISLKAYKE
HTPG_WOLSU      ---EKYEAFFKEFGRALKEGLYGD--FENKEKLLELMRFHSSLS-PNK---KISLQSYKE
HTPG_CAMJJ      ---EKYLSFFKTFGKVLKEGLYGF--GGEKDSLLKLMLYKSTKG-EN----LRSLEEYKN
HTPG_CAMJ8      ---EKYLSFFKTFGKVLKEGLYGF--GGEKDSLLKLMLYKSTKG-EN----LRSLEEYKN
HTPG_CAMJR      ---EKYLSFFKTFGKVLKEGLYGF--GGEKDSLLKLMLYKSTKG-EN----LRSLEEYKN
HTPG_CAMJE      ---EKYLSFFKTFGKVLKEGLYGF--GGEKDSLLKLMLYKSTKG-EN----LRSLEEYKN
HTPG_CAMJD      ---EKYLSFFKTFGKVLKEGLYGF--GGEKDSLLKLMLYKSTKG-EN----LRSLEEYKN
HTPG_CAMHC      ---EKYAKFYKLFGKVLKEGLWGF--STEKDEILKLCLFKSSKT-GE----LIDLAEYKK
HTPG_SULNB      ---EKMEIFTEQYNRVIKEGIYTD--HTNKETLLGIVRYKSSSE-EG----MVSLDDYIS
HTPG_ARCB4      ---EKYAEFVAQYIRPLKEGVYQD--YTNKEAILELLRYKSSKT-EAGK--MTSLEAYKE
HTPG_BORBP      ---EKFSKFSKEFGRCIKEGVYSD--FENREKLISLIRFKSSSV-DG----FVSFKEYKE
HTPG_BORBU      ---EKFSEFSKEFGRCIKEGVYSD--FENREKLISLIRFKSSSV-DG----FVSFKEYKE
HTPG_BORAP      ---EKFSEFSKEFGRCIKEGVYSD--FENREKLISLIRFKSSSV-DG----FVSFKEYKE
HTPG_SULDN      ---KKYDDFFTQFGNVLKEGLYSD--YGNRENILELLKFNTINS-DEK----IMIEEFIK
HTPG_MYCTA      ----DYRTFWTQFGRVLKEGLLSD--IDNRETLLGISSFVSTY---SEE-EPTTLAEYVE
HTPG_MYCBO      ----DYRTFWTQFGRVLKEGLLSD--IDNRETLLGISSFVSTY---SEE-EPTTLAEYVE
HTPG_MYCBP      ----DYRTFWTQFGRVLKEGLLSD--IDNRETLLGISSFVSTY---SEE-EPTTLAEYVE
HTPG_MYCTU      ----DYRTFWTQFGRVLKEGLLSD--IDNRETLLGISSFVSTY---SEE-EPTTLAEYVE
HTPG_MYCA1      ----DYRTFWTQFGRVVKEGLLSD--FDNQETLLQLCSFASTH---SEE-EATTLAQYVE
HTPG_MYCPA      ----DYRTFWTQFGRVVKEGLLSD--FDNQETLVQLCSFASTH---SEE-EATTLAQYVE
HTPG_MYCUA      ----DYRTFWTQFGKVVKEGLLAD--FDNRETLLEISSFASTH---SEE-EPTTLAGYVE
HTPG_MYCLE      ----DYRTFWTQFGKVLKEGLMSD--SDNRDTLLHISSFASTH---SDE-EPTTLAQYVE
HTPG_MYCGI      ----KYRTFWTQFGRVLKEGLLSD--TDNQETLLRVSSFASTR---SDD-EPTTLAEYVE
HTPG_MYCVP      ----KYRTFWTQFGRVLKEGLLTD--IENQETLLRVCSFASTH---SED-EPTTLAEYVE
HTPG_RHOJR      ----DYRTFWAEFGRAVKEGLMSD--TDNRDVLLGISSFASTH---SEE-ELTSLEDYVA
HTPG_NOCFA      ----KYQTFWREFGRVLKEGLLSD--FDNRETILQVSSFASTH---SDS-ELTTLAQYVE
HTPG_SALTO      ----KYRTFWTEFGAVVKEGLIDD--TENRDSLLEILSVASTH---DPA-EPTDLADYVT
HTPG_SALAI      ----KYRTFWTEFGAVVKEGLIDD--TENRDSLLEILSVASTH---DPA-EPTDLTGYVN
HTPG_FRACC      ----RYRTLWKEFGAALKEGLLED--ADNQDAILGLVSVDSTH---DAD-RPTTLREYIE
HTPG_STRCO      ----RYATFWREFGAVLKEGLVTD--SDNRDAILAACSFASTH---DAE-EPTALKDYVE
HTPG_GEOSL      ----SYLDFYKEFGPVLKEGVHFD--YANRDKLQDLLLFESTA---TDAGSFVSLKEYVE
HTPG_GEOMG      ----DYLAFYKEFGQVLKEGVHFD--YANREKLQDLLLFESTR---TEAGKFTSLKEYVE
HTPG_GEOUR      ----DYLKFYKEFGPVLKEGVHFD--HANKEKLQELILFESSK---TEAGNYISLKEYVA
HTPG_PELPD      ----EYVNFWKEFGPVLKEGLHFD--YANKEKLQELALFESTA---TEAGSFTSLKEYVE
HTPG_BDEBA      ----AYEDFWTEFGATLKEGLPSD--AANKEKLQDLLLFHSTS---SD--KMTTMDEYVA
HTPG_MYXXD      ----DYLTFWKAFGTVLKEGLATE--AEQKDKLGGLLRYESSR---EEG--LTSLADYVG
HTPG_METFK      --PEEYAKFWKEFGRVLKEGPGED--FANKERIAGLLRFASTH--ADTDEQVVSFKDYIA
HTPG_THIDA      --PEKYVEFWKEFGKVMKEGPGED--FANKEKIAGLLRFASTH--TDTDAQVVSLKDYVG
HTPG_CHRVO      --PEKYAEFWKEFGQVLKEGVGED--FANKERIAKLLRFVSTA--SEDAEPTVSLADYIG
HTPG_DECAR      --KEKYAKFWEAFGSVLKEGVGED--HANKEKIAGLIRFSSTH--NDTAEQNVSLADYIG
HTPG_AROAE      ADREKYATFWKEFGPVLKEGVGED--FANKDKIAGLLRFASTH--ADTPDEVVSLADYLA
HTPG_NITEC      EDQEKFKIFWREFGQVLKEGVAED--YSNRERIAKLLRFTSTH--DEQEEQTVSLDDYIA
HTPG_NITEU      EDQEKFKTFWREFGQVLKEGIAED--YSNRERIAKLLRFTSTH--DEREEQTVSLDDYIA
HTPG_NITMU      EGKAKFKTFWKEFGQVMKEGVAED--YANRERIAKLLRFVSTH--SDSEEQDVSLSDYVG
HTPG_BORBR      --AEDYATFWTEFGQVLKEGTGED--AANRERIARLLRFASTH--DGEQAQTVSFADYVG
HTPG_BORPA      --AEDYATFWTEFGQVLKEGTGED--AANRERIARLLCFASTH--DGEQAQTVSFADYVG
HTPG_BORPE      --AEDYATFWTEFGQVLKEGTGED--AANRERIARLLRFASTH--DGEQAQTVSFADYVG
HTPG_BORA1      --KDDYAVFWGEFGQVLKEGVGED--PSNQERIAKLLRFASTH--AGDASQTTSLQDYLG
HTPG_BURPS      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURMA      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURM7      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURP1      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURM9      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURMS      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURP0      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURP6      AGKEKYKTFWSAFGQVLKEGIGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURTA      AGKEKYKTFWSAFGQVLKEGVGED--HANRERVAKLLRFASTH--GDTDAQDVALADYVA
HTPG_BURCA      AGKEKYKTFWGAFGQVLKEGLGED--HANRERIAKLLRFASTH--GDTDAQDVSLADYVS
HTPG_BURCH      AGKEKYKTFWGAFGQVLKEGLGED--HANRERIAKLLRFASTH--GDTDAQDVSLADYVS
HTPG_BURCM      AGKEKYKTFWSAFGQVLKEGLGED--HANRERIAKLLRFASTH--GDTDAQDVSLADYVS
HTPG_BURL3      AGKEKYKTFWGAFGQVLKEGLGED--HANRERIAKLLRFASTH--GDTDAQDVSLADYVS
HTPG_PARXL      ADKEKYAGFWKEFGQVLKEGIGED--FANRERIAKLLRFASTH--TDTPEQTVSLADYVA
HTPG_CUPNH      AERAKYTTFWQQFGQALKEGIGED--QANLERVAKLLRFASTH--NDTAEQNVALAAYVG
HTPG_CUPPJ      AERAKYTTFWQQFGQALKEGLGED--NANQERIAKLLRFASTQ--NDNAEQSVSLAAYVG
HTPG_CUPMC      AERAKYKTFWEQFGQVLKEGVGED--HGNGERIAKLLRFATTH--GDTAEQSVSLVDYVG
HTPG_RALSO      AEKDKYATFWQHFGQVLKEGLGED--FANKDRIAKLLRFASTH--NAGDEQTVSLADYIG
HTPG_ACISJ      AKEGKYTQFYAEFGAVLKEGLGED--FANRERLAKLLRFAST----TSDTPSVSFADYKA
HTPG_VEREI      AKEGKYSQFYAEFGAVLKEGLGED--FANRERLARLLRFAST----SSDQASVGLADYKA
HTPG_RHOFT      ANEGKYSKFYAEFGAVLKEGLGED--YANKDRLAKLLRFASS----STDTVSVSFADYKA
HTPG_POLNA      --PEKFKTFYAEFGAVLKEGLGED--FANRERLAKLLRFASS----TTDTTTVSFADYKA
HTPG_POLSJ      --ADKFKAFYAEFGAVLKEGLGED--FANRERLAKLLRFASS----TTDTVSVGFADYKA
HTPG_METPP      ARRDQYAAFWREFGAVLKEGVGED--HANRERLAKLLRFAST----QAD-EGVSLADYLA
HTPG_PSYCK      DKQEKFAQFYAEFGDVIKEGVGED--MGNQERIAKLLRYATS----TQDSVTTSFEDYKA
HTPG_PSYA2      DKQEKFAQFYAEFGDVIKEGVGED--MGNQERIAKLLRYATS----TQDGEMTSFEDYKA
HTPG_ACIAD      KDQEKFKTFYQEFGSVLKEGLGED--FTNRERILKLLRYATS----NQDEISTSFADYKA
HTPG_ALKEH      ---EQYAEFYGNFGKVLKEGVAED--FANRERIAKLLRFSTTQ--DENETPDVSLDDYIA
HTPG_HALHL      ---EDYATFWQAFGRVFKEGIAED--PGNRERIARLLRFSSTH--EEKETPDVSLDDYVA
HTPG_NITOC      ---KKYQSFWKEFGQVMKEGVGED--SGNREQIARLLRFASTH--HDTAEQTVSLADYLS
HTPG_MAGMM      ---EKYATFWKEFGMVLKEGMIED--FANKERIAKLCRFSTTH--DGERVPKIALADYVE
HTPG_METCA      ---EKYQAFWKEFGQVLKEGLIED--FANKDRLAKLLRFSSTH--TDSEEQTVTLDEYVS
HTPG_COXBR      ---EKYASFWKAFGQVLKEGPAED--FANRDRIANLLRFASTH--NDTDEQNVSLQDYIS
HTPG_COXBU      ---EKYASFWKAFGQVLKEGPAED--FANRDRIANLLRFASTH--NDTDEQNVSLQDYIS
HTPG_COXBN      ---EKYASFWKAFGQVLKEGPAED--FANRDRIANLLRFASTH--NDTDEQNVSLQDYIS
HTPG_HAEIN      ---EKYLQFWKEFGLVLKEGPAED--FANKETVAKLLRFASTH--NDGSEQTVSLEDYIL
HTPG_HAEIE      ---EKYLQFWKEFGLVLKEGPTED--FANKETVAKLLRFASTH--NDGSEQAVSLEDYIL
HTPG_HAEI8      ---EKYLKFWKEFGLVLKEGPAED--FANKETIAKLLRFASTH--NDGSEQTVSLEDYIL
HTPG_HAEIG      ---EKYLQFWKEFGLVLKEGPAED--FANKETIAKLLRFASTH--NDGCEQTVSLEDYIL
HTPG_AGGAC      ---EKYQQFWKEFGLVLKEGPAED--FANKEAIAKLLRFASTH--NDSSEQNVSLEDYVS
HTPG_HAES1      ---EKYLQFWKEFGLVLKEGPSED--FANKENIAKLLRFASSK--NDSSEQTVSLEDYVA
HTPG_HISS2      ---EKYLQFWKEFGLVLKEGPSED--FANKENIAKLLRFASSK--NDSSEQTVSLEDYVA
HTPG_PASMU      ---EKYQRFWQEFGLVLKEGPAED--FANKETIAKLLRFASTH--NDSSQQSVSLEDYVA
HTPG_ACTSZ      ---EKYATFWKEFGLVLKEGVGED--FANREQIAKLFRFASTH--TDSSEQSVSLADYIA
HTPG_MANSM      ---EKYAVFWKEFGLVLKEGVAED--FANKEQIAKLYRFASTH--TDSSEQNVSFEDYIS
HTPG_ACTP2      ---AKYQTFWNEFGLVLKEGVGED--FANKQQIASLFRFASTQ--TDSSEQTVSLADYVG
HTPG_ECOLI      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECOL5      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECOHS      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECOL6      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SHIBS      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SHISS      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECO57      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECOLC      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECOUT      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECOK1      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_ECO24      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTY--TDSSAQTVSLEDYVS
HTPG_SHIFL      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTY--TDSSAQTVSLEDYVS
HTPG_SHIDS      ---EKYQTFWQQFGLVLKEGPAED--FANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SALPB      ---EKYQTFWKQFGLVLKEGPAED--HANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SALPA      ---EKYQTFWKQFGLVLKEGPAED--HANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SALTY      ---EKYQTFWKQFGLVLKEGPAED--HANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SALCH      ---EKYQTFWKQFGLVLKEGPAED--HANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SALTI      ---EKYQTFWKQFGLVLKEGPAED--HANQEAIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_CITK8      ---EKYQTFWKQFGLVLKEGPAED--HANQEAIAKLMRFASTH--TDSSAQTVSLEDYIS
HTPG_CROS8      ---EKYQTFWKQFGLVLKEGPAED--SANQEAIAKLLRFASTH--TDSAAQTVSLADYVS
HTPG_KLEP7      ---EKYQTFWKQFGLVLKEGPAED--PSNQEAIAKLLRFATTH--TDSSAQTVSLEEYVS
HTPG_ENT38      ---EKYQTFWKQFGLVLKEGPAED--SGNVESIAKLLRFASTH--TDSSEQTVSLEDYVS
HTPG_PECAS      ---EKYQTFWQQFGLVLKEGPAED--GSNREAIAKLLRFATTQ--SDSSAQTVSLEDYVS
HTPG_YERPA      ---EKYQQFWQQFGMALKEGPAED--GSNKETIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_YERPS      ---EKYQQFWQQFGMALKEGPAED--GSNKETIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_YERPN      ---EKYQQFWQQFGMALKEGPAED--GSNKETIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_YERPP      ---EKYQQFWQQFGMALKEGPAED--GSNKETIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_YERPE      ---EKYQQFWQQFGMALKEGPAED--GSNKETIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_YERE8      ---EKYQQFWQQFGMALKEGPAED--GSNKDTIAKLLRFASTH--TDSSAQTVSLEDYVS
HTPG_SERP5      ---EGYQKFWQQFGLVLKEGPAED--ANNKETIAKLLRFASTQ--SESSAQTVSLEEYVG
HTPG_PHOLL      ---EKYQQFWQQFGLVMKEGPAED--STNKEAIAKLLRFASTH--NDSSAQTVSLEEYVS
HTPG_SODGM      ---QQYQSFWQEFGLVLKEGAGED--PTNGEAVAKLLRFASTH--GDSPAQTVSLEEYVG
HTPG_BAUCH      ---EQYQNFWQHFGLVIKEGLAED--PNNSKSIARLLRFSTTH--SKSMEQNVSLDEYVS
HTPG_VIBCH      ---DNYQKFWKEFGLVMKEGPAED--FANREKIASLLRFASTH--IDSAEQTISLASYVE
HTPG_VIBC3      ---DNYQKFWKEFGLVMKEGPAED--FANREKIASLLRFASTH--IDSAEQTISLASYVE
HTPG_VIBPA      ---EKYQSFWKEFGLVLKEGPAED--FANKEKIAGLLRFASTE--VDSAEQTVGLASYVE
HTPG_VIBCB      ---EKYQSFWKEFGLVMKEGVAED--MANKEKVAGLLRFASTE--VDSAEQTVGLASYVE
HTPG_VIBVY      ---EKYQTFWKEFGLVMKEGPAED--YANREKVAALLRFASTE--VDSAEQTVSLESYVE
HTPG_VIBVU      ---DKYQTFWKEFGLVMKEGPAED--YANREKVASLLRFASTE--VDSAEQTVSLESYVE
HTPG_ALIF1      ---EKYLTFWKQFGQVLKEGLAED--LANKEKIAGLLRFATTE--KDSSEQALGLAGYVE
HTPG_PHOPR      ---EKYQTFWTEFGQVLKEGPAED--FSNREKIANLLRFSSTH--NDTADQTVSVADYVS
HTPG_AERHH      ---EKYAKFWSEFGNVLKEGPAED--YANREEIAKLLRFASTA--GEGEAQTVSLEDYVG
HTPG_AERS4      ---EKYAKFWSEFGNVLKEGPAED--YANREEIAKLLRFASTA--GEGEAQTVSLEDYVG
HTPG_PSEHT      ---DDYQVFWNEFGQVIKEGPAED--AANKEAICKLLRFSSTH--TDSATQDVSLEQYVE
HTPG_COLP3      ---DKYQGFWDEFGQVLKEGPAED--HANKEQVAGLLRFASTH--EDSTTQNVSLASYIE
HTPG_PSEA6      ---EKYQGFWAEFGNVLKEGPAED--HANKEKVAGLLRFASTE--NDSDAQNVSLADYVS
HTPG_IDILO      ---EQYQQFWDTFGNVLKEGPAED--HTNRERIAELLRFASTH--NDGAVQSVSLDDYIE
HTPG_PSYIN      ---DAYNLFWKEFGQVLKEGPAED--SSNKEKIGKLFRFSSTE--TDSTEQTVSLDAYIS
HTPG_SHEPA      ---EKYQSFWTEFGQVLKEGPAED--FANKERIAGLLRFASTH--TGEATPNVSLADYIE
HTPG_SHEHH      ---EKYQSFWTEFGQVLKEGPAED--FANKERVAGLLRFASTH--TGEATANVSLADYVE
HTPG_SHESH      ---EKYQTFWAEFGQVLKEGPAED--MVNKERIAGLLRFASTH--TEDAAPTVSLADYVS
HTPG_SHELP      ---EKYQTFWAEFGQVLKEGPAED--FANKEKIAGLLRFASTH--TNEAAHTVSLSDYVE
HTPG_SHEPC      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYIS
HTPG_SHESW      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYIS
HTPG_SHESM      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYLS
HTPG_SHESR      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYLS
HTPG_SHESA      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYLS
HTPG_SHEON      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYIS
HTPG_SHEB9      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYIS
HTPG_SHEB8      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYIS
HTPG_SHEB5      ---EKYQQFWAEFGQVLKEGPAED--FANRERIAGLLRFASTH--TGSAAPTVSLDDYIS
HTPG_SHEDO      ---GQYQSFWAEFGQVLKEGPAED--FANKERIAGLLRFASTH--EGSAATTVSLEDYIS
HTPG_SHEFN      ---EQYQSFWAEFGQVLKEGPAED--FANKERIAGLLRFASTH--DNSAATTVSLEAYIE
HTPG_SHEAM      ---DKYQQFWAEFGTVLKEGPAED--FANRERIAGLLRFASTH--TGDATPSVSLDDYIG
HTPG_BUCAI      ---EKYQIFWNQFGLVLKEGPAED--HENLNKIANLLRFTSMK--SNNSEQKMSLKEYIS
HTPG_BUCAP      ---EKYQIFWNQFGSVLKEGPAED--SNNLNLIASLLRFTSIQ--NNSSEQNISLEKYIS
HTPG_BUCBP      ---SKYEIFWKQFGLILKEGPAED--SENRTSISNLIRFSSLL--NNTQKPTMSLENYVK
HTPG_BUCCC      ---KKYQKFWNVFGIIIKEGIAED--SENKTILSNLLRFSSIK--KGNIEQTLSLNEYIK
HTPG_WIGBR      ---DEYKLFWKEFGLILKEGPSED--IKNYENVIKLFRFSSTY--INSENQEVSLEDYVK
HTPG_LEGPH      ---ETYQKFWNEFGLVLKEGPIED--FANKEAIAKLLRFSTTA--SGSEKQEVSLEEYVS
HTPG_LEGPC      ---ETYQKFWNEFGLVLKEGPIED--FANKEAIAKLLRFSTTA--SGSEKQEVSLEEYIS
HTPG_LEGPL      ---ETYQKFWNEFGLVLKEGPIED--FANKEAIAKLLRFSTTA--SGSEKQEVSLEEYVS
HTPG_LEGPA      ---ETYQKFWNEFGLVLKEGPIED--FANKEAIAKLLRFSTTA--SGSEKQEVSLEEYVS
HTPG_PSEAE      ---EQYKTFWKNFGQVLKEGPAED--FGNKEKIAGLLRFASTG--DDSGEQSVALADYIG
HTPG_PSEA7      ---EQYKTFWKNFGQVLKEGPAED--FGNKEKIAGLLRFASTG--GDSGEQSVALADYIG
HTPG_PSEMY      ---EEYKAFWKAFGQVLKEGPAED--FANKEKIAGLLRFASTA--GEGDEQSVSLADYLG
HTPG_PSEPF      ---EQYKGFWKNFGQVMKEGPAED--FANKEKIAGLLRFASTN--GTDGEQIVGLAEYLA
HTPG_PSEF5      ---EQYKGFWKNFGQVMKEGPAED--FANKEKIAGLLRFASTQ--GDDGEQNVSLADYLA
HTPG_PSEU2      ---EKYKGFWKNFGQVLKEGPAED--FANKEKIAGLLRFASTS--DDSGEQSVSLAEYLA
HTPG_PSE14      ---EQYKGFWKNFGQVLKEGPAED--FANKEKIAGLLRFASTS--DDSGEQSVSLAEYLA
HTPG_PSESM      ---EQYKGFWKNFGQVLKEGPAED--FANKEKIAGLLRFASTS--DDSGEQSVSLADYLA
HTPG_PSEPK      ---EKYKGFWKNFGQVLKEGPAED--FANKEKIAGLLRFASTQ--DDSGEQSVALADYLA
HTPG_XANC5      ---DDYATFWRNFGQALKEGPAED--YANREKIAGLLRFSSTH--DTTGAQSVGLADYVS
HTPG_XANAC      ---DDYATFWRNFGQALKEGPAED--YANREKIAGLLRFSSTH--DTTGAQSVGLADYVG
HTPG_XANOM      ---DDYATFWRNFGQALKEGPAED--YANREKIAGLMRFSSTH--DTTGAQSVGLADYVS
HTPG_XANOR      ---DDYATFWRNFGQALKEGPAED--YANREKIAGLMRFSSTH--DTTGAQSVGLADYVS
HTPG_XANCP      ---DDYATFWRNFGQALKEGPAED--YANREKVAGLLRFSSTH--DTTGAQSVALADYVG
HTPG_XANC8      ---DDYATFWRNFGQALKEGPAED--YANREKVAGLLRFSSTH--DTTGAQSVALADYVG
HTPG_XYLFA      ---EDYKTFWKNFGQVLKEGPAED--YSNREKVASLLRFASTY--DTSGDPSVALADYIA
HTPG_XYLFT      ---EDYKTFWKNFGQVLKEGPAED--YSNREKVASLLRFASTY--DTSGDPSVALTDYIA
HTPG_SACD2      ---EKYATFWKEFGEVLKEGPAED--FANKEKIAKLLRFATTH--KNTNEQDQSLDAYIE
HTPG_MARHV      ---DEYQGFWDEFGTVLKEGPAED--FSNREKIAGLLRFASTH--TGEATQNVSLDDYIS
HTPG_HAHCH      ---EKYQSFWDEFGRVLKEGPAED--FINREKIAKLMRFSSTH--QDDDKQTQSLEDYVS
HTPG_MARMS      ---EDYQKFWDEFGNVIKEGPADD--MGNKDKIAGLLRFSSTH--TDAAAQTVSLADYIE
HTPG_CHRSD      ---EAYQTFWNAFGNVLKEGPAED--FANRDKIADLLRFSSTQ--TDSATQDQSLAGYVS
HTPG_ALCBS      ---KQYAKFWAQFGSVIKEGVAED--RDNQQSIAALLRFATSK--TPDSV-STSLDQYLE
HTPG_RUTMC      ----DYEKFWQEFGMVMKEGVVED--FANKDKIAKLLRFTTNK--SESAAQTATLECYVK
HTPG_VESOH      ----DYATFWQEFGMLMKEGVVED--TINKDKIAKLLRFTTNK--SKNATQTVTLEHYIK
HTPG_HYDCU      ----DYETFWDQFGNVMKEGVIED--FANKDKIAKLLRFSSTHE-SSGPTQRVSLQDYID
HTPG_FRAT1      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTQ--SGDSKQTVSLADYIS
HTPG_FRATT      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTQ--SGDSKQTVSLADYIS
HTPG_FRATW      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTQ--SGDSKQTVSLADYIS
HTPG_FRATN      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTQ--SGDSKQTVSLADYIS
HTPG_FRATF      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTQ--SGDSKQTVSLADYIS
HTPG_FRATH      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTQ--SGDSKQTVSLADYIS
HTPG_FRAP2      ---EKYQKFWDSFGQVLKEGVSDD--YSNKEKIAGLLRFATTE--SGDAKQTVSLADYVS
HTPG_PELLD      ---EKFRTFYKAFGPIVKIGLNTDFTNRDK--LIELLRFESTK--TGEGE-YVTLKEYAA
HTPG_CHLPM      ---EKFKTFYKAFGPIVKIGLNTDFTNRDK--LIELLRFESTK--TGEGE-FVTLKEYVA
HTPG_CHLCH      ---EKFKTFYKAFGPIIKIGLNTDFTNREK--LIELLRFESTK--TEEGE-FVTLREYVE
HTPG_CHLPD      ---EKFRKFYKAFGPFLKIGLNTDFTHRDR--IIGLMRFESTK--TAEGE-YVTFKEYVE
HTPG_CHLTE      ---EKFRAFYKAFGTILKIGLNTDFTNRDK--LIDLLRFETTK--TVEGE-YVTLKEYVG
HTPG_DESHY      ---EIFKEFWNEFSIFLKEGAANDFTHRQE--ILKLLRFESSK--TGEGE-LISLGDYVG
HTPG_DESPS      ---SQYLQFWSTFGIYLKEGVTTDYEYQKE--LGKLLRFETSK--SELGV-PVSLADYLL
HTPG_DESAG      ---EKYATFWRTHGRVFRMGYN-DYINRDK--FIPLLRFNSSA--LDDEKGLCSLDDYIG
HTPG_DESVH      ---EAYATFWRQHGKVFKLGYS-DYANREK--FAPLLRFNSSH--HDDAQGLTSLDDYIS
HTPG_BACFR      ---AQFEEKWNDLKIFINYGMLTQ--EDFYDKAQKFALFTDTDGKYYTFEEYQTLIKDNQ
HTPG_BACFN      ---AQFEEKWNDLKIFINYGMLTQ--EDFYDKAQKFALFTDTDGKHYTFEEYQTLIKDNQ
HTPG_BACTN      ---KQFEEKWNDLKIFINYGMLTQ--EDFYEKAQKFALFTDTDNKHYTFEEYQTLIKDNQ
HTPG_PORGI      ---PTFEEKWDSLKLFVEYGMLTD--EKFYERAAKFFLFTDMDGHKYTFDEYRTLVEGVQ
                                .. *                                  .     

HTPG_BACSU      RMPEEQKFIYYATGDSY-DRIEKLPQTEMVADKGYEILYFTE-DIDEFAIKMLASYQEKE
HTPG_BACVZ      RMPEDQKYIYYASGDSY-ERIEKLPQTEMVADKGYEILYFTE-DIDEFAIKMLTSYEEKE
HTPG_BACLD      RMPEDQKYIYYASGDSY-DRIEKLPQTELVSEKGYEILYFTE-DIDEFAIKMLANYQEKE
HTPG_BACHD      RMKEDQPYIYYATGESY-ARIEKLPQTEMVADKGYEILYFTE-DVDEFAIKMLASYKEKE
HTPG_BACSK      RMKEGQTYIYYATGESN-ERIAKLPQTEMVADQGYEILYFTE-DVDEFAIKMLRSYDEKE
HTPG_OCEIH      CMPEDQKYIYYATGDSR-DRIEKLPQTELVADKGYEILYFTD-EIDEFAIKMLMNYDEKE
HTPG_CLOBH      RMPEDQKYIYYAVGESN-ERIEKLPQIEGVLDKGYEVLYFTD-DIDEFAIKMLMSYKEKE
HTPG_CLOB1      RMPEDQKYIYYAVGESN-ERIEKLPQIEGVLDKGYEVLYFTD-DIDEFAIKMLMSYKEKE
HTPG_CLOBL      RMPEDQKYIYYAVGESN-ERIEKLPQIEGVLDKGYEVLYFTD-DIDEFAIKMLMNYKEKE
HTPG_ALKMQ      RMKEDQKYIYYASGDSI-EKIDKMPQTELLAEQGYEILYFAD-DVDEFAIRVLVDYKEKE
HTPG_ALKOO      RMSEEQKYIYYATGESK-ERIEKLPQTELVSEKGFEILYLTE-DIDEFAIKVLMSYKDKE
HTPG_CLOP1      RMAEDQKYIYYAVGESN-ERIEKMPQTEMVLDKGYEILYFTE-DVDEFAIKMLMNYKEKE
HTPG_CLOPE      RMAEDQKYIYYAVGESN-ERIEKMPQTEMVLDKGYEILYFTE-DVDEFAIKMLMNYKEKE
HTPG_CLOPS      RMAEDQKYIYYAVGESN-ERIEKMPQTEMVLDKGYEILYFTE-DVDEFAIKMLMNYKEKE
HTPG_CLOAB      RMKEDQKYIYYAAGESN-EKIEKLPQTEVVKDKGYEILYFTD-DVDEFAIKMLMKYKEKE
HTPG_CLOTE      RMKDDQKYIYYAPGENI-DKIEKLPQTEIVRDKGYEILYFAD-EVDEFAIKMLMNYKEKE
HTPG_FUSNN      RMG-DNKEILYVPAESV-DAAKYLPKMEKLKEQGREVLILTD-KIDEFTLMAMRDYSGKE
HTPG_RHIME      EMKEGQSAIYYLTGDNL-AQLKASPQLEGFRARGIEVLLLTC-PVDSFWVTTAPDFDGKP
HTPG_RHIEC      DAKEGQDAIYYLAGGSL-DQLKASPQLEGFRARGIEVLLLTD-SVDSFWVVNAPEFEGKA
HTPG_NITWN      ALKENQTSIYYLAGQDA-ARLEASPHLEGFRARGVEVLLLSD-PVDSFWVTSGPSFEGKP
HTPG_NITHX      ALKDNQTSIYYLAGQDA-ARLEASPHLEGFRARGVEVLLLSD-PVDSFWVTSAPSFEGKP
HTPG_AZOC5      DLKENQTAIYYITG-DL-ARVEHAPQLEGFRARGVEVLLLPD-QVDSFWVTAGVDYEGKP
HTPG_RHILO      AMKEGQKAIFFMAGDDR-ARLEASPQLEGFKARGIEVLLLTD-PVDSFWVTMAPDFDGKP
HTPG_RHOP2      AMKENQTEIYYLVGDSL-DRLKANPKLESAAARGIEVLLLTD-AVDAFWTSGGLDFGGKP
HTPG_RHOPS      AMKENQTEIYYLVGDSI-ERLKSNPKLESATARGIEVLLLTD-GVDAFWTSGQLDFGGKP
HTPG_RHOPA      AMKENQTEIYYLVGDSL-ERLKSNPKLESATARGIEVLLLTD-PVDAFWTSGQLDFGGKP
HTPG_RHOP5      DLRDNQTEIYYLVGDSL-ERLKSNPKLESAAARGIEVLLLTD-PVDAFWTSAPLDFGGKP
HTPG_RHOPB      DLKENQTEIYYLVGDSI-ERLKSNPKLESAAARGIEVLLLTD-PVDAFWTSAPLDFGGKP
HTPG_BRADU      DFKPNQTEIYYLVGDSI-ERLKSNPRLEAATARGIEVLLLSD-PVDAFWTSMPTEFEGKP
HTPG_GLUOX      RMKDGQDAIYYLTGDSL-DALKSSAQLEGFRARGLEVLLLSD-PVDGFWPERLSSYQEKP
HTPG_MAGSA      RMKDGQDAIYTITGDDL-DQLKKSPQLEGFAAKGVEVLLLTD-PIDEFWVSAVRSYAEKD
HTPG_RHORT      RMKEGQSALYYITGDDA-TALARSPQVEGFVARGVEVLLLTD-PIDEFWVSAVPKVGDTA
HTPG_ROSDO      RCKEGQDAIYYIAGDDA-RKIAQSPHLEGFRAKDVEVLLLSD-HVDEFWLQHITEFEGKP
HTPG_RICRS      NFKEGQSTIYYLSGDNP-DKLLSSPQIEGLLSKKIDVLLFTD-TVDDFWVNVNSKYKEHA
HTPG_RICRO      NFKEGQSTIYYLSGDNP-DKLLSSPQIEGLLSKKIDVLLFTD-TVDDFWVNVNSKYKEHA
HTPG_RICCN      NFKEGQSTIYYLSGDNP-DKLLSSPQIEGLLSKKIDVLLFTD-TVDDFWVNVNSKYKEHA
HTPG_RICFE      GFKEGQNTIYYLSGDNP-DKLLSSPQIEGLLSKNIDVLLFTD-TVDDFWVNVNSEYKGHA
HTPG_RICAH      GFKEEQNTIYYLSGDNP-DKLLSSPQIEGLLSKNIDVLLFTD-TVDDFWVNVNSEYKGHA
HTPG_RICCK      NFKEGQNTIYYLSGDNP-DKLLSSPQIEGLLSKNIDVLLFTD-TVDDFWVNVNSEYKGHA
HTPG_RICBR      GFKEGQNTIYYLSGDNP-DKLLSSPQIEGLLSKNIDVLLFTD-TVDDFWVNVNSEYKGHT
HTPG_RICB8      GFKEGQNTIYYLSGDNP-DKLLSSPQIEGLLSKNIDVLLFTD-TVDDFWVNVNSEYKGHA
HTPG_RICTY      NFKEGQNTIYYLSGDNP-DKLLSSPQIEGLLNKNIDVLLFTD-TVDDFWVNVNSEYKGYA
HTPG_RICPR      NFKEGQNTIYYLSGDNP-DKLLSSPQIEGLLNKNIDVLLFTD-TVDDFWVNVNSEYKGYA
HTPG_ORITB      NLKSEQKNIYYITGDDL-EALKSSPQIEGLLSRNIDVLLLTD-DVDKFWVMVTRKYNDYV
HTPG_EHRCJ      RMKEGQDNIYYLTGNDL-DSIKKSPQLEGFVSRGIEVILLID-PVDDFWTNVVTDYQRVP
HTPG_EHRCR      RMKAGQDNIYYLTGNDL-DSVKKSPQLEGFISRGIEVILLVD-PVDDFWTNVVTDYQKVP
HTPG_EHRRW      RMKPEQNNIYYLTGNDL-DSIKKSPQLEGFVSRGIEVLLLVD-PVDDFWTNVVTDYQKVP
HTPG_EHRRG      RMKPEQNNIYYLTGNDL-DSIKKSPQLEGFVSRGVEVLLLVD-PVDDFWTNVVTDYQKVP
HTPG_WOLPM      RMKPEQEHIYYLTGNSL-DSVKNSPQLEGFVSKGLEVLLFVD-PVDDFWTSVIHEYKDQK
HTPG_WOLTR      RMKPEQGYIYYLTGNSL-DSVKNSPQLEGFISKGLEVLLFVD-PVDDFWTSVIHEYKGQK
HTPG_ANAPZ      RMKPGQESIFYLSGDDL-ESTKRSPQIEKLVSSGIEVILLVD-PVDDFWTSVVSEYKGVP
HTPG_ANAMM      RMKPGQEHIFYLSGNDL-ESAMRSPQIEGMVSNGIEVVLLVD-PVDDFWTSVVLEYKGVP
HTPG_NEOSM      DMHPEQKEIYCLCSTSF-ESAKNSPQLEGFVSRGLDVLFFTD-PVDDFWISVSHEYKSYN
HTPG_TREDE      RMKSDQKAIYYITGEDE-KTLRQSPHLEVYKQKGFEVLIMPD-EIDDIIIPSLGKYKDWE
HTPG_TREPA      RMKPDQKAIYYIAGNDD-RVLRQSPHAESYRLQGFEVLVMSD-DIDGIVMPSVSKYKEWE
HTPG_HELPH      NLKENQKSIYYLLGENL-DLLKASPLLEKYAQKGYDVLLLSD-EIDAFVMPGVNEYDKTP
HTPG_HELPJ      NLKENQKSIYYLLGENL-DLLKASPLLEKYAQKGYDVLLLSD-EIDAFVMPGVNEYDKTP
HTPG_HELPY      NLKENQKSIYYLLGENL-DLLKASPLLEKYAQKGYDVLLLSD-EIDAFVMPGVNEYDKTP
HTPG_HELAH      NLKENQKSIYYLLGENL-DLLKASPILEKYAQKGYDVLLLSD-EIDAFVMPSVNEYDKMP
HTPG_HELHP      SMGNEQKSIYYMLGENK-DALKNAPLLEKFAQKGFDVLLLSD-EIDAIVMPMVGEYDKVP
HTPG_WOLSU      RMKEGQKAIYYLMGENA-DLLQNSPLLEKFKKREIEVLFFDE-EIDSIVMPMVNQYGDLP
HTPG_CAMJJ      DLQGEQKEIFYIAGNNE-SLLRTSPLLEEYKQKNIEVLLMDD-EIDSLVTPML-EFEGLK
HTPG_CAMJ8      DLQGEQKEIFYIAGNNE-SLLRTSPLLEEYKQKNIEVLLMDD-EIDSLVTPML-EFEGLK
HTPG_CAMJR      DLQGEQKEIFYIAGNNE-SLLRTSPLLEEYKQKNIEVLLMDD-EIDSLVTPML-EFEGLK
HTPG_CAMJE      DLQGEQKEIFYIAGNNE-SLLRTSPLLEEYKQKNIEVLLMDD-EIDSLVTPML-EFEGLK
HTPG_CAMJD      DLQGEQKEIFYIAGNNE-SLLRTSPLLEEYKQKNIEVLLMDD-EIDSLVTPML-EFEGLK
HTPG_CAMHC      SMAAEQKEIYYISGGKA-ETLKNSPLLEEFNAKNIEVLICDD-EIDTIIMPMIGEFDKTP
HTPG_SULNB      RGDSEKKEIYYIVGADE-KVLRNSPLLEAYKKANIEVLIMDDEEVDSIVAPMIGSYKEWT
HTPG_ARCB4      RANSEQKAIYYIVGENE-KVLRNSPLLESYKKNDIEVLILDDKEIDEIITPAIGAFKEWE
HTPG_BORBP      RMKESQKSIYYITGGKE-NILKENPIVSAYKEKGFEILIMDD-ELDEAILNLIPEYEGLK
HTPG_BORBU      RMNESQKSIYYITGGKE-NILKENPIVAAYKEKGFEILIMDD-ELDEAILNLIPEYEGLK
HTPG_BORAP      RMNEGQKSIYYITGGKE-NILKENPIVTAYKEKGFEILIMDD-ELDEAILNLIPEYEGLK
HTPG_SULDN      NVDETKKEIYYITGKTSLSMLKSSPALERFKSRGINVLVLNE-EIDTIIFPMVTEYKEYK
HTPG_MYCTA      RMKDGQQQIFYATGETR-QQLLKSPHLEAFKAKGYEVLLLTD-PVDEVWVGMVPEFDGKP
HTPG_MYCBO      RMKDGQQQIFYATGETR-QQLLKSPHLEAFKAKGYEVLLLTD-PVDEVWVGMVPEFDGKP
HTPG_MYCBP      RMKDGQQQIFYATGETR-QQLLKSPHLEAFKAKGYEVLLLTD-PVDEVWVGMVPEFDGKP
HTPG_MYCTU      RMKDGQQQIFYATGETR-QQLLKSPHLEAFKAKGYEVLLLTD-PVDEVWVGMVPEFDGKP
HTPG_MYCA1      RMKEGQTQIFYATGETR-QQILKSPHLEAFKAKGYEVLLLTD-PVDEVWVGTVTEFDGKP
HTPG_MYCPA      RMKEGQTQIFYATGETR-QQILKSPHLEAFKAKGYEVLLLTD-PVDEVWVGTVTEFDGKP
HTPG_MYCUA      RMKEDQTQIFFATGDSR-QQILKSPHLEAFRAKGYEVLLLTE-PVDEVWVGVVNEFDGKP
HTPG_MYCLE      RMKDGQDQIFYATGESR-QQVMNSPHLEAFKAKGYEVLLLTD-PVDEVWVGMAPEFDGKP
HTPG_MYCGI      RMPEGQTQIFYAAGESR-QQLLNSPHLEAFKAKGYEVLLLTD-PVDEVWVESIHEFDGKP
HTPG_MYCVP      RMPDGQSQIFYAAGESR-QQLLHSPHLEAFKAKGYEVLLLTD-PVDEVWVESVHEFDGKP
HTPG_RHOJR      RMKDGQEQIFYATGESR-QLLESSPHMEAFRAKGFEVLLLTD-PVDEMWVGAVPEFDGKS
HTPG_NOCFA      RMPEGQDAIYYMTGESR-QQVESSPHMEAFKAKGREVLILTD-PVDEMWVGSVPEFDGKR
HTPG_SALTO      RMKDGQTDIYYATGENR-STIENSPHMEAFRAKGFEVLLLTD-PVDEVWVERVGEYEGKT
HTPG_SALAI      RMKDGQSEIYYATGENR-TTIENSPHMEAFRAKGFEVLLLTD-PVDEVWVERVGEYDGKT
HTPG_FRACC      RMKDAQNEIYYLTGDSR-GMIENSPHMEAFRAKGYEVLILTD-PVDEVWVERVAEFDGKP
HTPG_STRCO      RMKEGQDDIYYMTGESR-QAIENSPHMEAFRAKGVEVLLLTD-AVDEVWVDAVGEYEGKT
HTPG_GEOSL      RMPEGQEEIYFITGTSR-AALEQSPHLEIFRKKGYEVLFLTD-PVDEWVVQGLPEYGGKK
HTPG_GEOMG      RMPAGQEEIYFITGTSR-TALEQSPHLEIFRKKEYEVLFLTD-PVDEWVVQGVTEYDGKK
HTPG_GEOUR      RMPEAQKEIYYITGASR-SALENSPHLEIFRKKGFEVLYMTD-PVDEWVVQSLTDYDGKK
HTPG_PELPD      RMPEAQQEIYFITGDSR-ATLKISPHLEAFKAKGYEVLFLTD-PVDEWVVQALTEYKEKK
HTPG_BDEBA      RMKETQKDIYYITGDSL-SQVSNSPYLEKLKEKGFEVLLLVD-PVDEWVVDALSEFKGKK
HTPG_MYXXD      RMKEGQEAIYYVYGESR-KAVADSPHLEALKQRGFEVLYMTD-PVDEWAAQGLREFQGKP
HTPG_METFK      RMKEGQEAIYYITADSF-AAAKHSPHLEIFRKKGIEVLLLSD-RVDEWLVSSLTEFDGKK
HTPG_THIDA      RMKEGQTAIYYITADSF-AAAQHSPHLEIFRKKGIEVLLLSD-RVDEWLTGNLHEFDGKP
HTPG_CHRVO      RMKEGQDKIYYITADTL-AAAKNSPHLEVFKKKGVEVLLLTD-RVDEWVTGSLFEFDGKA
HTPG_DECAR      RMKEGQEKIYFVTADTF-NAAKNSPHLEIFRKKGIEVLLLSD-RVDEWVVGHLTEFDGKH
HTPG_AROAE      RMKEGQDKIYYVTAESF-NAAKNSPHLEIFRKKGIEVLLLTD-RVDEWVIGNLPEFDGKA
HTPG_NITEC      RMKPEQEKIYYITADGL-KAAQSSPHLEIFRKKGIEVLLLHD-RIDEWLTANLNEYAGKS
HTPG_NITEU      RMKPEQEKIYYITADGL-KAAQSSPHLEIFRKKGIEVLLLCD-RIDEWLVANLNEYTGKS
HTPG_NITMU      RMKDGQEKIYYVTADSL-TAAKSSPHLEIFRKKDIEVILLFD-RVDEWLVANLPEFEGKH
HTPG_BORBR      RMKDGQDKIYYVTADTF-TAAANSPHLEIFRKKGIEVLLLSD-RVDEWMLSYLREFDGKS
HTPG_BORPA      RMKDGQDKIYYVTADTF-TAAANSPHLEIFRKKGIEVLLLSD-RVDEWMLSYLREFDGKS
HTPG_BORPE      RMKDGQDKIYYVTADTF-TAAANSPHLEIFRKKGIEVLLLSD-RVDEWMLSYLREFDGKS
HTPG_BORA1      RLKEGQDKIYYVTADSY-SAASNSPHLEIFRKKGIEVLLLWD-RVDEWMLSHLREFEGKS
HTPG_BURPS      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURMA      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURM7      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURP1      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURM9      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURMS      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURP0      RMKPEQTKLYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURP6      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURTA      RMKPEQTKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURCA      RMKPEQSKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURCH      RMKPEQSKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURCM      RMKPEQSKIYYVTADTW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHEFDGKP
HTPG_BURL3      RMKPEQSRIYYVTADAW-QAAKNSPHLEVFRKKGVEVLLLTD-RVDEWMLSFLQEFDGKP
HTPG_PARXL      RMKPEQTKIYYVTADTW-QAATHSPHLEVFRKKGVEVLLLTD-RVDEWILSFLTEFEGKP
HTPG_CUPNH      RMKEGQDKIYYVTADTW-SAAKNSPHLEVFRKKGIEVLLLTD-RVDEWMLSFLREFDGKE
HTPG_CUPPJ      RMKEGQDKIYYVTADTW-AAAKNSPHLEVFRKKGIEVLLLTD-RVDEWMLSFLREFDGKE
HTPG_CUPMC      RMKEGQDKIYYVTADTW-VAAKSSPHLEVFRKKGIEVVLLTD-RVDEWLLSYLHEFDGKQ
HTPG_RALSO      RMKDGQDKIYYVSAENW-TAAKSGPHLEVFRKKGVEVLLLTD-RVDEWMLSFLHDFEEKA
HTPG_ACISJ      RMKEGQEAIYYITADTL-AAAKNSPQLEVFKKKGIEVLLMTD-RVDEWALNYLQDFDGTP
HTPG_VEREI      RMKEGQEAIYYITADTL-AAAKHSPQLEVFKKKGIEVLLMTD-RVDEWALNYLHEFDGTP
HTPG_RHOFT      RMKEGQEAIYYITADTP-AAAKNSPQLEVFKKKGIEVLLMTD-RVDEWALNYLQEFDGTP
HTPG_POLNA      RMKDGQDAIYYITADTL-AAAKSSPQLEIFRKKGIEVLLMAD-RVDEWALNYLNEFDGTP
HTPG_POLSJ      RMKEGQDAIYYVTADTL-AAAKSSPQLEIFRKKGIEVLLMAD-RVDEWALNYLHEFDGTP
HTPG_METPP      RMKDGQEAIYYITADTT-AAARHSPQLEVFRKKGIEVLLLTD-RVDEWMLSHLFEFEGKP
HTPG_PSYCK      RMKEGQKAIYYLTADNL-AAAKNSPQLELFKKKGIEVILMTS-RVDEWAMNFLTSFDETP
HTPG_PSYA2      RMKDGQKAIYYLTADNL-AAAKNSPQLELFKKKGIEVILMTS-RVDEWAMNFLTSFDETP
HTPG_ACIAD      RMKEGQKAIYYVSADSL-AAAKNSPQLELFKKKGIEVLLMSE-RVDEWAMNFVHEFDGTP
HTPG_ALKEH      RMKEGQEAIYYVTAESF-NAARNSPHLEVFRKKGVEVLLLPD-PVDEWVITHLNEYDGKP
HTPG_HALHL      RMKDGQEKIYYVTAESF-NAARNSPHLEIFRRHGIEVLLLPD-PVDEWLVAHLHEYDGKQ
HTPG_NITOC      RMKEGQDKIYYITADSF-PAAKSSPHLEVFRKKGIEVLLLSD-RVDEWLVASLPEFEGKS
HTPG_MAGMM      RMKEGQEAIYYVTGESF-EACSSSPHLEIFRKKGIEVLLLSD-RVDEWTVTHLTEFDGKP
HTPG_METCA      RMKEGQDKIYFVSAESF-GAARNSPHLEIFRKKDIEVLLLSD-RIDEWLVSYLTEYEGKP
HTPG_COXBR      RMKPEQNKIYYIVADTY-TSAKNSPLLEVFRKKDIEVLLMSD-RVDEWLVAHLNEFEGKS
HTPG_COXBU      RMKPEQNKIYYIVADTY-TSAKNSPLLEVFRKKDIEVLLMSD-RVDEWLVAHLNEFEGKS
HTPG_COXBN      RMKPEQNRIYYIVADTY-TSAKNSPLLEVFRKKDIEVLLMSD-RVDEWLVAHLNEFEGKS
HTPG_HAEIN      RMKEGQKAIYYITADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKQ
HTPG_HAEIE      RMKEGQKAIYYITADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKQ
HTPG_HAEI8      RMKEGQKAIYYITADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKQ
HTPG_HAEIG      RMKEGQKAIYYITADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKQ
HTPG_AGGAC      RMKEGQKAIYYITADSY-VAARNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKP
HTPG_HAES1      RMKEGQKAIYYITADSY-IAAKNSPHLELFNKKDIEVLLLSD-RIDEWMLSYLTEFDGKQ
HTPG_HISS2      RMKEGQKAIYYITADSY-IAAKNSPHLELFNKKDIEVLLLSD-RIDEWMLSYLTEFDGKQ
HTPG_PASMU      RMKEGQKAIYYITADTY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKP
HTPG_ACTSZ      RMKEGQKAVYYITADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKP
HTPG_MANSM      RMKEGQKAVYYITADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWMLSYLTEFDGKP
HTPG_ACTP2      RMKEGQKAIYFLTADSY-VAAKNSPHLELFNKKGIEVLLLSD-RIDEWVVGHLTEFDGKP
HTPG_ECOLI      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECOL5      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECOHS      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECOL6      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_SHIBS      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_SHISS      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECO57      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECOLC      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECOUT      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECOK1      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_ECO24      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_SHIFL      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_SHIDS      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKP
HTPG_SALPB      RMKEGQEKIYYITADSY-AAAKNSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_SALPA      RMKEGQEKIYYITADSY-AAAKNSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_SALTY      RMKEGQEKIYYITADSY-AAAKNSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_SALCH      RMKEGQEKIYYITADSY-AAAKNSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_SALTI      RMKEGQEKIYYITADSY-AAAKNSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_CITK8      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_CROS8      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMSYLTEFDGKA
HTPG_KLEP7      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMSYLTEFDGKA
HTPG_ENT38      RMKEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLLSD-RIDEWMMNYLTEFDGKA
HTPG_PECAS      RMVEGQDKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSE-RIDEWMMSYLTEFDGKS
HTPG_YERPA      RMAEGQEKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFEGKA
HTPG_YERPS      RMAEGQEKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFEGKA
HTPG_YERPN      RMAEGQEKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFEGKA
HTPG_YERPP      RMAEGQEKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFEGKA
HTPG_YERPE      RMAEGQEKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFEGKA
HTPG_YERE8      RMAEGQEKIYYITADSY-AAAKNSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFDGKA
HTPG_SERP5      RMAEGQEKIYYITADSY-AAAKSSPHLELFRKKGIEVLLLSD-RIDEWMMSYLTEFDGKP
HTPG_PHOLL      RMTEGQDKIYYITADSY-AAAKNSPHLELFRKKGIEVLLLSE-RIDEWMMGYLTDFDGKK
HTPG_SODGM      RMVEGQEKIYYITADSY-AAAKSSPHLELLRKKGIEVLLFSD-RIDEWMMSYLTEFDGKA
HTPG_BAUCH      RIAEQQEKIYYIIADSY-AAANSSPHLELLQKKGIEVLLLHE-RIDAWMMNYLIEFNGKS
HTPG_VIBCH      RMKEGQDKIYYLTADSY-TAAKNSPHLEQFKSKGIEVILMFD-RIDEWLMNYLPEFEGKA
HTPG_VIBC3      RMKEGQDKIYYLTADSY-TAAKNSPHLEQFKSKGIEVILMFD-RIDEWLMNYLPEFEGKA
HTPG_VIBPA      RMKEGQDKIYYLTADSY-AAAKNSPHLEQFKAKGIEVILMFD-RIDEWLMNYLTEFDGKQ
HTPG_VIBCB      RMKEGQDKIYFLTADSY-AAAKNSPHLEQFRAKGIEVILMFD-RIDEWLMNYLTEFDGKQ
HTPG_VIBVY      RMKEGQDKIYYLTADSY-AAAKNSPHLEQFKAKGLEVILMFD-RIDEWLMNYLTEFDGKQ
HTPG_VIBVU      RMKEGQDKIYYLTADSY-AAAKNSPHLEQFKAKGLEVILMFD-RIDEWLMNYLTEFDGKQ
HTPG_ALIF1      RMKEEQDKIFYLTADSY-AAAKNSPHLEQFKAKGIEVVLMYD-RIDEWLMSYLTEFDGKQ
HTPG_PHOPR      RMKEGQEKIYFLTADSF-TAAKNSPHLEQFRAKGLEVILMHD-RIDEWLMSQLPEFDGKP
HTPG_AERHH      RMKEGQQKIYYITADSY-AAAKNSPHLEIFRKKGVEVLLMWE-RVDEWLMSHLTEFDGKQ
HTPG_AERS4      RMKEGQQKIYYITADSF-AAAKNSPHLEIFRKKGVEVLLMWE-RVDEWLMSHLTEFDGKQ
HTPG_PSEHT      RMNEGQEKIYYVVADTF-TAAKNSPHLEIFRKKGIEVLLLSD-RVDEWMMSHLTEFADKQ
HTPG_COLP3      RMKEGQDKIYFVVADSF-EAAKNSPHLEVFRKKGIEVLLMSD-RIDEWLVSHLTEFDGKQ
HTPG_PSEA6      RMKDGQDKIYYITADSY-KAAKSSPHLEIFRKKGIEVLLMSD-RVDEWLMSHLTEFDEKS
HTPG_IDILO      RMKEGQDKIFYIVADSY-EAARNNPALEIFNKKGIEVLLLSE-RIDEWLMSHLTEFKEKQ
HTPG_PSYIN      RMTEGQDKIYYITADSF-NAAKNSPHLEVLREKGIEVLLLSD-RIDEWLLSHLPEYDGKT
HTPG_SHEPA      RMQEGQSKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEFDGKK
HTPG_SHEHH      RMKEGQSKIYFIVADSY-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEFDGKK
HTPG_SHESH      RMQEGQSKIYYIVADSH-EAAANSPHLELLRKKGIEVVLMSE-RIDEWLINHLTDFDGKQ
HTPG_SHELP      RMKEGQSKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLSEFDGKQ
HTPG_SHEPC      RMKEGQTKIYYIVADSY-DAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHESW      RMKEGQTKIYYIVADSY-DAAANSPHLELLRKKDIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHESM      RMKEGQTKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHESR      RMKEGQNKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHESA      RMKEGQNKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHEON      RMKEGQTKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHEB9      RMKEGQTKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHEB8      RMKEGQTKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHEB5      RMKEGQTKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEYKEKQ
HTPG_SHEDO      RMKEGQDKIYYIVADSH-EAAANSPHLELLRKKGIEVLLMSE-RIDEWLINHLTEFKGKK
HTPG_SHEFN      RMKAGQDKIYYIVADSH-EAAANSPHLELLRKKGIEVLLLSE-RIDEWLVNHLTEFKDKK
HTPG_SHEAM      RMKEGQEKIYYIVADSH-EAAANSPHLELLKKKGIEVLLLSE-RIDEWLINHLHDYKEKA
HTPG_BUCAI      NMNEQQEKIYYITADSY-SSANNSPHLELFKKNNIDVLLLSD-RIDEWMMNYLSEFEGKK
HTPG_BUCAP      NMHEKQEKIYYITADSY-TSAKNSPHLELFNKKNIDVLLLSD-RIDEWMMNYLTEFEGKK
HTPG_BUCBP      NMKQNQEKIYFITADNY-ASAVSSPHLEFFKKKNIDVLILSD-KIDEWMMNYLIEYNEKK
HTPG_BUCCC      NMKKNQKKIYFITSDSY-KSALNSPNLEIFKENDIDVLILSE-KIDEWMMNYLTEFNNIK
HTPG_WIGBR      RMQSGQNKIFYITSDNY-LSAKNNPHLEKLKEKKIEVLLLFD-RIDEWMMNYMTEFKKIK
HTPG_LEGPH      RMKEGQDKIYYITASSY-NAAKNSPHLEIFRKKGIEVLLLSD-KVDEWLVGYMNEFAGKK
HTPG_LEGPC      RMKEGQDKIYYITASSY-NAAKNSPHLEIFRKKGIEVLLLSD-KVDEWLVGYMNEFAGKK
HTPG_LEGPL      RMKEGQDKIYYITASSY-NAAKNSPHLEIFRKKGIEVLLLSD-KVDEWLVGYMNEFTGKK
HTPG_LEGPA      RMKEGQDKIYYITASSY-NAAKNSPHLEIFRKKGIEVLLLSD-KVDEWLVGYMNEFAGKK
HTPG_PSEAE      RMKEGQDKIYYLTGESY-SQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLPEFDGKQ
HTPG_PSEA7      RMKEGQDKIYYLTGESY-SQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLPDFDGKS
HTPG_PSEMY      RVKDGQDKIYYLTGESY-AQIKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDGKQ
HTPG_PSEPF      RAKEGQDKIYYLTGETY-AQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLSEFDGKT
HTPG_PSEF5      RAKEGQDKIYFLTGESY-AQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLNEFDGKS
HTPG_PSEU2      RAKEGQDKIYYLTGESY-AQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLSDFDGKG
HTPG_PSE14      RAKEGQDKIYYLTGESY-AQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLSDFDGKG
HTPG_PSESM      RGKEGQDKIYYLTGESY-AQVRNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLSDFDGKN
HTPG_PSEPK      RAKEGQDKIYYLTGESY-AQVKNSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLNEFDGKA
HTPG_XANC5      RLAEGQDKLYYLTGESY-AQIKDSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDGKS
HTPG_XANAC      RLADGQDKLYYLTGESY-AQIKDSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDGKS
HTPG_XANOM      RLAEGQDKLYYLTGESY-AQIKDSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDGKS
HTPG_XANOR      RLAEGQDKLYYLTGESY-AQIKDSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDGKS
HTPG_XANCP      RMTEGQDKLYYLTGESY-AQIKDSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDSKS
HTPG_XANC8      RMTEGQDKLYYLTGESY-AQIKDSPHLEVFRKKGIEVLLLTD-RIDEWLMSYLTEFDSKS
HTPG_XYLFA      RMKEGQDKLYYLTGESY-AQIKDSPYLEVFRKKGIEVLLLVD-RIDEWLMNYLHEFDGKS
HTPG_XYLFT      RMKEGQDKLYYLTGESY-AQIKDSPYLEVFRKKGIEVLLLVD-RIDEWLMNYLHEFDGKS
HTPG_SACD2      RMKEGQDKIYYVVAENF-NTAKNSPHLEVFRKKGIEVLLLSN-RIDDWLMGHLMEYDGKQ
HTPG_MARHV      RMKEGQNKIYYITGDNF-AAAKSSPHLEVFRKKGIEVLILSD-RIDEWMMGYLSEYDGKQ
HTPG_HAHCH      RMKQGQDKIYYITAESY-SAGVKSPHLEIFRKKGIEVLVMHD-RIDEWLMSHLNEFDGKH
HTPG_MARMS      RMQEGQDKIYYIYAESH-NTAKNSPHLEILRKKGFEVLLLSD-RIDEWMMSSLQEFEGKS
HTPG_CHRSD      RMKEGQQKIYYLVADGF-NAASHSPHLEIFRKKGIEVLLLHD-RIDEWLMSHLTEYDGKA
HTPG_ALCBS      SKPADQDCIYYLLADTP-SAARQSPHLEVFRKKGIEVLLLSD-PVDEWMVGYLESYKEVK
HTPG_RUTMC      SMQKDQKAIYYITAETY-EAAKGSPHLEIFNQKDIEVLLLSD-RVDEWMVNNFGKFEDVP
HTPG_VESOH      NIQKDQKAIYYITAETY-ETAKGSPHLENFNQKNIEVLLLSD-RVDEWMVSNFREFDGIQ
HTPG_HYDCU      RMGEGQEAIYYITADTY-AAATGSPHLEMFRKKGIEVLLLTD-RIDEWLVSHLTEFEGKQ
HTPG_FRAT1      RMKEGQDTIYYITSDSY-KAAANNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDGKH
HTPG_FRATT      RMKEGQDTIYYITSDSY-KAAANNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDGKH
HTPG_FRATW      RMKEGQDTIYYITSDSY-KAAANNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDGKH
HTPG_FRATN      RMKEGQDTIYYITSDSY-KAAANNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDGKH
HTPG_FRATF      RMKESQDTIYYITSDSY-KAAANNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDDKH
HTPG_FRATH      RMKESQDTIYYITSDSY-KAAANNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDDKH
HTPG_FRAP2      RMKEGQDTIYYITSDSY-KAAVNNPQLEAFKKKGIEVILMTD-RIDEWMMSTLTEFDGKH
HTPG_PELLD      RMAPDQKEIYYHSGAGR-AQLLANPNLEYFQDKGIEVLLLSD-PVDVFVIPSIHEYDKKQ
HTPG_CHLPM      RMGGEQKEIYYHSGAGR-AQLLANPNLEYFQSRGIEVLLLSD-PVDVFVIPSIHEYDSKQ
HTPG_CHLCH      RMGSEQKEIYYHSGNNR-AQLLAHPNIEYFREHGIEVLLLSD-PVDMFVIPSIHEFDKKP
HTPG_CHLPD      RMEAGQNEIYYHSGSNR-IQLLAHPNLEYFQHKGIEVLLLSD-PVDVFVIPSIHEYDKKP
HTPG_CHLTE      RMAEGQTEIYYHSGSSR-AQMLAHPNLEYFRKRDIEVLLLSD-PVDVFVIPSIFEYDKKP
HTPG_DESHY      RMKEGQEAIYFINGPTR-QIIEEGPYLEVFKNKDYEVIYTYD-GIDDYVFDMIREYDGKR
HTPG_DESPS      RMNPDQEKIYYINGASR-AAIEAGPYVEMFKKKDIEIVYTLD-PIDDFVLSHLQEFEGKK
HTPG_DESAG      RAREGQKTVWYVSAPNR-EAARLNPHVEIFRRKGIEVLYLYE-AADEFIMESLGKWNEFE
HTPG_DESVH      RAREGQKEIWYIAAPGR-EAARLDPRVEVFRRKGLEVLYLLE-PIDEFVLETLDSYSDFS
HTPG_BACFR      TDKDKNLIYLYANNKDE-----QFAYIEAAKNKGYNVLLMDGQLDVAMVSMLEQKLEKSR
HTPG_BACFN      TDKDKNLIYLYANNKDE-----QFAYIEAAKNKGYNVLLMDGQLDVAMVSMLEQKLEKSR
HTPG_BACTN      TDKDGNLIYLYANNKDE-----QFSYIEAATNKGYNVLLMDGQLDVAMVSMLEQKFEKSR
HTPG_PORGI      TDKDGQVVYLYATDKHG-----QYSHVKRASDKGYSVMLLDGQLDPHIVSLLEQKLEKTH
                     :                  .          .::                      

HTPG_BACSU      FKSVSSGDLGIDT-DEDQKQSEE--------------EESKYKDLFEEMKNILSDKVKNV
HTPG_BACVZ      FKSVSSADLGIDS-DEDEKQTEA--------------EENEYKDLFESMKEILADKVKNV
HTPG_BACLD      FKSVSSGDLGIEN-DDEQNQSDG--------------DDSQYKDLFEEMKKTLDGKVKSV
HTPG_BACHD      FRSVSSGDLGFE--DDEQKDTAA--------------DTDEQKELFEHMKTILDGKVKDV
HTPG_BACSK      FMSVSSADLDIET-DEKQEE-ET--------------NSEENKKLFEKMKSILDGKVKDV
HTPG_OCEIH      FRSVSSGDLGIE--EDEKEENEQ--------------ENNDNAELFTAMKEVLSTKVKDV
HTPG_CLOBH      FKSVSSGDLGIEG-EEKENTSNS--------------DDKENKELFESMKDMLSGKVKDV
HTPG_CLOB1      FKSVSSGDLGIEG-EEKENTSNS--------------DDKENKELFESMKDMLSGKVKDV
HTPG_CLOBL      FKSVSSGDLGIEG-EEKENTSSS--------------DDKENKELFESMKDILSGKVKDV
HTPG_ALKMQ      FKSVSSGDLGIEE-KDEKEEQEE--------------QTQGSKEVFAFMKEALSQKVKDV
HTPG_ALKOO      FKSVSSSDLGIED-SETEKNTET--------------EELENKELFEKMTALLSDKVTAV
HTPG_CLOP1      FKSVSSGDLGIES-EEENKK-----------------ENEENKGIFEAMKEALGEKISAV
HTPG_CLOPE      FKSVSSGDLGIES-EEENKK-----------------ENEENKGIFEAMKEALGEKISAV
HTPG_CLOPS      FKSVSSGDLGIES-EEENKK-----------------ENEENKGIFEAMKEALGEKISAV
HTPG_CLOAB      FKSVSNKDLGFEA-DEKESK--K--------------ETEENKDLFDFMKEVLDGKVKEV
HTPG_CLOTE      FKSVYSKDLGFEA-EEKEEQ--K--------------ENDENKEVFEFMKDVLNGKVKEV
HTPG_FUSNN      FKSINSSDFKFSDDKEKEEEVKK--------------IADENKELIEKAKEFLKDKVSEV
HTPG_RHIME      FKSITQGAA-DLAGIAKNDDAA----AASP-----E-AGAAVTDFVSFARETLGEAVSDV
HTPG_RHIEC      FKSITQGTA-DLAQFPRLDNQT----PPEQ-----D-S-AGLATFIGFAREKLAGQVADV
HTPG_NITWN      FKSVTQGAA-DLAAIPRLDAGT----EPSP-----D-VSEGVTEFLAFLKTTLSDLVSDV
HTPG_NITHX      FKSVTQGDT-DLAAIPRVDASA----ETLQ-----E-VSASVTEFLAFLKTTLADLVSDV
HTPG_AZOC5      FKSVTQGAA-DLSLIPLPKSDE----AETP-----EPEAKDTGDFIAFVKETLGDQVADV
HTPG_RHILO      FKSVTQGVA-ELSDIPLLDDAK----KPDT-----A-AAPEVDGFLAFVKSALGDAVSDV
HTPG_RHOP2      LKSLSQGEV-NFDLIPKLDADKA---EDKP-----DEAKADEATVIAVIKDALGDRVSDV
HTPG_RHOPS      LKSLSQGDV-NFDLIPKLDADKP---DDKP-----DETKADEATVIAVIKDALGERVSDV
HTPG_RHOPA      LKSLSQGDV-NFDLIPKLEQDQD---KDNK-----DEAKVDEATVIAVIKDALGERVSDV
HTPG_RHOP5      LKSLSQGDV-NFDLIPTTDEAK-----DEQ-----PKPETDEALVIATIKDALGERVSDV
HTPG_RHOPB      LKSLSQGDV-DFGQIPTTEENK-----DEQ-----AKPETDEALTIAAIKDALGDKVSDV
HTPG_BRADU      LKSLSQGDL-NLDLIPRVDATD----EAKK-----DEPEADEAATIAVIKAALGERVSDV
HTPG_GLUOX      LRSVTHSHG-DLEKFESVEADT--------------TEAADVEKLVPALKDALGDQVKDV
HTPG_MAGSA      FRSVAAAGA-DLSKVKAPEGAE---DKKAD-----EAPADELTTLIEAVKLALGERVKDV
HTPG_RHORT      LKAVAQGSA-DLERLALIDGKQPPDDAEHA-----PAETAKMDALIAAMKAALGTAVADV
HTPG_ROSDO      FKSITRGAA-DLDKIN--EGEK--ADDAEE-----EAQAPDLNDLIAALKLELGASVKDV
HTPG_RICRS      IKSATRSDI-DVEQTTSQSE---AKNTDSK-----KSDDE-YKLLTDYFKETLGELVKEV
HTPG_RICRO      IKSATRSDI-DVEQTTSQSE---AKNTDSK-----KSDDE-YKLLTDYFKETLGELVKEV
HTPG_RICCN      IKSATRSDI-DVEQTTSQSE---EKNTDST-----KSNDE-YKLLTDYFKETLGELVKEV
HTPG_RICFE      IKSATRSDI-DVEQTTSQSE---EKNADSK-----KSDDE-YKLLTDYFKETLGELVKEV
HTPG_RICAH      IKSATRSDI-DVEQTTSQSE---DKNTHSK-----KSDDE-YKLLTDYFKETLGKLVKEV
HTPG_RICCK      IKSATRSDI-DVEQTTSSSE---EKNTDSK-----KSDDE-YKLLTDYFKETLGDLVKDV
HTPG_RICBR      IKSATRSDI-DVDQATSSSE---EKNKDDK-----KSDDE-YKSLTDYFKEVLGILVKDV
HTPG_RICB8      IKSATRSDI-DVDQATSSSE---EKNKDDK-----KSDDE-YKSLTDYFKEVLGILVKDV
HTPG_RICTY      IKSATRSDI-DVEHTTSRPQ---DKNTDSK-----KSDDE-YKLLTDYFKEILGELVKEV
HTPG_RICPR      IKSATRSDI-DVEQTTSQPK---DKNTDSK-----KSDNE-YKLLTDYFKEILGELVKEV
HTPG_ORITB      LKSVTSANI-EIDNCDTKTAKSSDTNNDGKDDT-SSSDDQNCEQLIKYFKEVLGDKVKSV
HTPG_EHRCJ      LKSVIRADE-DLEKLAHLKKDEEVGESKDE----NPDSKEKVDAFVKYAIQVLDKLVSGV
HTPG_EHRCR      LKSVIRADE-DLEKLAHLDKSEEIKENEDE----SVDSKEKVDTFVKYAAQVLDKLVSSV
HTPG_EHRRW      LRSVIRADE-DLEKFSDVEKDDESKESQNE----DAQSKEKVDKFISYAAQVLTNLVSNV
HTPG_EHRRG      LRSVIRADE-DLEKFSDVEKGDESKDSQNE----DTQSKEKVDKFIGYAAQVLNNLVSNV
HTPG_WOLPM      IKSVTRADV-DLEKFSSEE-DKTDEENKS-------NEEKTEETILQYFTTVLGDSVKSV
HTPG_WOLTR      FKSVTRADV-DLEKFSPEEKDKENKSDEE-------RAEGNTDSILQYFTKVLGNAVKSV
HTPG_ANAPZ      FKSVMRVGEKDLEKCIGASDDSGDKTSED--SGESASDKESIGSFIEYLKKVLDGVVSDV
HTPG_ANAMM      FKSVTRVDESDLEKFTEGDDQQSTKKKKEKKDTDDAQQKENVEAFIDYMKKVLGDSVSDI
HTPG_NEOSM      IKSITRSSI-DLDAFAELEKAGQEVQQHHD---------KEIDRLIAKMQEVLKDEVESV
HTPG_TREDE      LKAANRAGS-DKELNTEEETKEAEKKE------------KDFKPVLEKIKEVLGDKVKEV
HTPG_TREPA      LRAINRLGS-EEELRPNEETDAAAQRE------------QGFKPLLERLTHILSDSVKEV
HTPG_HELPH      FRDASHSES-LKELGLEEINDEVKDQ---------------FKDLMKAFEENLKDEIKGV
HTPG_HELPJ      FRDASHSES-LKELGLAEIHDEVKDQ---------------FKDLIKAFEENLKDEIKGV
HTPG_HELPY      FKDASHSES-LKELGLEEIHDEVKDQ---------------FKDLMKAFEENLKDEIKGV
HTPG_HELAH      FRDASHSES-LKELGLEEINDEVKNQ---------------FKDLIKAFEENLKDEIKGV
HTPG_HELHP      LKSINSKEA-LAELGEESIDEATQNA---------------YEPLIKGFKDALGEQIAEV
HTPG_WOLSU      LKAINSAEA-DKDFEEESVSEEEKER---------------FKPLLERFEKALSGEIKSV
HTPG_CAMJJ      FVAINQVE------DKNELSDEEKNT---------------FAPLVAKFKELLKDQVEDV
HTPG_CAMJ8      FVAINQVE------DKNELSDEEKNT---------------FAPLVAKFKELLKDQVEDV
HTPG_CAMJR      FIAINQVE------DKNELSDEEKNT---------------FAPLVAKFKELLKDQVEDV
HTPG_CAMJE      FVSINQVE------DKNELSDEEKNT---------------FAPLVAKFKELLKDQVEDV
HTPG_CAMJD      FVAINQVE------DKNELSDEEKNT---------------FAPLVAKFKELLKDQVEDV
HTPG_CAMHC      IKSVMDAD------FSDDKG-EISAQ---------------DLEIAEKIKENLKDKVKDV
HTPG_SULNB      FKDITTIDA-PDS-KTEEEKEEISKE---------------FKPLTDKIKEVLGDEVKEV
HTPG_ARCB4      FKDITAIEP-PKVEQSEEEKKEVEEK---------------FQDILSKIKDKLGDAVKDV
HTPG_BORBP      LKAINKNET-SNELKDENFKKIEEEF----------------KDILTKVKEILKDHIKEV
HTPG_BORBU      LKAINKNET-SNELKDENFKKIEEEF----------------KDTLTKVKEILKDHIKEV
HTPG_BORAP      LKAINKNET-SNELKDENFKKIEEEF----------------KDTLTRVKEILKDQIKEV
HTPG_SULDN      LIHVNDVKF-EENENDKKAQEKSSKE---------------FEGLTKELKESLGDSVKSV
HTPG_MYCTA      LQSVAKGEV-DLSSEED--TSEAE----RE------ERQKEFADLLTWLQETLSDHVKEV
HTPG_MYCBO      LQSVAKGEV-DLSSEED--TSEAE----RE------ERQKEFADLLTWLQETLSDHVKEV
HTPG_MYCBP      LQSVAKGEV-DLSSEED--TSEAE----RE------ERQKEFADLLTWLQETLSDHVKEV
HTPG_MYCTU      LQSVAKGEV-DLSSEED--TSEAE----RE------ERQKEFADLLTWLQETLSDHVKEV
HTPG_MYCA1      LQSIAKGEV-DLSAEGE--ESQAE----RE------EQQKEFADLLAWLKDTLSDHVKEV
HTPG_MYCPA      LQSIAKGEV-DLSAEGE--ESQAE----RD------EQQKEFADLLAWLKDTLSDHVKEV
HTPG_MYCUA      LQSVAKGEV-DLDSDGE--GSEAE----RE------EQQKEFADLLGWLKETLGEQVKEV
HTPG_MYCLE      LKSVARGEV-DLESEEEKTAHEAE----RK------EQEQNFAGLVNWLKETLSDHVKEV
HTPG_MYCGI      LQSVAKGEV-DLDSEADKEAQETE----RQ------QREKEFADVIAWLTEVLGDHVKEV
HTPG_MYCVP      LQSVAKGEV-DLDSDADNDGQDAE----RQ------EREQGFADLIAWLKEALSDHVKEV
HTPG_RHOJR      FQSIAKGEV-DLDTEEDKKAHESE----RE------EQEKDFAGLLSWMADALSEQVKEV
HTPG_NOCFA      FQSIAKGEV-DLESEEEKKASEAL----RE------QQDKEFADLLSWLGKTLEENIKEV
HTPG_SALTO      LRSVAKGQV-DLDTEEERSAAEAE----RE------RQRTEYADLLTWLSSTLADQVREV
HTPG_SALAI      LRSVAKGQV-DLDTDEERSAAEAE----RE------RQRTEYADLLTWLGSALADQVREV
HTPG_FRACC      LKSIAKGEV-DLDTDDEKKSSEAE----RE------QLRKDFAALLPWLAAKLEDDVKEV
HTPG_STRCO      LRSVAKGEI-DLSGTEAD-KSDAE----KE------KQGEEYAGLLGWMTEHLGEEVKEV
HTPG_GEOSL      LKAVDRGDV-IPATEEEKKEQEAK----RE------EAAKQYGDLLSFVKEKLAERVKEV
HTPG_GEOMG      LKAVDRGDV-IPATEEEKKEQEAK----RE------EAFKQYGDLLSFVKEKLDARVKEV
HTPG_GEOUR      LHAVDRGDL-ELDSAEEKKEKEAK----QE------EAKKQYQGVLDFVKEQLKDKVKEV
HTPG_PELPD      LKAVDRGDV-DLDSEEEKKEKETK----QE------EARKEYGDLISFIKSHLEDRVKDA
HTPG_BDEBA      LQSIMREGL-DLDTAEEKQQKEQE----KK------QAEVTLKPVLESMKKTLESDVKDV
HTPG_MYXXD      LVSALQADL-KLQSTDE---QKKE----QE------QHAEGLKTLTSKMKDVLQESVREV
HTPG_METFK      LQSVAKGDL-DLGKLEDEAEKEQ-----QK------KTEDEYKPLVERIQAALGDSVKEV
HTPG_THIDA      LKSVAKGGL-DLGELEDEAEKTA-----QK------EAEESMKPLVERIKAMLGERVKDV
HTPG_CHRVO      LQSVAKGAL-DLGALEDEADKEA-----QK------QVEEASKPVVEKVQKALGDKVKEV
HTPG_DECAR      LQSVAKGGL-DLGKLEDEAEKQE-----AE------KAADDYKELLEKVKTSLGDKVKDV
HTPG_AROAE      LVSVAKGGL-DLGKLEDEAEKKE-----TE------KAADEYKELLEKMKASLGERVKEV
HTPG_NITEC      LQSIAKGDL-DLGKLEDEVEKQE-----HE------KEAGDFQELTAKMKEVLGELVKDV
HTPG_NITEU      LQSIAKGNL-DLGKLEDEEEKKE-----HE------KEAGDFQELTNKMKEVLGEQVKDV
HTPG_NITMU      LQSVAKGSL-DLGKLEDEAEKKE-----QE------KEAGEYKELTEKIKEVLGEQVKDV
HTPG_BORBR      LVSVAKGGL-DLAELADEEEKKR-----QS------EVAETFKPLVERLQQALAEQVKEV
HTPG_BORPA      LVSVAKGGL-DLAELADEEEKKR-----QS------EVAETFKPLVERLQQALAEQVKEV
HTPG_BORPE      LVSVAKGGL-DLAELADEEEKKR-----QS------EVAETFKPLVERLQQALAEQVKEV
HTPG_BORA1      LVSVAKGGL-DLADLADEEEKKK-----QT------EVAESFKPLIERLQTALGEQVKEV
HTPG_BURPS      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURMA      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURM7      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURP1      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURM9      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURMS      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURP0      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURP6      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGEKVKDV
HTPG_BURTA      LASVARGDL-DLGALNDDEKKA------QE------ETGEAMKPVVDKMKETLGGKVKDV
HTPG_BURCA      LASVARGDL-DLGELNDEEKKA------QE------QAGEAIKPVVEKMKEALGDKVKEV
HTPG_BURCH      LASVARGDL-DLGELNDEEKKA------QE------QAGEAIKPVVEKMKEALGDKVKEV
HTPG_BURCM      LASVARGDL-DLGELNDEEKKA------QE------QAGEAIKPVVEKMKEALGDKVKEV
HTPG_BURL3      LASVARGDL-DLGELNDEEKKA------QE------EAGEAIKPVVEKMKEALGDKVKEV
HTPG_PARXL      LQSVARGDL-DLGALNDEEKEA------QE------KVSEEFKPLVEKMKEALKDKAKDV
HTPG_CUPNH      LVSVARGDL-DLGKLADEAEKAE-----QE------KAEADWKDVVDRAKTVLDGKAKDV
HTPG_CUPPJ      LVSVARGDL-DLGSLADEAEKAE-----QE------KAETEWKDVVARAKTVLEGKAKDV
HTPG_CUPMC      LVSVARGDL-DLGALADEAEKAE-----QE------KASADWKEVVDRAKSVLEGKAKDV
HTPG_RALSO      LVSVARGGL-DLGALEDEAERAE-----HA------KVEGEFKPLVDRAKAVLADKAKDV
HTPG_ACISJ      LQSVAKGAV-DLGKLQDEAEKKA-----AE------EAAEAFKPMLAKLKEALKDKAEDV
HTPG_VEREI      LQSVAKGAV-DLGKLQDEAEKKA-----AE------EAAEAFKPLLARLKETLKDKAEDV
HTPG_RHOFT      LQSVAKGAV-DLGKLQDEAEKKA-----AE------EAAETFKPLLAKLKEALKDKAEDV
HTPG_POLNA      LQSVAKGAV-DLGKLQDEDEKKA-----AE------EAQTQFKPILDKLKEALKDKASDV
HTPG_POLSJ      LQSVAKGAV-DLGKLQDEDEKKA-----AE------EAQTHFKPILDKLKEALKDKAKDV
HTPG_METPP      LQSVAKGAV-DLGKLQDEGEKQQ-----AE------AAAEAFKPVLEKLKDTLKERAKDV
HTPG_PSYCK      LQNIAKGAV-DLGDLQDEAEKAE-----AE------KAQETMKPIVDKLKTALGERAKDV
HTPG_PSYA2      LQNIAKGAV-DLGDLQDEAEKAE-----AE------KAQETMKPVVDKLKAALGDRAKDV
HTPG_ACIAD      LQNVSKGAV-DLGDLQDAEEKKA-----LE------QAAEQFKPVVDKLTDALKDKTKEV
HTPG_ALKEH      LKSVAKGGL-DLGELEDQAEKKA-----AE------EATESHKDLLEKLKGALEDKVSEV
HTPG_HALHL      LASVAKGEL-DLEALGEEDDKQA-----RQ------EKEQAYEDLCKRLGETLGERVSEV
HTPG_NITOC      LQSVTKGEL-DLGHLEDEQEKQQ-----QK------EVEEDFQNLVERVKNNLGDKVKEV
HTPG_MAGMM      LQAITKGEL-DLSKFAGGEEEAKDEE-AEK------AQEEALKPITERMAKVLEGQVKEV
HTPG_METCA      LQSVARGDL-DLGKLEGEEEKAE-----AA------AEKEAFAPLTERLKKALEAKVNDV
HTPG_COXBR      LQSIAKGTL-DLGDLEKEEKVET------E------KFEKDFDELLKQFKEVLGEKIKDV
HTPG_COXBU      LQSIAKGTL-DLGDLEKEEKVET------E------KFEKDFDELLKQFKEVLGEKIKDV
HTPG_COXBN      LQSIAKGTL-DLGDLEKEEKVET------E------KFEKDFDELLKQFKEVLGEKIKDV
HTPG_HAEIN      LQSITKADL-DLGDLADK-ESET-----QK------QQDEAFGSFIERVKNLLGERVKTV
HTPG_HAEIE      LQSITKADL-DLGDLADK-ESET-----QK------QQDEAFGSFIERVKNLLGERVKTV
HTPG_HAEI8      LQSITKADL-DLGDLADK-ESET-----QK------QQDKAFGSFIERVKNLLGERVKTV
HTPG_HAEIG      LQSITKADL-DLGDLADK-ESET-----QK------QRDEAFGSFIERVKNLLGERVKTV
HTPG_AGGAC      LQSITKADL-DLGDLADK-EAEE-----QK------AQDESFGSFVERVKTLLGGRVKEV
HTPG_HAES1      LQPITKADL-DLGDLADK-EQEE-----QK------EQDKTFSSFIERVKTLLGERVKDV
HTPG_HISS2      LQPITKADL-DLGDLADK-EQEE-----QK------EQDKTFSSFIERVKTLLGERVKDV
HTPG_PASMU      LQTISKADL-DLGDLADK-EEDS-----QK------AQDEQYASFVERVKTLLGERVKEV
HTPG_ACTSZ      LQSITKADL-DLGDLADKTEAEK-----EK------AQDEALSGFIERVKTLLGERVKDV
HTPG_MANSM      LQSVTKADL-DLGDLADK-EEEN-----QK------EQDEKFDSFIQRVKSLLGERVKDV
HTPG_ACTP2      LQSITKSDL-DLGDLADKEQEES-----QK------AQQAEFGSFLERAQSYFGERVKKV
HTPG_ECOLI      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECOL5      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECOHS      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECOL6      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_SHIBS      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_SHISS      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECO57      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECOLC      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECOUT      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECOK1      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_ECO24      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_SHIFL      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_SHIDS      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFIDRVKALLGERVKDV
HTPG_SALPB      FQSVAKADE-SIEKLADE-VDEN-----AK------EAEKALEPFVERVKTLLGDRVKEV
HTPG_SALPA      FQSVAKADE-SIEKLADE-VDEN-----AK------EAEKALEPFVERVKTLLGDRVKEV
HTPG_SALTY      FQSVAKADE-SIEKLADE-VDEN-----AK------EAEKALEPFVERVKTLLGDRVKDV
HTPG_SALCH      FQSVAKADE-SIEKLADE-VDEN-----AK------EAEKVLEPFVERVKTLLGDRVKDV
HTPG_SALTI      FQSVAKADE-SIEKLADE-VDEN-----AK------EAEKALEPFVERVKTLLGDRVKEV
HTPG_CITK8      FQSVSKVDE-SLEKLADE-VDES-----AK------EAEKALTPFVERVKTLLGDRVKEV
HTPG_CROS8      FQSVAKADE-SLEKLADE-VDES-----AK------EAEKALEPFVERVKTLLGDRVKEV
HTPG_KLEP7      FQSVAKADE-SLDKLADE-VDES-----TK------EAEKALEPFVERVKNLLGDRVKEV
HTPG_ENT38      FQSVAKADE-SIDKLADE-VDET-----AK------EAEKALEPFVERVKTLLGDRVKEV
HTPG_PECAS      FQSVSKADD-TLDKLADE-ENDA-----QK------EAQKALEPFVERVKTLLGERVKDV
HTPG_YERPA      FQSVSKADD-SLNKLADE-ENPE-----QQ------EAEKALEPFVERVKTLLGERVKDV
HTPG_YERPS      FQSVSKADD-SLNKLADE-ENPE-----QQ------EAEKALEPFVERVKTLLGERVKDV
HTPG_YERPN      FQSVSKADD-SLNKLADE-ENPE-----QQ------EAEKALEPFVERVKTLLGERVKDV
HTPG_YERPP      FQSVSKADD-SLNKLADE-ENPE-----QQ------EAEKALEPFVERVKTLLGERVKDV
HTPG_YERPE      FQSVSKADD-SLNKLADE-ENPE-----QQ------EAEKALEPFVERVKTLLGERVKDV
HTPG_YERE8      FQSVSKADD-SLNKLADE-ERPE-----QQ------EADKALEPFVERVKTLLGERVKDV
HTPG_SERP5      FQSVSKADD-ALDKLADE-TE-E-----QK------AAEKQLEPFVDRVKTLLGDRVKDV
HTPG_PHOLL      FQSVSKADE-SLDKLADE-NKAE-----QE------EIEKQLEPFVERVKTLLGDRVKEV
HTPG_SODGM      FQSVSKADP-SLDKLADE-EDEE-----QK------EVEKALEPFVERVKTYLGERVKEV
HTPG_BAUCH      FQLVSKADL-KLDKFLNE-NTTE-----QK------DMTKAFEPFIERVKKYLGDRIKEV
HTPG_VIBCH      FQSITKAGL-DLSQFEDEAEKEK-----HK------ETEEQFKSVVERLKGYLGSRVKEV
HTPG_VIBC3      FQSITKAGL-DLSQFEDEAEKEK-----HK------ETEEQFKSVVERLKGYLGSRVKEV
HTPG_VIBPA      FQSITKAGL-DLSKFEDEADKEK-----QK------ETEEEFKSVVERTKSYLGDRVKDV
HTPG_VIBCB      FQSITKAGL-DLSKFEDEAEKEK-----QK------ETEEEFKSVVERTQSYLGDRVKEV
HTPG_VIBVY      FQSITKAGL-DLSQFEDEQEKEK-----QK------ETEQEFQSVVERTKSYLGDRVKEV
HTPG_VIBVU      FQSITKAGL-DLSQFEDEQEKEK-----QK------ETEQEFQSVVERTKSYLGDRVKEV
HTPG_ALIF1      FQSITKAGL-DLSKFEDEAEKEK-----HK------ETEEEFKSVVERTKSYLGDRVKEV
HTPG_PHOPR      FQAITKADL-DLSKFENEEDKEK-----QK------EAAEEFKSVVERAKGYLGTRVKDV
HTPG_AERHH      LVSVTRGEL-DLGDLEDEASKQA-----QE------EAEKANAGLVERVKQSLGEAVKEV
HTPG_AERS4      LVSVTRGEL-DLGDLEDEASKQA-----QE------EAEKANAGLVERVKTSLGEAVKEV
HTPG_PSEHT      LQSITRGDL-DLGKLDDEETKKA-----QE------ESEKEVAGLVERIKTALGDEVKEV
HTPG_COLP3      LQSVTRGGL-DLGDMDDAETKEA-----QE------KLEKEYDSVVKRIKASLDGKVKEV
HTPG_PSEA6      FQSITHGEL-DLGDLDDEDSKKA-----QE------EAEKQVEGLTERVKTVLGDKVAEV
HTPG_IDILO      LQSVTRGDL-DLGELDDEEDKAE-----QE------KAEEAFKENLERFEKALGDKVKKV
HTPG_PSYIN      FTSVTQGDL-DLGKLDSEEKKKE-----QE------KQETEFASFVERVKAVLGDKVKDV
HTPG_SHEPA      LHSVTRGDL-ELGELEDDDEKEA-----QE------KLQTESEGLVKRVKDSLGDKVSEV
HTPG_SHEHH      LHSVTRGDL-ELGELEDASEKEA-----QE------KLETESEGLVKRVKDSLGDKVSAV
HTPG_SHESH      LHSVTRGDL-ELGDLEDAGEKEA-----QE------KLETESEGLVKRIKDSLGEKVSAV
HTPG_SHELP      LHSVTRGDL-ELGELEDAAEKEA-----QE------KLETESEGLVKRVKEVLGDKVAEV
HTPG_SHEPC      LHSVTRGEL-ELGELEDAAEKEA-----QE------KLAEESAPLIERIKAALGTKVADV
HTPG_SHESW      LHSVTRGEL-ELGELEDAAEKEA-----QE------KLAEESAPLIERIKAALGTKVADV
HTPG_SHESM      LHSVTRGEL-ELGELEDAAEKEA-----QE------KLAEESAPLVERIKAALGASVADV
HTPG_SHESR      LHSVTRGEL-ELGELEDAAEKEA-----QE------KLAEESAPLVERIKAALGASVADV
HTPG_SHESA      LHSVTRGEL-ELGELEDAAEKEA-----QE------KLAEESAPLIERIKAALGASVADV
HTPG_SHEON      LHSVTRGEL-ELGELEDAAEKEA-----QE------KLAEESAPLIERIKAALGASVADV
HTPG_SHEB9      LHSVTRGDL-ELGELEDASEKEA-----QE------KLEQESVALVERIKAALGSTVADV
HTPG_SHEB8      LHSVTRGDL-ELGELEDASEKEA-----QE------KLEQESVALVERIKAALGSTVADV
HTPG_SHEB5      LHSVTRGDL-ELGELEDAAEKEA-----QE------KLEQESVALVERIKAALGSSVADV
HTPG_SHEDO      LHSVTRGDL-ELGELEDAADKEA-----KD------KITEEAKGLVERMKAALGAKVSEV
HTPG_SHEFN      LHSVTRGDL-ELGELEDAADKEA-----HD------KVAEESKGLIERVKAALADSVSEV
HTPG_SHEAM      LHSVTRGDL-DLGALEDEAEKAA-----QE------KLAQESEPLVERFKSALGDKVSDV
HTPG_BUCAI      FQSISKEDI-SLNKLTKE-KKIK-----NK------DVSTEMIEFLKKVKNILGNQVKDV
HTPG_BUCAP      FQSISKEDL-SLNKLTKE-NENK------K------ETSTEMIEFLKKVKKTLGDKVKSV
HTPG_BUCBP      FQSVSKDDK-SIEKLVHE-QNSQ-----NE------TYQENMNDFLNRAKKTLSDKIKDI
HTPG_BUCCC      FQSVSKLDD-TIDSLLLK-KNVS-----NE--------KNTFNEFIEKTKKILKNKVKDV
HTPG_WIGBR      FQSISKYSS-YLENIFKD-ENND-----QK------NTEQKLSTIILRIKSYLKDRVKDV
HTPG_LEGPH      LQSISKGKV-ELG---DDETSEQ-----IK------EQEKTLEPLIKHIKSVLNERVKDV
HTPG_LEGPC      LQSISKGKI-ELG---DDETSEQ-----IK------EQEKTLEPLIKHIKSVLNERVKDV
HTPG_LEGPL      LQSISKGKV-ELG---DDETSEQ-----IK------EQEKTLEPLIKHIKSVLNERVKDV
HTPG_LEGPA      LQSISKGKI-ELG---DDETSEQ-----IK------EQEKTLEPLIKHIKSVLNDRVKDV
HTPG_PSEAE      FVDVARGDL-DLGSLDSEEDKKA-----QE------EVAKSKEGLIERLKKVLDEQVSEV
HTPG_PSEA7      FVDVARGDL-DLGSLDSEEDKKA-----QE------EVAKSKEGLIERLKKVLDEQASEV
HTPG_PSEMY      FVDVARGDL-DLGKLDSEEDKKA-----QE------EVAKAKEGLIERLKGALGEQVKEV
HTPG_PSEPF      FVDVARGDL-DLGNLDSEEDKKA-----AE------EVAKSKEGLVERLKTALGDSVAEV
HTPG_PSEF5      FVDVARGDL-DLGNLDSEEDKKA-----AE------EVAKTKEGLVERIKTALGESVSEV
HTPG_PSEU2      FVDVARGDL-DLGNLDSEEDKKA-----QE------EIAKDKEGLIERLKAALGESVSEV
HTPG_PSE14      FVDVARGDL-DLGNLDSEEDKKA-----QE------EIAKDKEGLIERLKAALGESVSEV
HTPG_PSESM      FVDVARGDL-DLGNLDSEEDKKA-----QE------EIAKDKEGLIERLKAALGESVSEV
HTPG_PSEPK      FVDIARGDL-DLGKLDSEEDKKA-----QE------EVAKDKEGLVERLKGALGDSVAEV
HTPG_XANC5      FVDVARGDL-DLGKLDSEEDKKA-----QE------DLAKSKEGLASRIKAALGDDVAEV
HTPG_XANAC      FVDVARGDL-DLGKLDSEEDKKA-----QE------EVAKSKEGLASRIKAALGDDVAEL
HTPG_XANOM      FVDVARGDL-DLGKLDSEEDKKA-----QE------EVAKSKEGLASRIKAALGEDVAEV
HTPG_XANOR      FVDVARGDL-DLGKLDSEEDKKA-----QE------EVAKSKEGLASRIKAALGEDVAEV
HTPG_XANCP      FVDVARGDL-DLGKLDSEEDKKA-----QE------EVAKSKEGLASRIKAALGDDVAEV
HTPG_XANC8      FVDVARGDL-DLGKLDSEEDKKA-----QE------EVAKSKEGLASRIKAALGDDVAEV
HTPG_XYLFA      FVDIARGDL-DLGNLDSEADKKA-----QE------EIAKTKEALASRIKATLGEDVAEV
HTPG_XYLFT      FVDIARGDL-DLGNLDSEADKKA-----QE------EIAKTKEALASRIKATLGEDVAEV
HTPG_SACD2      FQDVGKGSL-DLGKLDSEEDKKE-----QE------KVEEAMAPFVERMKAALAEQVEEV
HTPG_MARHV      FQDVARGDL-DLGEVETEEDKKH-----QE------EAAKEHKDLLERIKTALEDQVQEV
HTPG_HAHCH      FQDIAKGEL-DLGEVEDKEEKEK-----QE------EVSKEAEPLLNRLKEVLKDHVEEV
HTPG_MARMS      FQDVTKGKL-DLADQENEEEKKE-----KE------EKAEKMKPLLDRMKAVLNEKVAGV
HTPG_CHRSD      FADVAKGDL-DLDDMADEEEKKA-----QE------ETAKAKAPLIERVKTALGDEVQEV
HTPG_ALCBS      LVNAARGEL-DLGD--------------ES------EQANNDDPLIQRLAASLTEQVEAV
HTPG_RUTMC      LKSITKG---DLEGLDSKEEKKA-----KE------EVSKNFEKVIEKMQKILDTQVKEI
HTPG_VESOH      LKSIAKG---NLEDFDSKEEKKA-----KE------EVAKNFEIVIEKMQKILDSQVKEI
HTPG_HYDCU      LKSVTSA---DLKEFDEEADKEL-----SE------EDKKAREALTEKVKKAIEDQVSDV
HTPG_FRAT1      MKSIIKGDI-DLDRFETPENKEK-----FE------KEAKDFEKVLKEIKEVLKDKVEDV
HTPG_FRATT      MKSIIKGDI-DLDRFETPENKEK-----FE------KEAKDFEKVLKEIKEVLKDKVEDV
HTPG_FRATW      MKSIIKGDI-DLDKFETPENKEK-----FE------KEAKDFEKVLKEIKEVLKDKVEDV
HTPG_FRATN      MKSIIKGDI-DLDKFETPENKEK-----FE------KETKDFEKVLKEIKEVLKDKVEDV
HTPG_FRATF      MKSIIKGDI-DLDKFETPENKEK-----FE------KEAKDFEKVLKEIKEVLKDKVEDV
HTPG_FRATH      MKSIIKGDI-DLDKFETPENKEK-----FE------KEAKDFEKVLKEIKEVLKDKVEDV
HTPG_FRAP2      MKSIIKGDI-DLDKFETPENKEK-----FE------KEAKDFEKVLKEIKEVLKDKVEDV
HTPG_PELLD      LKSIEKADIDFSKA---TKDKTEP-IAENL-----------LVPLLKIFRETLGEGIEDV
HTPG_CHLPM      LKSIEKADIDFSKE---KTEGEEP-VAENL-----------LVPLLAKFREALGEDIADV
HTPG_CHLCH      LKSIEKADCDFSQQ---SSNKAEP-VAPNL-----------LNPVLQAFKEALSNEVEDV
HTPG_CHLPD      LKSIEKADIDFTRT---GDDKTEPPLPETL-----------SQPLLGLFRQTIGDVIEDV
HTPG_CHLTE      LKSIEKAEIDMSTV---EPE-GER-LSAEG-----------TVGVISLFKEVLGERVADV
HTPG_DESHY      LLSADHGDLNLADE--DGASAEEKLLSEEE-----------LKEFNDWLKEVLGEKVTEV
HTPG_DESPS      LVSADGADISLDKEEAEDALVDESGVDKAE-----------LAELLTWMKEELKDEVGDV
HTPG_DESAG      FRSAEHADADALKDFDDVEKKDAPEALDEEG-------RKTLSSLLSHMKTLLGDKVEDV
HTPG_DESVH      FKAVEHADGEKLAQFEDTGPARDVTPLTEDE-------DAAFARLIERMKALLGDAVEDV
HTPG_BACFR      FTRVDSDVVDNLIVKEDKKSDVLEAS----------KQEALSAAFKSQLPKMEKVEFNVM
HTPG_BACFN      FTRVDSDVVDNLIVKEDKKSDVLEAS----------KQEALSAAFKSQLPKMEKVEFNVM
HTPG_BACTN      FTRVDSDVIDNLIIKEDKKNETLEGE----------KQEAITTAFKSQLPKMDKVEFNVM
HTPG_PORGI      FVRVDSDTINNLIRKEERAEVKLSDT----------ERATLVKLFEARLPRDEKKHFNVA
                :                                                           

HTPG_BACSU      RISKRLKSHPVCLAADGEVT--IEMEKILNAMPDSQ----NVKAEKVLEINPNHEVFQTL
HTPG_BACVZ      RASKRLKSHPVCFATDGEVT--IEMEKVLNAMPDSQ----QVKAEKVLEINPNHEVFETL
HTPG_BACLD      RASKRLKTHSVCLAADGEVT--IEMEKILNAMPDNQ----HVKADKVLEINTNHEVFKTL
HTPG_BACHD      RASKRLKSHPVCLTAEGEVS--IEMEKVLRAMPDNQ----NVQAEKVLEINVNHDVFDVL
HTPG_BACSK      RTSKRLKSHPVFLAADGEIT--LEMEKVLQAMPDNQ----NVKAEKVLEINPNHDVFHSL
HTPG_OCEIH      RASKRLKSHPVVLTADGEIS--LEMEKIINAMPDDQ----QIQADKVLEINVNHDIFQSL
HTPG_CLOBH      RASKRLKNHPVCLANEGELS--IEMEKVLNAMPNNQ----NIKADKVLEININHDVFKSL
HTPG_CLOB1      RASKRLKNHPVCLANEGELS--IEMEKVLNAMPNNQ----NIKADKVLEININHDVFKSL
HTPG_CLOBL      RASKRLKNHPVCLANEGELS--IEMEKVLNAMPNNQ----NIKADKVLEININHDVFKSL
HTPG_ALKMQ      RPSKRLKNHPVCLATDGDVT--IEMEKILSAMPNNQ----EIKAERVLEININHDVFKTL
HTPG_ALKOO      RISKRLKSHPVCLANEGEIS--IEMEKILSAMPNNE----NIKANKILEINGNHQVFEVL
HTPG_CLOP1      KASSRLKNYPVCLSSEGEVS--IEMEKILSAMPNNQ----GVKAQKVLEVNTNHEVFNSL
HTPG_CLOPE      KASSRLKNYPVCLSSEGEVS--IEMEKILSAMPNNQ----GVKAQKVLEVNTNHEVFNSL
HTPG_CLOPS      KASSRLKNYPVCLSSEGEVS--IEMEKILSAMPNNQ----GVKAQKVLEVNTNHEVFNSL
HTPG_CLOAB      RASSRLKSHPVCLSNDGELS--IEMEKVLKMMPDNN----NVKAEKILEINTNHEMFNSI
HTPG_CLOTE      RASKRLKSHPVCLANASDIS--IEMEKVLSMMPNNE----NIKADKILEINTNHNMFNTI
HTPG_FUSNN      ELSNNIGNSASSLLAKGGLS--LEMEKTLSEMTNNND---MPKAEKVLAINPEHVLFNRL
HTPG_RHIME      RTSDRLTESAVCLVAPEQGP-DRQLQKMLQDAGRI--EGAP---KPVLEINPGHQLIAAL
HTPG_RHIEC      RASDRLTESAVCLVAPEDGY-DRQMEKILQNAGRL--QGAT---KPILEINLAHPVIKAI
HTPG_NITWN      RSSDRLTDSPVCLVAAESGP-DRQLEKILLGVGQL--AGAS---KPVLEVNPNHPLVASL
HTPG_NITHX      RSSERLTDSPVCLIAAESGP-DRQLEKILVGVGQL--TGAS---KPVLEVNPRHPLIASL
HTPG_AZOC5      RASDRLTTSAVCLVAPESGI-DRRLEKLLASAGRL--GDAA---KPVLEINPRHPLVAAL
HTPG_RHILO      KASDRLTESAVCLVAPEHGP-DRQFERLMNAAGRL--DKAA---KPILEINPRHERVLAL
HTPG_RHOP2      KASQRLTASASCLVAGGFGP-DRELEKMLARANK---GAAT---KPVLEINLGHPLVAAL
HTPG_RHOPS      KASQRLTSSASCLVAGGFGP-DRELEKMLARANK---GAAT---KPVLEINLGHPLVAAL
HTPG_RHOPA      KASQRLTSSASCLVAGGMGP-DRELEKLLARANK---GAGS---KPILEINLQHPLVAAL
HTPG_RHOP5      RASQRLTASASCLIAGGQGP-DRALERMLAQQNR---GGAS---KPILEINLRHPLVAAI
HTPG_RHOPB      RASQRLTASASCLVAGGLGP-DRALERMLAQQNR---GAAS---KPILEVNLRHPIVAAV
HTPG_BRADU      KASTRLTSSASCLVADSQGP-SRELERILSQQNR---GMRA---KPVLEINLRHPMVGAI
HTPG_GLUOX      RSTVRLTGSAVVITSDG-GP-DLTMQRLMRRSGQA--MPAM---PPILEINPKHPLIKAL
HTPG_MAGSA      RPSERLTESAVCLVAAEGEM-SMHLEKMLRAHNQA--PGER---ARILEINPRHALIKGL
HTPG_RHORT      RVSARLTDSPVCLVAKEGAM-SLHLQKLLRQANQG--SELSG--DRVLEINPRHALVKTL
HTPG_ROSDO      RPSKRLTDSPVCLIADEGDI-DVNLERMLKRHGQL--QDAM---PRVLELNPDHRIITKL
HTPG_RICRS      KISKKLTSSPACLAVSDAAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_RICRO      KISKKLTSSPACLAVSDAAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_RICCN      KISKKLTSSPACLAVSDAAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_RICFE      KISKKLTSSPACLAVSDAAM-DIRMERFLIEQKQI--AAAS---AKNLELNPKNKIIEKI
HTPG_RICAH      KISKKLTSSPACLAVSDSAM-DIRMERFLIEQKQI--TAAS---AKNLELNPKNKIIEKI
HTPG_RICCK      KISKKLTSSPACLAVSESAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_RICBR      KISKKLTSSPACLAVSEAAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_RICB8      KISKKLTSSPACLAVSEAAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_RICTY      KISKKLTLSPACLAVSDTAM-DIRMERFLIEQKQI--ASAS---AKNLELNPKNKIIEKI
HTPG_RICPR      KISKKLTLSPACLAVSDTAM-DIRMERFLIEQKQI--ANAS---AKNLELNPKNKIIEKI
HTPG_ORITB      EVSKKLTRSPVCLTVPEGSM-DIRTERFLIEQKQL--SSHS---SKILEINPNHTIIKKI
HTPG_EHRCJ      RVSKKLTNSPVCLAVADGSM-DIRMERFLREQKQL--NYKS---TKILEINPKHPIVSRM
HTPG_EHRCR      RVSKKLTNSPVCLAVADGSM-DIRMERFLREQKQL--NYKS---TKILEINPKHPIVTKM
HTPG_EHRRW      RVSKKLTDSPVCLAVADGSM-DIRMERFLREQKQL--NYKS---TKILEINSKHPIVSKM
HTPG_EHRRG      RVSKKLTDSPVCLAVADGSM-DIRMERFLREQKQL--NYKS---TKILEINSKHPIISKM
HTPG_WOLPM      KISKKLTDSPVCLAVDEGAM-DLRMERFLREQKQL--NYRT---PKVLEINTKHPLIKSI
HTPG_WOLTR      KISKKLTDSPVCLAVDEGAM-DLRMERFLREQNQL--NYRT---PKVLEVNTKHSVIKSI
HTPG_ANAPZ      RVSKKLTTSLVCLAVPDNSM-DIRMERFLREQKQL--NYKG---NRILEINIDHPIAKSL
HTPG_ANAMM      KVSRKLTTSLVCLAVPEHAL-DIRMERFLREQKQL--SYKG---SRILELNIKHPVLSGL
HTPG_NEOSM      RISKRLTESPVCLAVPDGAM-DIRMEKFMLEQKQL--HSRS---KKILEINASHPVIGKI
HTPG_TREDE      RFSKRLSDSPSCIVVDETDP-SLQMERMMRAMGQF--N--TSAVKPILEVNADHPLVQKL
HTPG_TREPA      RLSKRLSDSVSCIVIDENDP-TVQMERLMRATGQT--H--KSKIKPILEINASHTLVQKL
HTPG_HELPH      ELSSHL-TSAVALIGDEQNA---MMANFMRQMGQS--V---PESKKTLELNPNHAILQKL
HTPG_HELPJ      ELSGHL-TSAVALIGDEPNA---MMANWMRQMGQS--V---PESKKTLELNPNHAILQKL
HTPG_HELPY      ELSSHL-TSAVALIGDEQNA---MMANWMRQMGQS--V---PESKKTLELNPNHAILQKL
HTPG_HELAH      ELSSHL-TSAVALIGDEQNA---MMANLMRQMGQN--M---PESKKTLELNPNHAILQKL
HTPG_HELHP      KLSSLG-DAPLTLIKEDNNP---MMANLMAQMGQK--V---PETKPILQLNITHPLFEKL
HTPG_WOLSU      RLSKRLVDSPACVVADEDDP-NFAMIKMMRQMGNA--LGDFPEPKPILELNPEHPMVGKL
HTPG_CAMJJ      RLTSRLKDSPSCIVYDKNKP-DFAMQQLLKQMGQE------QNFKPILEINPKHAIFTGL
HTPG_CAMJ8      RLTSRLKDSPSCIVYDKNKP-DFAMQQLLKQMGQE------QNFKPILEINPKHAIFTGL
HTPG_CAMJR      RLTSRLKDSPSCIVYDKNKP-DFAMQQLLKQMGQE------QNFKPILEINPKHAIFTGL
HTPG_CAMJE      RLTSRLKDSPSCIVYDKNKP-DFAMQQLLKQMGQE------QNFKPILEINPKHAIFTGL
HTPG_CAMJD      RLTSRLKDSPSCIVYDKNKL-DFAMQQLLKQMGQE------QNFKPILEINPKHAIFTGL
HTPG_CAMHC      KISKRLKNALGVLVFDKNDP-NYAMQAIYKQMGQE--N--LPEVLPILEINKDHEIIKKL
HTPG_SULNB      KISTRLTESPSCVLKDASDP-MAGMAAMFAQMGQE-----MPEIPLILEINPEHEMIKKL
HTPG_ARCB4      KVTSRLSESPSCVVKDAADAQMAAMAHMFRAMGQA-----MPESAPILEINPEHEIVKKL
HTPG_BORBP      NLSATLIKEPSAIIVDSNDP-TYQMQKIMLSMGQE--V---KEIKPILELNPNNKIVQNL
HTPG_BORBU      NLSATLIKEPSAIIIDSNDP-TYQMQKIMLSMGQE--V---KEIKPILELNPNNKIVQNL
HTPG_BORAP      NLSATLIKEPSAIIVDSNDP-TYQMQKIMLSMGQE--V---KEIKPILELNPNNKIVQNL
HTPG_SULDN      EVTFDLVDSPVKLKEDKEDP-AFMMAQIMKQMGQS--G-DTPAPAPILQINPKHELIIKL
HTPG_MYCTA      RLSTRLTESPACLITDAFGM-TPALARIYRASGQE--VP---VGKRILELNPSHPLVTGL
HTPG_MYCBO      RLSTRLTESPACLITDAFGM-TPALARIYRASGQE--VP---VGKRILELNPSHPLVTGL
HTPG_MYCBP      RLSTRLTESPACLITDAFGM-TPALARIYRASGQE--VP---VGKRILELNPSHPLVTGL
HTPG_MYCTU      RLSTRLTESPACLITDAFGM-TPALARIYRASGQE--VP---VGKRILELNPSHPLVTGL
HTPG_MYCA1      RLSNRLTDSPACLITDAFGI-TPALARLYRASGQD--IP---VGKRILELNPKHPLVTGL
HTPG_MYCPA      RLSNRLTDSPACLITDAFGI-TPALARLYRASGQD--IP---VGKRILELNPKHPLVTGL
HTPG_MYCUA      RLSTRLTESPACLITDTFGI-TPALARIYRATGQD--VP---VGKRTLELNPTHPLVIGL
HTPG_MYCLE      RLSTRLTESPACLITDAFGI-TPALARIYRASGQD--VP---FGKRILELNPNHPLITGL
HTPG_MYCGI      RLSTRLTDSPACLITDTFGI-TPALARMYRASGQP--VP---VEKRILELNPTHPLVVGL
HTPG_MYCVP      RLSTRLTDSPACLITDTFGI-TPALARMYRASGQP--VP---VEKRILELNPNHPLITGL
HTPG_RHOJR      RLSTRLTTSPACIVGDAFSM-SPALERMYRASGQP--VP---VTKRILELNPTHPLVTGL
HTPG_NOCFA      RLTNRLTTSPACLVGDVFDF-TPMLERMYRASGQP--VP---VSKRILELNPTHPLVTGL
HTPG_SALTO      RLSARLTTSPACVVGDAHDV-TPTLEKMYRAMGHE--VP---QVKRILELNPTHPLVSGL
HTPG_SALAI      RLSARLTTSPACVVGDAHDV-TPTLEKMYRAMGHE--VP---QVKRILELNPTHPLVSGL
HTPG_FRACC      RLSSRLTTSPACLVGDTFDM-TPALEKMYRAMGHE--MP---RPKRILELNPTHALVMGL
HTPG_STRCO      RLSSRLTVSPACVVSDAGEL-TPALENMYRAMGQE--VP---GAKRILELNPEHQLVKSL
HTPG_GEOSL      RLSNRLTDSACCLVADEHGL-NANMERILRAMNQT--VP---ESKRILELNPDHPIMQVM
HTPG_GEOMG      RLSSRLTDSACCLVADEHGL-NANMERILRAMNQD--VP---ESKRILELNPDHPLMQVM
HTPG_GEOUR      RFSSRLTDSACCLVADEYGL-NANMEKILKAMNQD--VP---ESKRVLELNPDHPLMQVL
HTPG_PELPD      RLSKRLTDSACCLVADEYGI-NANMERILKAMNQP--VP---DSKRVLELNPDHPIMKIM
HTPG_BDEBA      VLSDRLTNTPACLVASSADP-SAHMQKLMAQMGKE--YAGQ-QVKRIMEINPNHPVFEKM
HTPG_MYXXD      RVSDRLTDSPVCLVVPEGGS-PAYLERLLQQRGRG--AGMP-RVKRILEVNPKHPVIEHL
HTPG_METFK      RVTHRLTDSPACLVAGEHDL-SGNLERLLKAAGQK--TPG---SKPILEINPDHGIVQRL
HTPG_THIDA      RVTHRLTDSPACLVTGEGDM-SANLERLLKAAGQA--APT---VKPTLEINPSHALVTRL
HTPG_CHRVO      RATARLVESPACLVAGEHDM-SAHLERMLKAAGQK--IEG---SKPTLEINPEHVLVKRL
HTPG_DECAR      RVTYRLTDSPSCLVSDEHDP-SGNLARLMKAAGQP--MPN---SKPILEINPQHPAVMRL
HTPG_AROAE      RVTHRLTDSPACLVADEHDV-GMNLARILKAAGQQ--APA---SKPILEINPQHPAVMRL
HTPG_NITEC      RITYRLTESPACLVADTHDM-SGNLGRLLKSAGQK--VPD---SKPFLEINPHHPMVQRL
HTPG_NITEU      RITYRLTESPACLVADTHDV-SGNLGRLLKSAGQK--VPD---SKPFLEINPHHPMIQRL
HTPG_NITMU      RITLRLTESPACLVTETHDM-SGNLERLLKSAGQK--VTH---TKPILEINPYHPMVERL
HTPG_BORBR      RVTQRLVDSPACVVVGQNEL-SPHLLRMLKAAGQE--APE---VKPVLEINPDHALIARI
HTPG_BORPA      RVTQRLVDSPACVVVGQNEL-SPHLLRMLKAAGQE--APE---VKPVLEINPDHALIARI
HTPG_BORPE      RVTQRLVDSPACVVVGQNEL-SPHLLRMLKAAGQE--APE---VKPVLEINPDHALVARI
HTPG_BORA1      RVTLRLVDSPACVVVGQNDL-SPHLLRMLKAAGQE--VPE---VKPVLEINPEHALIARI
HTPG_BURPS      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURMA      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURM7      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURP1      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURM9      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURMS      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURP0      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURP6      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQS--APS---FQPILEINPEHPLVKAL
HTPG_BURTA      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQN--APS---FQPILEINPEHPLVKAL
HTPG_BURCA      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQN--APA---MQPILEINPEHALVKQL
HTPG_BURCH      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQN--APA---MQPILEINPEHALVKQL
HTPG_BURCM      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQN--APA---MQPILEINPEHALVKQL
HTPG_BURL3      RVTFRLTDSPSCLVADDNDM-SGYLQRMLKAAGQN--APA---MQPILEINPEHALVKQL
HTPG_PARXL      RLTFRLTDSPSCLVADDGEM-SGYLQRMLKAAGQQ--APS---FHPILEVNPEHALVKGL
HTPG_CUPNH      RVTLRLTASASCLVSDEGDM-SGYLQRLLKQAGQK--APD---AQPILELNPEHALVQKL
HTPG_CUPPJ      RVTLRLTASASCLVSDEGDM-SGYLQRLLKQAGQK--APD---AQPILELNPEHALVKKL
HTPG_CUPMC      RVTLRLTDSASCLVSDDGDM-SGYLQRLLKQAGQK--APD---AQPILELNPEHALVKKL
HTPG_RALSO      RITHRLTDSPSCLVADEGDI-SGTLARLLKQAGQK--APD---TKPVLELNPAHPLVRKL
HTPG_ACISJ      RVTTRLVDSPACLVVQDGGM-STQLARLLKQAGQS--APD---AKPVLEVNPEHALVKKL
HTPG_VEREI      RVTTRLVDSPACLVVHGDGM-STQLARLLKQAGQQ--APE---TKPVLEVNASHALVRKL
HTPG_RHOFT      RVTTRLVDSPACLVVQDHGM-STQLARMLKQAGQA--APD---VKPVLEVNAEHPLVKKL
HTPG_POLNA      RATSRLVDSPACLVVQDGDM-STQLARMLKQAGQT--VPE---VKPILEVNAQHPLVRKL
HTPG_POLSJ      RATTRLVDSPACLVVQDGDM-STQLARMLKQAGQA--VPE---VKPILEVNAQHPLVKKL
HTPG_METPP      RVTTRLVDSPACLVVEDGDI-SGHLARLLKQAGQS--APT---SLPILEVNTEHALVKRL
HTPG_PSYCK      KVSTRLVDSPACLVVGEGEL-SPQMIQMLKQMGQD--VPE---SKPTLEVNPDHPLIKKL
HTPG_PSYA2      KVSTRLVDSPACLVVGEGEL-SPQMIQMLKQMGQD--VPE---SKPTLEVNPDHPLIKKL
HTPG_ACIAD      RVTTRLVDSPACLVTSDGEL-SPQLIRMLKQAGQA--VPE---SKPILEINPEHPLVQKL
HTPG_ALKEH      RVSTRLTDSPACLVVGEYDF-GMGMQRLLKAAGHA--MPQ---GKPALEINIDHPIVQRM
HTPG_HALHL      RVSHRLTDSPACLVVGEYDF-GMGMQRLLQAAGHQ--LPA---GQPALEVNPDHSVIERL
HTPG_NITOC      RVTHRLTDSPVCLVVEQHDM-SGYLERLLKEAGQQ--APH---IQPILELNPAHPIIARL
HTPG_MAGMM      RLSHRLTESPACLVGDAHDM-SATLERLLKEAGQE--VPT---AKRILEINPSHALLKRL
HTPG_METCA      RLSHRLTDSPACLISESYGM-SRTMERIMKSAGQN--IPG---SKPILEINPHHGLIARL
HTPG_COXBR      RITHRLTDSPTCVVFDENEM-SGHLQRLLIQTGQD--FMQ---AKPILEINPSHPLILRV
HTPG_COXBU      RITHRLTDSPTCVVFDENEM-SGHLQRLLIQTGQD--FMQ---AKPILEINPSHPLILRV
HTPG_COXBN      RITHRLTDSPTCVVFDENEM-SGHLQRLLIQTGQD--FMQ---AKPILEINPSHPLILRV
HTPG_HAEIN      RLTHNLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHHLVKKV
HTPG_HAEIE      RLTHNLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHHLVKKV
HTPG_HAEI8      RLTHNLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHYLVKKV
HTPG_HAEIG      RLTHNLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHHLVKKV
HTPG_AGGAC      RLTHRLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHHLVKKV
HTPG_HAES1      RLTHRLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHHLVKKV
HTPG_HISS2      RLTHRLTDTPAVVSTDNDQM-TTQMAKLFAAAGQP--VPE---VKYTFELNPEHHLVKKV
HTPG_PASMU      RLTHRLTDTPAVVSTGDDQM-TTQMAKLFAAAGQA--MPE---VKYTFELNPEHGLVQKV
HTPG_ACTSZ      RLTHRLTDTPAVVSTDNDQM-TTQMAKLFAMSGQP--VPE---VKYTFELNPDHALVKKT
HTPG_MANSM      RITHRLTDTPAVVSTDNDQM-TTQMAKLFAMSGQP--VPE---VKYTFEINPQHELVKKA
HTPG_ACTP2      VLTHRLTDTPAVVSTDNDEM-TTQMAKLFAAMGQK--APE---VKYTFELNPDHRMVKKI
HTPG_ECOLI      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECOL5      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECOHS      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECOL6      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_SHIBS      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_SHISS      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECO57      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECOLC      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECOUT      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECOK1      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_ECO24      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_SHIFL      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_SHIDS      RLTHRLTDTPAIVSTDADEM-STQMAKLFAAAGQK--VPE---VKYIFELNPDHVLVKRA
HTPG_SALPB      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQS--VPE---VKYIFELNPDHVLVKRT
HTPG_SALPA      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQS--VPE---VKYIFELNPDHVLVKRT
HTPG_SALTY      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQS--VPE---VKYIFELNPDHVLVKRT
HTPG_SALCH      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQS--VPE---VKYIFELNPDHVLVKRT
HTPG_SALTI      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQS--VPE---VKYIFELNPDHVLVKRT
HTPG_CITK8      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQA--VPE---VKYIFELNPDHVLVKRT
HTPG_CROS8      RLTHRLTDTPAIVTTDNDEM-STQMAKLFAAAGQA--VPE---VKYIFELNPDHQLVKRT
HTPG_KLEP7      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQA--APE---VKYIFELNPAHQLVKRA
HTPG_ENT38      RFTHRLTDTPAIVTTDADEM-GTQMAKLFAAAGQA--MPE---VKYIFELNPDHPLVKRA
HTPG_PECAS      RFTYRLTDTPAIVVTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPEHALIKRA
HTPG_YERPA      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPDHGLVKRA
HTPG_YERPS      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPDHGLVKRA
HTPG_YERPN      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPDHGLVKRA
HTPG_YERPP      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPDHGLVKRA
HTPG_YERPE      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPDHGLVKRA
HTPG_YERE8      RLTHRLTDTPAIVTTDADEM-STQMAKLFAAAGQQ--APE---VKYIFELNPEHSLVKRA
HTPG_SERP5      RLTHRLTDTPAIVITDADEM-STQMAKLFAAAGQE--APA---VKYIFELNPEHALVKRA
HTPG_PHOLL      KLTHRLTDTPAIVTTNVDEM-STQMAKLFAAAGQQ--VPD---VKYNFELNPDHQLVKLA
HTPG_SODGM      RLTHRLTDTPAVVTTDADDM-TTQMAKLFAAAGQA--APE---IKYIFELNPDHALVKRT
HTPG_BAUCH      RLTYSLTDTPAIVTIDSNNM-TTHMAKLIVASGQN--KPD---IKYIFELNPLHPIVKKV
HTPG_VIBCH      RTTFKLANTPAVVVTDDYEM-GTQMAKLLAAAGQP--VPE---VKYILEVNPEHALVKRM
HTPG_VIBC3      RTTFKLANTPAVVVTDDYEM-GTQMAKLLAAAGQP--VPE---VKYILEVNPEHALVKRM
HTPG_VIBPA      RTTFKLASTPAVVVTDDYEM-GTQMAKLLAAAGQA--VPE---VKYIFEINPEHELVKRM
HTPG_VIBCB      RTTFKLATTPAVVVTDDFEM-GTQMAKLLEAAGQA--VPE---VKYIFEINPEHALVKRM
HTPG_VIBVY      RTTFKLANTPAVVVTDDFEM-GTQMAKLLAAAGQA--VPE---VKYIFEINPNHTLVKQM
HTPG_VIBVU      RTTFKLANTPAVVVTDDFEM-GTQMAKLLAAAGQA--VPE---VKYIFEINPNHTLVKQM
HTPG_ALIF1      RTTFKLATTPAVVVTDDFEM-GTQMAKLLEAAGQA--APE---VKYIFEINPDHALVKQM
HTPG_PHOPR      RTTFKLHDTPAVVVTDENEM-GTQMAKLLAAAGHD--APE---VQYIFEINPEHGLVKQM
HTPG_AERHH      RVTHRLTDSPSCIVTDAHGM-STQMIKLMRAAGQP--VPE---QKYILELNPDHALVKKL
HTPG_AERS4      RVTHRLTDSPSCIVTDNHGM-STQMIKLMRAAGQP--VPE---QKYILELNPDHALVKKL
HTPG_PSEHT      RFTHRLTDSPACVVSDDNDM-SSQMQKLMESVGQA--APE---AKPVFELNPEHQLVKHL
HTPG_COLP3      KLSQRLTDSPACIVADDDDM-SSQMAKLMASVGQE--VPD---TLPIFEINGEHALVKHV
HTPG_PSEA6      KFTHRLTDSPACIVADGTGM-STQMIKLMQAAGQP--VPE---AKYHFELNPEHSLVKML
HTPG_IDILO      RVTNRLTNSPACIITDDNDM-STQMAKLMEAAGQA--VPE---TKYIFEVNPEHPLVQRM
HTPG_PSYIN      RLTHRLTSTPSCIVADNDDM-STQMAKLMAQMGQP--VPE---SKPVFELNPEHVMIVKL
HTPG_SHEPA      KVTTRLTDTPACVVAGEGEM-STQMIKLMQAAGQD--VPE---PKPTFELNPEHPLVARL
HTPG_SHEHH      KVTTRLTDTPACVVAGEGEM-STQMIKLMQAAGQD--VPE---SKPTFELNPEHPLVARL
HTPG_SHESH      KVTTRLTDTPACVVAGEGEM-STQMIKLMEAAGQA--VPE---SKPTFEINPEHPLVARL
HTPG_SHELP      KVTSRLTDTPACVVAGAGEM-SSQMIKLMQAAGQA--VTE---SKPVFELNPEHPLVKRL
HTPG_SHEPC      KVTSRLTDTPACVVTGEGEM-STQMIKLMQAAGQP--VPE---VKPTFEVNPAHPLVSRL
HTPG_SHESW      KVTSRLTDTPACVVTGEGEM-STQMIKLMQAAGQP--VPE---VKPTFEVNPAHPLVSRL
HTPG_SHESM      KVTSRLTDTPACVVTGEGEM-SSQMIKLMQAAGQP--VPE---VKPTFEINPAHPLVSRL
HTPG_SHESR      KVTSRLTDTPACVVTGEGEM-SSQMIKLMQAAGQP--VPE---VKPTFEINPAHPLVSRL
HTPG_SHESA      KVTSRLTDTPACVVTGEGEM-SSQMIKLMQAAGQP--VPE---VKPTFEVNPAHPLVSRL
HTPG_SHEON      KVTSRLTDTPACVVTGEGEM-STQMIKLMQAAGQP--VPE---VKPTFEVNPAHPLVSRL
HTPG_SHEB9      KVTSRLTDTPACVVAGEGEM-STQMIKLMQAAGQP--VPE---VKPTFEINPAHPLVSRL
HTPG_SHEB8      KVTSRLTDTPACVVAGEGEM-STQMIKLMQAAGQP--VPE---VKPTFEINPAHPLVSRL
HTPG_SHEB5      KVTSRLTDTPACVVAGDGEM-STQMIKLMQAAGQP--VPE---VKPTFEINPAHPLVSRL
HTPG_SHEDO      KVTTRLTDTPACVVAGEGEM-STQMIKLMQAAGQA--VPE---SKPTFEINPNHPLVARL
HTPG_SHEFN      RVTSRLTDTPACVVAGEGEM-STQMIKLMQAAGQP--VPE---SKPTFEINPTHPLVEHL
HTPG_SHEAM      KITTRLTDTPACVVTGEGEM-SSQMIKLMQAAGQP--VPE---SKPTLELNPTHPLVARL
HTPG_BUCAI      RLTHRLTETPCVLLSDSTEM-TTQMAKLFSAAGQS--VPE---LKYIFEINPDHILIKKI
HTPG_BUCAP      RLTYRLTETPCIVLSDSNEM-STQMAKLFSAAGQS--VPE---LKYIFEINPEHKLIQKI
HTPG_BUCBP      RFTHKLTNTPAMVITDSNEM-STQMAKLFSAAGQT--VPT---IKYILEINPNHLLIKKI
HTPG_BUCCC      KITYRLKNTPAIVLTDTNDM-STQMAKIFSAAGQP--IPK---IKYILEINPLHPLIKKI
HTPG_WIGBR      RFTSKLTNSPSTVTTDENDI-TTQMSKLLISTGQE--SPE---IKYIFELNANHPIIKHV
HTPG_LEGPH      LLTNRLTDSPACVVADEQDM-GLEMQRILQAAGQQ--VPV---SKPIFEINPDHALIKRL
HTPG_LEGPC      LLTNRLTDSPACVVADEQDM-GLEMQRILQAAGQQ--VPV---SKPIFEINPDHALIKRL
HTPG_LEGPL      LLTNRLTDSPACVVADEQDM-GLEMQRILQAAGQQ--IPV---SKPIFEINPEHALIKRL
HTPG_LEGPA      LLTNRLTDSPACVVADEQDM-GLEMQRILQAAGQQ--VPV---SKPIFEINPDHALIKRL
HTPG_PSEAE      RVSHRLTDSPAILAIGEQDL-GLQMRQILEASGQK--VPD---SKPIFEINPQHPLIEKL
HTPG_PSEA7      RVSHRLTDSPAILAIGEQDL-GLQMRQILEASGQK--VPE---SKPIFEINPQHPLIEKL
HTPG_PSEMY      RVSHRLTDSPAILAIGEQDL-GLQMRQILEASGQK--VPE---SKPIFEFNPSHPLIERL
HTPG_PSEPF      RVSHRLTDSPAILAIGEQDL-GLQMRQILEASGQK--VPD---SKPIFEFNPSHPLIEKL
HTPG_PSEF5      RVSHRLTDSPAILAIGEQDL-GLQMRQILEASGQK--VPD---SKPIFEFNPTHPLIEKL
HTPG_PSEU2      RVSHRLTDSPAILAIGEQDM-GLQMRQILEASGQK--VPD---SKPIFEFNPAHPLIGKL
HTPG_PSE14      RVSHRLTDSPAILAIGEQDM-GLQMRQILEASGQK--VPD---SKPIFEFNPAHPLIGKL
HTPG_PSESM      RVSHRLTDSPAILAIGEQDM-GLQMRQILEASGQK--VPD---SKPIFEFNPAHPLIGKL
HTPG_PSEPK      RVSHRLTDSPAILAIGEQDL-GLQMRQILEASGQK--VPE---SKPIFEFNPSHPLIEKL
HTPG_XANC5      RVSHRLTDSPAILAIGQGDL-GLQMRQLLEASGQA--VPE---SKPVFEFNPTHPLIEKL
HTPG_XANAC      RVSHRLTDSPAILAIGQGDL-GLQMRQLLEASGQA--VPE---SKPVFEFNPTHPLIEKL
HTPG_XANOM      RVSHRLTDSPAILAIGQGDL-GLQMRQLLEASGQA--VPE---SKPVFEFNPTHPLIEKL
HTPG_XANOR      RVSHRLTDSPAILAIGQGDL-GLQMRQLLEASGQA--VPE---SKPVFEFNPTHPLIEKL
HTPG_XANCP      RVSHRLTDSPAILAIGQGDL-GLQMRQLLEASGQA--VPE---TKPVFEFNPAHPLIEKL
HTPG_XANC8      RVSHRLTDSPAILAIGQGDL-GLQMRQLLEASGQA--VPE---TKPVFEFNPAHPLIEKL
HTPG_XYLFA      RVSHRLTDSPAVLAIGEGDL-GLQMRQLLEASGQK--VPE---TKPVFEFNPSHPLIEKL
HTPG_XYLFT      RVSHRLTDSPAVLAIGEGDL-GLQMRQLLEASGQK--VPE---TKPVFEFNPSHPLIEKL
HTPG_SACD2      RITHRLTESPACLVVGEHDM-GAQMRRLLEAAGQA--VPE---SKPIIEINPTHPLVQKL
HTPG_MARHV      RVTNRLTDSPACLVVGQFDM-GAQMKKIMEAAGQK--VPE---SKPIFEINVDHPLVQRL
HTPG_HAHCH      RVTHRLTDSPACLVVGAYDM-GVQMRRIMEAAGQA--LPE---SKPTFEINPDHPLVKKL
HTPG_MARMS      NSTDRLTNSPACLVVGEYDM-GLQMRRLLEQAGQK--LPE---SKPTLEVNPDHPIVAKM
HTPG_CHRSD      RITHRLTDSPACVVLSEHDM-GYQMRRLMEAAGQP--LPE---VKPILELNPEHSLVARL
HTPG_ALCBS      RATTRLVDSPACLVLAEDQL-GPQMRRMLEAAGQP--VPE---NKPVLEVNLDHTLLQAL
HTPG_RUTMC      KVSSRLSDSPSCLVVDENEM-GGNMERIMKSLGQD--VPD---TKPILEINPNHPLVKKL
HTPG_VESOH      KISSRLSESPSCLVADENEM-GGNMERIMKSLGQD--IPD---TKPILEINPTHSLVKKL
HTPG_HYDCU      KITHRLTDSPACVVSAEGDI-SAHMARMMEQMGQA--MPK---QKPVLELNPDHALVKKL
HTPG_FRAT1      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQS--FMPGMGMKPILELNAEHNLVQKL
HTPG_FRATT      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQS--FMPGMGMKPILELNAEHNLVQKL
HTPG_FRATW      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQS--FMPGMGMKPILELNAEHNLVQKL
HTPG_FRATN      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQG--FMPGMGMKPILELNAEHNLVQKL
HTPG_FRATF      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQS--FMPGMGMKPILELNAEHNLVQKL
HTPG_FRATH      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQS--FMPGMGMKPILELNAEHNLVQKL
HTPG_FRAP2      RLSKRLTDSPSCVVVNDYGM-SLHMQKMMEEAGQG--FMPGMGMKPILELNAEHNLVQKL
HTPG_PELLD      VESHRLVSSPVTLVSGKDAM-DSQMERMMKMMQ-----QEMPAGRKILEVNPSHPIIRNL
HTPG_CHLPM      VESHRLVSSPVTIVGGKDAM-DSQMERMMKMMQ-----QEMPAAKKVLEVNPRHPIIRNL
HTPG_CHLCH      VESRRLVSSPVTLVSGKDAI-DSQLERMMKMMN-----TPMPPAKRILEVNSSHPIVRNI
HTPG_CHLPD      VESHRLVSSPVTLVSGKDSL-DSSMEKMMKMMH-----AEMPAAKKILEVNTSHPIIKNL
HTPG_CHLTE      VESRRLVSSPVTLVSGKDAL-DSQFEKMMKMMNKD---ADMPSTKKILEINTAHPIIRNL
HTPG_DESHY      RESKRLVDSPAIILSHYGTH-SMQRMMQLMNRDLQDVPAGI------LEINPKHVLIQRL
HTPG_DESPS      LSSHRLVDAPAMIVNADGFM-SASMERVLAASRKEQGIAGVDGSKKHLEINGKNPLIKQL
HTPG_DESAG      RESARLSDSPACLASKDGGM-TASMEKLMRVMN-----KDESVPRKVLEINPDHPLTRNL
HTPG_DESVH      RISHRLADSPACLVQPGGAS-TSSMDRLLRVLH-----KDESVPRKVFEVNRDHPILRNL
HTPG_BACFR      TQALGENGSPVMITQSEYMRRMKEMANIQAGMSFYGEMPD----MFNLVLNSDHKLVKEV
HTPG_BACFN      TQALGENGSPVMITQSEYMRRMKEMANIQAGMSFYGEMPD----MFNLVLNSDHKLVKEV
HTPG_BACTN      TQALGDNSAPVMITQSEYMRRMKEMANIQAGMSFYGEMPD----MFNLVLNSDHKLIKQV
HTPG_PORGI      FESLGAEGEAILITQAEFMRRMRDMAQLQPGMSFYGELPD----SYNLVLNTDHPLIDRV
                  :         .                                  : .*  :      

HTPG_BACSU      QDAFEQ------------DKEKLSLYTNLLYNQALLIEGLPIQDPVEFTNNICKVMV---
HTPG_BACVZ      KNAHGQ------------DREKLALYTNLLYNQALLIEGLPIHDPVEFTNDICKVMV---
HTPG_BACLD      QNAFDN------------DKDKFKLYTGLLYNQALLIEGLPIEDPVEFTNDICKVMA---
HTPG_BACHD      KASFES------------DKDKVDLYTKLLYNQALLIEGLPVEDPVAFSNDICKVMA---
HTPG_BACSK      KQAYEE------------DEDKLKLYTNLLYNQALLIEGLPLEDPVEFSQNMCKVMV---
HTPG_OCEIH      KAAQGN------------DDEKFKLYTNLLYNQALLIEGLPINDPVEFTNDICKVMV---
HTPG_CLOBH      KEAYEG------------DKEKLKLYTDLLYNQALLIEGLAINDPVEFTNNICKIMK---
HTPG_CLOB1      KEAYEG------------DKEKLKLYTDLLYNQALLIEGLAINDPVEFTNNICKIMK---
HTPG_CLOBL      KEAYEG------------DKEKLKLYTDLLYNQALLIEGLAINDPVEFTNNICKIMK---
HTPG_ALKMQ      KEAFDN------------DQEKLKIYTNVLYNQALLIEGLTINDPVEFTNDICKLMS---
HTPG_ALKOO      KDAYKN------------DSEKFGLFTELLYNQALLIEGLPINDPVEFSNSICKLMI---
HTPG_CLOP1      KDALEN------------DKDKFNLYTKLLYNQALLVEGLSIEDPVDFTNDICKLMK---
HTPG_CLOPE      KDALEN------------DKDKFNLYTKLLYNQALLVEGLSIENPVDFTNDICKLMK---
HTPG_CLOPS      KDALEN------------DRDKFNLYTKLLYNQALLVEGLSIEDPVDFTNDICKLMK---
HTPG_CLOAB      KAAFKD------------DKDKLKKYASLLYNEALLIEGLPIEDPVQFANDVASLMK---
HTPG_CLOTE      KSAFKD------------DKDKLKMLSSLLYNQALLIEGLPIEDPVQFANDVCKLIK---
HTPG_FUSNN      KSSV--------------NTEDFNKLVDVLYNQALLLEGFNIENPAEFIKNLNSLIK---
HTPG_RHIME      ATCPSE------DKA------FREDAVKLLLDQARVLDGDRPEDPRAFAERLSRVFGRAL
HTPG_RHIEC      AAV-ED------DAS------YQEDATFLLLDQARILDGERPQDPRKFAQRLARVFERSV
HTPG_NITWN      AALGQD------DRE------FKEDAARMLLDDARVLDGDRPSDALEFSRRLIRLVERGL
HTPG_NITHX      AALGDG------DRA------FKEDTARMLLDDARVLDGDRPSDALEFSRRLARIVERGL
HTPG_AZOC5      AAHGAS------DSN------FRADAAHLLLDQARVLDGDQPSDPQAFAERLMRVMQRGL
HTPG_RHILO      AGLGDE------DQA------FKDDAAHLLYDEARVLDGDKPADARAFSERLARLIARGI
HTPG_RHOP2      ADT-KA------DKA------DATDLSFLLLEQAQILDGELPEDPAAFAGRLNRLVLRGV
HTPG_RHOPS      ADA-KA------DKA------DATDLSFLLLEQAQILDGELPEDPAAFAGRLNRLVLRGL
HTPG_RHOPA      GDT-KT------DKA------EAADLAFLLLEQAQILDGELPEDPAAFASRLNRLVLRGV
HTPG_RHOP5      G---RP------GNA------DAADLSLLLLEQAQILDGELPEDPAGFAGRINRLVLRAL
HTPG_RHOPB      A---KA------NAA------DAADLSLLLLEQAQILDGELPEDPAAFSARLNRLVLRAL
HTPG_BRADU      TKA-QA------GSK------AVDDLSLLLLEQAQILDGELPEDPAAFAARLNRLVLQGL
HTPG_GLUOX      AERVAK------GE-------SVKDYATVLLDLARVQEGEPLPDPTGFGRSLATLLAGPA
HTPG_MAGSA      AARVK----AGGTDA------GLEDAAFLLLDQARIIEGEPPADPAAFARRMVSVMEKGL
HTPG_RHORT      AERAA----TGGS---------VDEAALLLMDQARILEGEAPADAIAFARRLTEVMGKGL
HTPG_ROSDO      AERAKGS--AAASDT------LLKDAAHLLLDQARIADGETPADPAEFVRRLGSVMDSAL
HTPG_RICRS      FNDLKA----NNK--------NNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICRO      FNDLKA----NNK--------NNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICCN      FNDLKA----NNK--------NNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICFE      FNDLKA----NNK--------NNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICAH      FNDLKA----NNK--------NNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICCK      FNDLKA----NNK--------NNKELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICBR      FNDLKA----NNK--------NNEELVKLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICB8      FNDLKA----NNK--------NNEELVKLIFDQACILEGEPVADTGAFSKRLNDIVQKAI
HTPG_RICTY      FNDLKA----NNK--------NNEELVNLIFDQACILEGEPIADTGAFSKRLNDILQKAI
HTPG_RICPR      FNDLKA----NNK--------NNNELVNLIFDQACILEGEPVADTGAFSKRLNDILQKAI
HTPG_ORITB      NENIKL----NQNLD------VNKQLVMTLLDQSYLIEGQPIPDLQDYCNRINFFIEKSV
HTPG_EHRCJ      IDEYAN----TGENA------VLDNMLHLLLGQACILEGEELEDVSSFAERMNNVLVKVY
HTPG_EHRCR      IDEHAN----AGESV------TLENMLHLLLNQACILEGEELQDVSDFAERMNNILAKVY
HTPG_EHRRW      IDQYAE----NGENA------VLCNMLHLLLGQACILEGEELQNVSDFAERMNNVLSQIN
HTPG_EHRRG      IDQYTE----NGESA------MLCNMLHLLLGQACILEGEELQNVSDFAERMNSVLSQIN
HTPG_WOLPM      MKSYAE----SGENP------TLEDMIHLLFYQACIVEGEEMDDVSLFAKRLNNLLGKIS
HTPG_WOLTR      IKSYAE----NGENP------TLEDMVHLLFYQACIVEGEEMDDASLFAKKLNNLLGKVI
HTPG_ANAPZ      LKEHEA----RGESE------LLNGIVHLLYDEACIIEGEEIRSTVDFASRINGVLAKIF
HTPG_ANAMM      LREYKD----NGESE------LLENMVHVLFDQACIIEGEEVNSAVDFANRMNQVLARLF
HTPG_NEOSM      IGKVD--------SP------EVEDLIFLLYDQACILQGDEVRNPVRMSKALTRLLLMT-
HTPG_TREDE      KD--------SKDK------EFVEDMSNLLLEQALLVESGELKAPVDFVKRLNRLMTNLK
HTPG_TREPA      KE--------STDE------AFVEDLAFVLLDQALLIEGMDVGSSVDFVKRVNRLLARG-
HTPG_HELPH      LK--------CEDK------EQLSAFIWLLYDGAKLLEKGALKDAKSFNERLNSVLLKAL
HTPG_HELPJ      LK--------CEDK------EQLSAFIWLLYDGAKLLEKGALKDAKSFNERLNSVLLKAL
HTPG_HELPY      LK--------CEDK------EQLSAFIWLLYDGAKLLEKGALKDAKSFNERLNSVLLKAL
HTPG_HELAH      LK--------CEDK------EQMSAFIWLLYDGAKLLEKGALKDAKSFNERLNSVLLKAL
HTPG_HELHP      KT--------AQE-------DKIKQSALLLFGAALILEGSTLKNAKDFNTELNSLLLQSL
HTPG_WOLSU      LA--------LEDE------ERASDYAHLLLDQAKLLESGSLKDAVGFAKRLNAMLERAI
HTPG_CAMJJ      K----------NNE------SFSADIATLVLNMAKLSEGMGVDNPAEFNASLTKIINKAF
HTPG_CAMJ8      K----------NNE------SFSADIATLVLNMAKLSEGMGVDNPAEFNASLTKIINKAF
HTPG_CAMJR      K----------NNE------SFSADIATLVLNMAKLSEGMGVDNPAEFNASLTKIINKAF
HTPG_CAMJE      K----------NNE------SFSADIATLVLNMAKLSEGMGVDNPAEFNASLTKIINKAF
HTPG_CAMJD      K----------NNE------TFSADIATLVLNMAKLSEGMGVDNPAEFNASLTKIINKAF
HTPG_CAMHC      I----------ANQ------SEIAKISNIIFDLAKLSEGQNIDDASEFAKNVSEIIAKAI
HTPG_SULNB      DK--------VEDE------SLFNDLSWILLDSAKLSEGLEPKDKGAFAHRVASLATKAL
HTPG_ARCB4      NG--------CADE------ATIEDVSWILLDQAKLSEGMEITDTVAFAQRLSRITAKAL
HTPG_BORBP      KN--------LES-------EKLEKISILLFEEALLTSGMPSKNPGKFINIINEFLEKEL
HTPG_BORBU      KN--------LEP-------EKLEKISILLFEEAMLTSGMPSKNPGKFINIINEFIEKDF
HTPG_BORAP      KN--------LEP-------EKLEKISILLFEEALLTSGMPSKNPRKFINIINEFLEKDL
HTPG_SULDN      KN--------SADI------NLINDAAHLLLDQAKLFDGVQLEDTAGFVLRLNRVIAKAI
HTPG_MYCTA      RQAH----QDRADDAEK----SLAETAELLYGTALLAEGGALEDPARFAELLAERLARTL
HTPG_MYCBO      RQAH----QDRADDAEK----SLAETAELLYGTALLAEGGALEDPARFAELLAERLARTL
HTPG_MYCBP      RQAH----QDRADDAEK----SLAETAELLYGTALLAEGGALEDPARFAELLAERLARTL
HTPG_MYCTU      RQAH----QDRADDAEK----SLAETAELLYGTALLAEGGALEDPARFAELLAERLARTL
HTPG_MYCA1      RQAH----QDRADDP------SVAETAELLYGTALLAEGGALDDPARFAEILADRLARTL
HTPG_MYCPA      RQAH----QDRADDP------SVAETAELLYGTALLAEGGALDDPARFAEILADRLARTL
HTPG_MYCUA      RQAQ----ASADDDAKKE---AVSETAELLYGTALLAEGGAPDDPARFAELLADRLTRTL
HTPG_MYCLE      QQAH----ENGGDDTHLR---QLSETAELLYGTALLAEGGALENPAKFAGLLADLLSRSM
HTPG_MYCGI      REAH----ESRGADD------ELAGTAELLYGTALLAEGGALEDPARFAGLLADRLTRMV
HTPG_MYCVP      REAH----KSRGADA------ELVGTAELLYGTALLAEGGVLEDPARFAGLLADRLTRTV
HTPG_RHOJR      REAH----GERNEDP------ALGETAELLYGMALLAEGGELEDPARFTTMLANRLARTV
HTPG_NOCFA      RDAY----DQRKQDADEGKVPELTETAELLYGTAVLAEGGELKDPARFAHILTDRLTRTL
HTPG_SALTO      RKAR----EQGVTEE------SLKETAELLYGMALLAEGGELADPSHFTRILAERLARTL
HTPG_SALAI      RKAR----EQGATED------SLTETAELLYGMALLAEGGELADPSRFTRILAERLARTL
HTPG_FRACC      RAAH----ERDADSA------ALGDTAELLYGMALLAEGGELRDPARFTRLLAERLAEAL
HTPG_STRCO      NRAW----TDRQDRA------ELTETAELLHALAVLAEGGRPKEPARFVQLMADRLERTL
HTPG_GEOSL      ATLF----GKDKTNP------RLADYCDLLYDQALLTEGSPIADPLRFTRLVAELMVADG
HTPG_GEOMG      ANLF----ARDKANP------RLGDYCDLLYDQALLTEGSPISDPLRFTRLVAELMVADG
HTPG_GEOUR      SSIF----EKDKENP------RLADYCGLLYDQALLTEGSPVPDPLRFTRLVAELMVKAA
HTPG_PELPD      TEIF----RENKEDA------RLTDYADLLYDQALLTEGSPIKDPLRFTRLVSELMVKAA
HTPG_BDEBA      LKAS----PEQQ-----------TKWAEILYAQALLTEGSNLPDPVKFSQQIAELMVQAA
HTPG_MYXXD      KAVH----DRDPAAA------QVAEWIELLHDQALLTEGSTIADPNRFARRMTGLLTQVA
HTPG_METFK      KD--------VTDEA------KFADWAHLLFDQALLAEGGQLEDPAAFVRRVNAMLA---
HTPG_THIDA      DS--------ESDED------RFKDWANLLFEQALLAEGGQLDDPASFVRRLNGLLAMLP
HTPG_CHRVO      AE--------ESDEA------RAGDLAAVLYDQALLAEGGKLEDPASFVKRINKLMLELS
HTPG_DECAR      K----------YEES------RFDDWAALLFEQATLAEGGQLDDPAGFVKRINDLMMALS
HTPG_AROAE      K----------YEER------QFDDWAAVLFDQALLAEGGTLDDPATFVKRINQLMMAMG
HTPG_NITEC      K----------YEEA------KFADWSHILFDQALLAEGGQLEDPASFVRRLNDLLLQNI
HTPG_NITEU      K----------YEEA------KFADWSHILFDQALLAEGGQLEDPAGFVKRLNDLLLQNI
HTPG_NITMU      K----------SEET------HFADWSHILFDQALLAEGGQLEDPASFVKRINQLFLSTG
HTPG_BORBR      R---------DASDA------EFGDWAALLLDQALLAEGAQIADPAAFVKRLNGLLLKA-
HTPG_BORPA      R---------DASDA------EFGDWAALLLDQALLAEGAQIADPAAFVKRLNGLLLKA-
HTPG_BORPE      R---------DASDA------EFGDWAALLLDQALLAEGAQIADPAAFVKRLNGLLLKA-
HTPG_BORA1      R---------DVSDA------DFGAWAQLLLDQALLAEGAQIADPAAFVKRLNALLLKV-
HTPG_BURPS      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURMA      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURM7      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURP1      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURM9      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURMS      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURP0      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURP6      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURTA      ----------KADGA------DFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRA
HTPG_BURCA      ----------NADSA------DFGDWCHLLFDQALLAEGGMLDDPASFVKRTNALLLSRA
HTPG_BURCH      ----------NADSA------DFGDWCHLLFDQALLAEGGMLDDPASFVKRTNALLLSRA
HTPG_BURCM      ----------NADSA------SFGDWCHLLFDQALLAEGGMLDDPASFVKRTNALLLSRA
HTPG_BURL3      ----------KADSA------DFGDWCHLLFDQALLAEGGMLDDPASFVKRTNALLLSRA
HTPG_PARXL      ----------HADSA------NFDDWCHLLFDQALLAEGGALEDPASFVKRTNALLLARA
HTPG_CUPNH      RDLP--------EGD------AFSDRVQVLFDQALLAEGGMLDDPAAYVQRVNKLLA---
HTPG_CUPPJ      RDLP--------EGD------GFNDRLLVLFDQALLAEGGMLDDPAAYVQRVNKLLA---
HTPG_CUPMC      RDLP--------DGE------AFGDRVRVLFDQALLAEGGMLDDPAAYVQRVNRLLA---
HTPG_RALSO      ALLESV-TGGEADRA------AFEDRLHVLFDQALLAEGGSLADPADYVQRVNRLLA---
HTPG_ACISJ      DG-------SVH----------FHDLAHILFDQALLAEGGLPEDPAAYVKRVNALLA---
HTPG_VEREI      DG-------SQH----------FDDLAHILFDQALLAEGGLPADPAAYVKRVNALLV---
HTPG_RHOFT      DG-------SVH----------FNDLAHILFDQALLAEGGLPADPAAYVKRVNALLV---
HTPG_POLNA      EA-------SSELA-------SFDDLANILFDQALLAEGGMPTDPAAYVRRVNALLV---
HTPG_POLSJ      EA-------GEH----------FDDLAHILFDQALLAEGGMPEDPAAYVKRVNALLV---
HTPG_METPP      DG-------SER----------FDDLAQVLFDQAVLAEGGQLDDPAAYVQRVNRLLV---
HTPG_PSYCK      ES-------SEQSAE------DFDKLAQVIFDQALLADGGQLDDPAAYLRRVNELLMR--
HTPG_PSYA2      ES-------SEQSAE------DFDKLAQVIFDQALLADGGQLEDPAAYLRRVNELLMK--
HTPG_ACIAD      EG-------SAQ----------FDDLANVIFDQAVIAEGGLPEDPAAYVKRINSLLLK--
HTPG_ALKEH      DTGL--------DDA------RFSDWAAVLYDQALLTEGGQLEDPAAFVKRVNALLTEQA
HTPG_HALHL      ATE---------SGQ------RFEDWALTLYEQSLLAEGGQLEDPAAYVRRVNNLLAG--
HTPG_NITOC      KG--------EESEE------NFGDWAHLLFEQALLAEGGRLEEPALFVKRLNSLLLAMA
HTPG_MAGMM      AD--------EADEE------KFGELTHVLHDQALLAEGGQLKDPSQFVKRLNKLLMG--
HTPG_METCA      NT--------EADQT------RFQDLASLLLDQAVLAEGGQLDDPAEFVHKLNGLLQSLL
HTPG_COXBR      KN--------ESDKT------RFNRWADLLLNQALLAEGEQLKDPASFVKGLNELLLDS-
HTPG_COXBU      KN--------ESDKT------RFNRWADLLLNQALLAEGEQLKDPASFVKGLNELLLDS-
HTPG_COXBN      KN--------ESDKT------RFNRWADLLLNQALLAEGEQLKDPASFVKGLNELLLDS-
HTPG_HAEIN      AD--------IADET------EFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG---
HTPG_HAEIE      AD--------IADET------EFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG---
HTPG_HAEI8      AD--------IADET------EFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG---
HTPG_HAEIG      AD--------IADEI------EFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG---
HTPG_AGGAC      AE--------IADEA------QFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG---
HTPG_HAES1      AD--------LADED------EFANWIELLLEQAMLAERGSLENPTAFIKRVNSLLS---
HTPG_HISS2      AD--------FADED------EFANWIELLLEQAMLAERGSLENPTAFIKRVNNLLG---
HTPG_PASMU      AE--------IADEQ------QFADWIELLLEQAMLAERGSLENPVAFIKRMNTLLSKLT
HTPG_ACTSZ      AA--------LTDES------AFADWVELLLEQAMLSERGTLENPTAFIKRVNTLLAG--
HTPG_MANSM      AK--------VTDET------EFGDWIELLLNQAMLAERGSLENPVAFIKLVNALLAK--
HTPG_ACTP2      AD--------LTDET------KFNDWIELLFEQALLAERGSLENPAAFIKRMNKLLG---
HTPG_ECOLI      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECOL5      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECOHS      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECOL6      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_SHIBS      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_SHISS      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECO57      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECOLC      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECOUT      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECOK1      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_ECO24      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_SHIFL      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_SHIDS      AD--------TEDEA------KFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS--
HTPG_SALPB      AD--------TEDEA------QFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_SALPA      AD--------TEDEA------QFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_SALTY      AD--------TKDEA------QFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_SALCH      AD--------TKDEA------QFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_SALTI      AD--------TKDEA------QFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_CITK8      AD--------TQDEA------QFNEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_CROS8      AD--------TQDEA------QFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS--
HTPG_KLEP7      AD--------TQDDA------QFGEWVELLLDQALLAERGTLEDPNQFIRRMNQLLAS--
HTPG_ENT38      AD--------TQDEA------RFSEWVELLLDQSLLAERGTLEDPNQFIKRVNALLLG--
HTPG_PECAS      AD--------VSDEA------EFGEWVELLLDQALLAERGTLDDPNLFIRRMNQLLSA--
HTPG_YERPA      AE--------VTDDT------QFAQWVELLLDQALLAERGTLEDPNQFIRRMNQLLTA--
HTPG_YERPS      AE--------VTDDT------QFAQWVELLLDQALLAERGTLEDPNQFIRRMNQLLTA--
HTPG_YERPN      AE--------VTDDT------QFAQWVELLLDQALLAERGTLEDPNQFIRRMNQLLTA--
HTPG_YERPP      AE--------VTDDT------QFAQWVELLLDQALLAERGTLEDPNQFIRRMNQLLTA--
HTPG_YERPE      AE--------VTDDT------QFAQWVELLLDQALLAERGTLEDPNQFIRRMNQLLTA--
HTPG_YERE8      AD--------VADDT------QFAEWVELLLDQALLAERGTLEDPNQFIRRMNQLLTA--
HTPG_SERP5      SD--------VGDNE------QFAEWIDLLLDQALLAERGTLEDPNQFIRRMNKLLSA--
HTPG_PHOLL      AD--------ISDEV------QFADWIELLLDQALFAERGTLEDPNQFIRRMNQLLLSEK
HTPG_SODGM      AN--------LGDDG------AFGDWVELLLDQALLAERGTLDDPNQFIRRMNQLLNA--
HTPG_BAUCH      SN--------TDNDI------YFSEVIELLLDQALLVECGTLENPNQFVRRINKLLNHDT
HTPG_VIBCH      AD--------EADEQ------TFGRWAEVLLGQAMLAERGSMEDPSQFLGAVNQLLAPSH
HTPG_VIBC3      AD--------EADEQ------TFGRWAEVLLGQAMLAERGSMEDPSQFLGAVNQLLAPSH
HTPG_VIBPA      AD--------EADEE------AFGRWVEVLLGQAMLAERGSMEDPTQFLGAINKLLTKV-
HTPG_VIBCB      AD--------EADEE------VFGRWVEVLLGQAMLAERGSMEDPSQFVGAINKLLTKV-
HTPG_VIBVY      AD--------EADEE------AFGRWVEVLLGQAMLAERGSMEDPSQFLTAINSLLTKG-
HTPG_VIBVU      AD--------ETDEE------AFGRWVEVLLGQAMLAERGSMEDPSQFLTAINSLLTKG-
HTPG_ALIF1      AD--------EADEE------AFGRWVEMLLGQAMLAERGSLEDPSQFLSAMNQLLAK--
HTPG_PHOPR      AN--------EADEE------TFGRWVELLLGQAMLAERGSLEDPSQYVAAVNKLLTKV-
HTPG_AERHH      GA--------IEDEA------LFGEWVTLLHEQAQLAEQGGLNDPASFVSRINRLLLQA-
HTPG_AERS4      DT--------IEDEA------LFGEWVTLLHEQAQLAEQGGLNDPASFVSRINRLLLQA-
HTPG_PSEHT      ND--------EQDED------KFAQWSHVLLDQALLAERGTLKDPTGFVTRLNKLMLELS
HTPG_COLP3      AD--------EQDDD------MFNQWVEVLFEQAMLAERGSLKDPASFVSRLNKLMLSLT
HTPG_PSEA6      AD--------EQDEE------RFGQWTEVLFDQAALSEQGSLKDPAAFVHNLNTLLMNLA
HTPG_IDILO      LT--------KED-D------TFKEWAEVLLDQATLAERGNLKDPASFVTRLNKLMLNA-
HTPG_PSYIN      AD--------MADED------LFAQWSELLLEQAILSEKGSLDDPSEFVGRINKLLLA--
HTPG_SHEPA      ND--------EQDEQ------QFAQWSELLLQQALLSEKGSLADPSAFIKLMNQMLLASV
HTPG_SHEHH      ND--------EQDEQ------RFAQWSELLLQQALLSEKGSLADPSAFIKLMNQMLLASV
HTPG_SHESH      ND--------EQDEA------LFAQWSDLLLQQAQLSEKGSLADPSAFIKLMNEMLLAKL
HTPG_SHELP      DT--------EQDEE------VFGQWAELLLQQAQLSEKGSLADPSAFIKLMNKMLLASV
HTPG_SHEPC      ND--------LQDET------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANM
HTPG_SHESW      ND--------LQDET------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANM
HTPG_SHESM      ND--------LQDEA------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANL
HTPG_SHESR      ND--------LQDEA------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANL
HTPG_SHESA      ND--------LQDEA------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANL
HTPG_SHEON      ND--------LQDEA------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANL
HTPG_SHEB9      ND--------LQDEA------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANM
HTPG_SHEB8      ND--------LQDEA------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANM
HTPG_SHEB5      ND--------LQDET------AFADWSNLLLQQAQLSEKGSLADPSAFIKLMNQMLLANM
HTPG_SHEDO      ND--------EADEQ------LFADWASLLLQQAQLSEKGSLADPSAFIKLMNQMLLANA
HTPG_SHEFN      NN--------ETDEQ------LFADWANLLLQQALLSEKGSLADPSAFIKLTNQMLLASV
HTPG_SHEAM      DK--------EQDET------AFAEWAEMLLAQATLSERGSLADPSAFIKLVNQMLLKSV
HTPG_BUCAI      CT--------INNEN------ELHQWIKLLLDQALLAEKGNLENPHKFISRMNKLLIK--
HTPG_BUCAP      CK--------IKENE------KFDEWIKLLLDQALFAEKGNLENPHEFIARTNKLILEQ-
HTPG_BUCBP      NN--------EKNEK------KFKNWINFLFEQCLLAEKNTLDNPNKFIARINDLLINN-
HTPG_BUCCC      EK--------IKNEK------DFSNWIKIIFDQSILSEKGSLENPHKFIQRINNFFIS--
HTPG_WIGBR      FN--------IEDKN------IFNNWIELLFEESILSERGNLDDPNKFIHRINNLLLSNI
HTPG_LEGPH      HD--------IQDDN------QFELWVTMLFEQAVLAEGGQLDNPADFVNRVNRLLVSS-
HTPG_LEGPC      HD--------IQDDN------QFELWVTMLFEQAVLAEGGQLDNPADFVNRVNRLLVSS-
HTPG_LEGPL      HD--------IQDDN------QFELWVTMLFEQAVLAEGGQLDNPADFVNRVNRLLVSS-
HTPG_LEGPA      HD--------IQDDN------QFELWVTMLFEQAVLAEGGQLDNPADFVNRVNRLLVSS-
HTPG_PSEAE      DA--------EPDED------RFGELSHILFDQAALAAGDSLKDPGAYVRRLNKLLVELS
HTPG_PSEA7      DA--------EPDED------RFGELSHILFDQAALAAGDSLKDPGAYVRRLNKLLVELS
HTPG_PSEMY      DA--------EADED------RFVDLTHILFDQAALAAGDSLKDPAAYVQRLNKLLVELS
HTPG_PSEPF      DN--------EASED------RFSDLSHILFDQAALAAGDSLKDPAAYVSRLNKLLVELS
HTPG_PSEF5      DG--------EQSEE------RFGDLSHILFDQAALAAGDSLKDPAAYVRRLNKLLVELS
HTPG_PSEU2      DA--------EQSED------RFGDLSHILFDQAALAAGDSLKDPAAYVRRLNKLLVELS
HTPG_PSE14      DA--------EQSEE------RFGDLSHILFDQAALSAGDSLKDPAAYVRRLNKLLVELS
HTPG_PSESM      DA--------EQSEE------RFGDLSHILFDQAALAAGDSLKDPAAYVRRLNKLLVELS
HTPG_PSEPK      DH--------EQSED------RFAELSHILFDQAALAAGDSLKDPAAYVRRLNKLLVELS
HTPG_XANC5      DA--------EQDMD------RFGDLSRVLFDQAALAAGDSLKDPAAYVRRLNKLLLELS
HTPG_XANAC      DA--------EQDMD------RFGDLSRVLFDQAALAAGDSLKDPAAYVRRLNKLLLELS
HTPG_XANOM      DA--------EQDMD------RFCDLSQVLFDQAALAAGDSLKDPAGYVKRLNKLLLELS
HTPG_XANOR      DA--------EQDMD------RFCDLSQVLFDQAALAAGDSLKDPAGYVKRLNKLLLELS
HTPG_XANCP      DA--------EQDMD------RFGDLSRVLFDQAALAAGDSLKDPAGYVRRLNKLLLELS
HTPG_XANC8      DA--------EQDMD------RFGDLSRVLFDQAALAAGDSLKDPAGYVRRLNKLLLELS
HTPG_XYLFA      DA--------EQDMD------RFADLSHILFDQAALAAGDSLKDPANYVRRLNKLLLELS
HTPG_XYLFT      DA--------EQDMD------RFADLSRILFDQAALAAGDSLKDPANYVRRLNKLLLELS
HTPG_SACD2      DQ--------EQDED------RFKDLSHILFDQASLAEGGSLKDPAAYVSRLNKLLLELS
HTPG_MARHV      ET--------EQGEQ------RFKELSAVLFDQATLASGEQLKDPGAYVSRLNRLLLELA
HTPG_HAHCH      GE--------EQG-A------RFEDLTWVLFDQARLAGGENLKDPAGYVSRLNKLLLELS
HTPG_MARMS      DS--------ETDEE------RFADMAWLLFEQATLSEGGQLEDPATFVSRMNKLIVQLS
HTPG_CHRSD      E---------GADDS------VFNDLARILLDQAIIAEGGHLEDPATYVQRLNKLLSH--
HTPG_ALCBS      TR--------IEEDE------KFNDFAALLLDQAMLAEGQLPKDPAATARRMQALLSQSV
HTPG_RUTMC      KT--------KIDED------LVK----VLFDQAVLSEGVQLKDPAEFVKRINKLIN---
HTPG_VESOH      KT--------KIDED------LVK----VLFDQAVLSEGGQLKDPAEFVKRINKLIN---
HTPG_HYDCU      DS--------LEDEP------KVKEWSLFLLEQAQLAEGDQLEKPADFIKRMNALLSEVI
HTPG_FRAT1      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_FRATT      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_FRATW      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_FRATN      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_FRATF      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_FRATH      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_FRAP2      KN--------EADTE------IFADLSELLLLQAMFVEGAKIEDPMAFVKLVNKYIR---
HTPG_PELLD      SGMM-------MAN----DNNPLIRTAIHQLYEGALLLEGGLDSTTGFVSRMNELIEAAT
HTPG_CHLPM      SGMM-------IAN----ADNPLINSAIRQLYEGALLLEGDLSSTTGFVQRMNELIEAAT
HTPG_CHLCH      AGMI-------MAD----ANNPLIKTVARQLYEGALFLEGSLEDATSYVTRMNELIEAAT
HTPG_CHLPD      SGMI-------MAN----EHNPLIRTVIQQLYDGALLHEGNLDATTGFLQRMNELIEAAT
HTPG_CHLTE      AGKH-------AVGL---STDPVVRAAVTQLFESALLLEGDLESVADYVSRMNELVEAAT
HTPG_DESHY      NDLR-------KQE------DSFAPLAAEQLFANAQIAAGIIVDPRSMVSRLNEILEKAL
HTPG_DESPS      AELR-------KAD------AGFAGEVAHQILDNAMIQAGLVVDPLKMVARNYKILDRAV
HTPG_DESAG      LRLY-------RAD----ADDRLLAQATEQLYESALLLEGYLRDPHALVGRVNSLLEQAT
HTPG_DESVH      LKVF-------TSD----ASDPLVEDTTRQLFATSLMLDGYLKDPHELAAMMHRLMEKSG
HTPG_BACFR      LAD-------EEKECSAAIAPIQTELEDVTKRRDALKKKQEGKKDEDIPTVEKDELNDLD
HTPG_BACFN      LAD-------EEKECSAAIAPIQTELEDVTKRRDALKKKQEGKKDEDIPTAEKDELNDLD
HTPG_BACTN      LDE-------EEAACHPEVAPIQTEMNSVSKRRNELKDSQKDKKEEDIPTAEKDELNELD
HTPG_PORGI      LSG-------EKESVEPSLTELRAKIAELKAEEAKLLDEEKGKKPEEIPVATKEAKENNA
                                                                            

HTPG_BACSU      ------------------------------------------------------
HTPG_BACVZ      ------------------------------------------------------
HTPG_BACLD      ------------------------------------------------------
HTPG_BACHD      ------------------------------------------------------
HTPG_BACSK      ------------------------------------------------------
HTPG_OCEIH      ------------------------------------------------------
HTPG_CLOBH      ------------------------------------------------------
HTPG_CLOB1      ------------------------------------------------------
HTPG_CLOBL      ------------------------------------------------------
HTPG_ALKMQ      ------------------------------------------------------
HTPG_ALKOO      ------------------------------------------------------
HTPG_CLOP1      ------------------------------------------------------
HTPG_CLOPE      ------------------------------------------------------
HTPG_CLOPS      ------------------------------------------------------
HTPG_CLOAB      ------------------------------------------------------
HTPG_CLOTE      ------------------------------------------------------
HTPG_FUSNN      ------------------------------------------------------
HTPG_RHIME      KE----------------------------------------------------
HTPG_RHIEC      RSEG--------------------------------------------------
HTPG_NITWN      RRSSAGGGD---------------------------------------------
HTPG_NITHX      RGSTA-------------------------------------------------
HTPG_AZOC5      PTA---------------------------------------------------
HTPG_RHILO      AKG---------------------------------------------------
HTPG_RHOP2      VAHG--------------------------------------------------
HTPG_RHOPS      VAHG--------------------------------------------------
HTPG_RHOPA      VAHG--------------------------------------------------
HTPG_RHOP5      ------------------------------------------------------
HTPG_RHOPB      ------------------------------------------------------
HTPG_BRADU      GG----------------------------------------------------
HTPG_GLUOX      AE----------------------------------------------------
HTPG_MAGSA      LG----------------------------------------------------
HTPG_RHORT      I-----------------------------------------------------
HTPG_ROSDO      ------------------------------------------------------
HTPG_RICRS      L-----------------------------------------------------
HTPG_RICRO      L-----------------------------------------------------
HTPG_RICCN      L-----------------------------------------------------
HTPG_RICFE      L-----------------------------------------------------
HTPG_RICAH      L-----------------------------------------------------
HTPG_RICCK      LSL---------------------------------------------------
HTPG_RICBR      L-----------------------------------------------------
HTPG_RICB8      L-----------------------------------------------------
HTPG_RICTY      L-----------------------------------------------------
HTPG_RICPR      L-----------------------------------------------------
HTPG_ORITB      N-----------------------------------------------------
HTPG_EHRCJ      Q-----------------------------------------------------
HTPG_EHRCR      Q-----------------------------------------------------
HTPG_EHRRW      ------------------------------------------------------
HTPG_EHRRG      ------------------------------------------------------
HTPG_WOLPM      V-----------------------------------------------------
HTPG_WOLTR      I-----------------------------------------------------
HTPG_ANAPZ      SSK---------------------------------------------------
HTPG_ANAMM      KK----------------------------------------------------
HTPG_NEOSM      ------------------------------------------------------
HTPG_TREDE      ------------------------------------------------------
HTPG_TREPA      ------------------------------------------------------
HTPG_HELPH      ------------------------------------------------------
HTPG_HELPJ      ------------------------------------------------------
HTPG_HELPY      ------------------------------------------------------
HTPG_HELAH      ------------------------------------------------------
HTPG_HELHP      ------------------------------------------------------
HTPG_WOLSU      ------------------------------------------------------
HTPG_CAMJJ      S-----------------------------------------------------
HTPG_CAMJ8      S-----------------------------------------------------
HTPG_CAMJR      S-----------------------------------------------------
HTPG_CAMJE      S-----------------------------------------------------
HTPG_CAMJD      S-----------------------------------------------------
HTPG_CAMHC      ------------------------------------------------------
HTPG_SULNB      ------------------------------------------------------
HTPG_ARCB4      ------------------------------------------------------
HTPG_BORBP      L-----------------------------------------------------
HTPG_BORBU      L-----------------------------------------------------
HTPG_BORAP      L-----------------------------------------------------
HTPG_SULDN      ------------------------------------------------------
HTPG_MYCTA      ------------------------------------------------------
HTPG_MYCBO      ------------------------------------------------------
HTPG_MYCBP      ------------------------------------------------------
HTPG_MYCTU      ------------------------------------------------------
HTPG_MYCA1      ------------------------------------------------------
HTPG_MYCPA      ------------------------------------------------------
HTPG_MYCUA      ------------------------------------------------------
HTPG_MYCLE      ------------------------------------------------------
HTPG_MYCGI      GEQS--------------------------------------------------
HTPG_MYCVP      GDQT--------------------------------------------------
HTPG_RHOJR      ------------------------------------------------------
HTPG_NOCFA      ------------------------------------------------------
HTPG_SALTO      ------------------------------------------------------
HTPG_SALAI      ------------------------------------------------------
HTPG_FRACC      ------------------------------------------------------
HTPG_STRCO      ------------------------------------------------------
HTPG_GEOSL      KAAAGE------------------------------------------------
HTPG_GEOMG      KAAAGE------------------------------------------------
HTPG_GEOUR      EK----------------------------------------------------
HTPG_PELPD      TK----------------------------------------------------
HTPG_BDEBA      DSTKH-------------------------------------------------
HTPG_MYXXD      ALAAAPAPAQTPASATAS------------------------------------
HTPG_METFK      ------------------------------------------------------
HTPG_THIDA      G-----------------------------------------------------
HTPG_CHRVO      V-----------------------------------------------------
HTPG_DECAR      AK----------------------------------------------------
HTPG_AROAE      GSAGTD------------------------------------------------
HTPG_NITEC      LSGK--------------------------------------------------
HTPG_NITEU      LSGK--------------------------------------------------
HTPG_NITMU      SKE---------------------------------------------------
HTPG_BORBR      ------------------------------------------------------
HTPG_BORPA      ------------------------------------------------------
HTPG_BORPE      ------------------------------------------------------
HTPG_BORA1      ------------------------------------------------------
HTPG_BURPS      A-----------------------------------------------------
HTPG_BURMA      A-----------------------------------------------------
HTPG_BURM7      A-----------------------------------------------------
HTPG_BURP1      A-----------------------------------------------------
HTPG_BURM9      A-----------------------------------------------------
HTPG_BURMS      A-----------------------------------------------------
HTPG_BURP0      A-----------------------------------------------------
HTPG_BURP6      A-----------------------------------------------------
HTPG_BURTA      A-----------------------------------------------------
HTPG_BURCA      A-----------------------------------------------------
HTPG_BURCH      A-----------------------------------------------------
HTPG_BURCM      A-----------------------------------------------------
HTPG_BURL3      A-----------------------------------------------------
HTPG_PARXL      NEA---------------------------------------------------
HTPG_CUPNH      ------------------------------------------------------
HTPG_CUPPJ      ------------------------------------------------------
HTPG_CUPMC      ------------------------------------------------------
HTPG_RALSO      ------------------------------------------------------
HTPG_ACISJ      ------------------------------------------------------
HTPG_VEREI      ------------------------------------------------------
HTPG_RHOFT      ------------------------------------------------------
HTPG_POLNA      ------------------------------------------------------
HTPG_POLSJ      ------------------------------------------------------
HTPG_METPP      ------------------------------------------------------
HTPG_PSYCK      ------------------------------------------------------
HTPG_PSYA2      ------------------------------------------------------
HTPG_ACIAD      ------------------------------------------------------
HTPG_ALKEH      RAGEAKSNAARGD-----------------------------------------
HTPG_HALHL      ------------------------------------------------------
HTPG_NITOC      D-----------------------------------------------------
HTPG_MAGMM      ------------------------------------------------------
HTPG_METCA      ------------------------------------------------------
HTPG_COXBR      ------------------------------------------------------
HTPG_COXBU      ------------------------------------------------------
HTPG_COXBN      ------------------------------------------------------
HTPG_HAEIN      ------------------------------------------------------
HTPG_HAEIE      ------------------------------------------------------
HTPG_HAEI8      ------------------------------------------------------
HTPG_HAEIG      ------------------------------------------------------
HTPG_AGGAC      ------------------------------------------------------
HTPG_HAES1      ------------------------------------------------------
HTPG_HISS2      ------------------------------------------------------
HTPG_PASMU      SH----------------------------------------------------
HTPG_ACTSZ      ------------------------------------------------------
HTPG_MANSM      ------------------------------------------------------
HTPG_ACTP2      ------------------------------------------------------
HTPG_ECOLI      ------------------------------------------------------
HTPG_ECOL5      ------------------------------------------------------
HTPG_ECOHS      ------------------------------------------------------
HTPG_ECOL6      ------------------------------------------------------
HTPG_SHIBS      ------------------------------------------------------
HTPG_SHISS      ------------------------------------------------------
HTPG_ECO57      ------------------------------------------------------
HTPG_ECOLC      ------------------------------------------------------
HTPG_ECOUT      ------------------------------------------------------
HTPG_ECOK1      ------------------------------------------------------
HTPG_ECO24      ------------------------------------------------------
HTPG_SHIFL      ------------------------------------------------------
HTPG_SHIDS      ------------------------------------------------------
HTPG_SALPB      ------------------------------------------------------
HTPG_SALPA      ------------------------------------------------------
HTPG_SALTY      ------------------------------------------------------
HTPG_SALCH      ------------------------------------------------------
HTPG_SALTI      ------------------------------------------------------
HTPG_CITK8      ------------------------------------------------------
HTPG_CROS8      ------------------------------------------------------
HTPG_KLEP7      ------------------------------------------------------
HTPG_ENT38      ------------------------------------------------------
HTPG_PECAS      ------------------------------------------------------
HTPG_YERPA      ------------------------------------------------------
HTPG_YERPS      ------------------------------------------------------
HTPG_YERPN      ------------------------------------------------------
HTPG_YERPP      ------------------------------------------------------
HTPG_YERPE      ------------------------------------------------------
HTPG_YERE8      ------------------------------------------------------
HTPG_SERP5      ------------------------------------------------------
HTPG_PHOLL      A-----------------------------------------------------
HTPG_SODGM      ------------------------------------------------------
HTPG_BAUCH      IVN---------------------------------------------------
HTPG_VIBCH      ------------------------------------------------------
HTPG_VIBC3      ------------------------------------------------------
HTPG_VIBPA      ------------------------------------------------------
HTPG_VIBCB      ------------------------------------------------------
HTPG_VIBVY      ------------------------------------------------------
HTPG_VIBVU      ------------------------------------------------------
HTPG_ALIF1      ------------------------------------------------------
HTPG_PHOPR      ------------------------------------------------------
HTPG_AERHH      ------------------------------------------------------
HTPG_AERS4      ------------------------------------------------------
HTPG_PSEHT      K-----------------------------------------------------
HTPG_COLP3      K-----------------------------------------------------
HTPG_PSEA6      K-----------------------------------------------------
HTPG_IDILO      ------------------------------------------------------
HTPG_PSYIN      ------------------------------------------------------
HTPG_SHEPA      K-----------------------------------------------------
HTPG_SHEHH      K-----------------------------------------------------
HTPG_SHESH      K-----------------------------------------------------
HTPG_SHELP      K-----------------------------------------------------
HTPG_SHEPC      K-----------------------------------------------------
HTPG_SHESW      K-----------------------------------------------------
HTPG_SHESM      K-----------------------------------------------------
HTPG_SHESR      K-----------------------------------------------------
HTPG_SHESA      K-----------------------------------------------------
HTPG_SHEON      K-----------------------------------------------------
HTPG_SHEB9      K-----------------------------------------------------
HTPG_SHEB8      K-----------------------------------------------------
HTPG_SHEB5      K-----------------------------------------------------
HTPG_SHEDO      K-----------------------------------------------------
HTPG_SHEFN      K-----------------------------------------------------
HTPG_SHEAM      G-----------------------------------------------------
HTPG_BUCAI      ------------------------------------------------------
HTPG_BUCAP      ------------------------------------------------------
HTPG_BUCBP      ------------------------------------------------------
HTPG_BUCCC      ------------------------------------------------------
HTPG_WIGBR      IRLN--------------------------------------------------
HTPG_LEGPH      ------------------------------------------------------
HTPG_LEGPC      ------------------------------------------------------
HTPG_LEGPL      ------------------------------------------------------
HTPG_LEGPA      ------------------------------------------------------
HTPG_PSEAE      A-----------------------------------------------------
HTPG_PSEA7      A-----------------------------------------------------
HTPG_PSEMY      A-----------------------------------------------------
HTPG_PSEPF      A-----------------------------------------------------
HTPG_PSEF5      V-----------------------------------------------------
HTPG_PSEU2      V-----------------------------------------------------
HTPG_PSE14      V-----------------------------------------------------
HTPG_PSESM      V-----------------------------------------------------
HTPG_PSEPK      A-----------------------------------------------------
HTPG_XANC5      V-----------------------------------------------------
HTPG_XANAC      A-----------------------------------------------------
HTPG_XANOM      V-----------------------------------------------------
HTPG_XANOR      V-----------------------------------------------------
HTPG_XANCP      A-----------------------------------------------------
HTPG_XANC8      A-----------------------------------------------------
HTPG_XYLFA      A-----------------------------------------------------
HTPG_XYLFT      A-----------------------------------------------------
HTPG_SACD2      N-----------------------------------------------------
HTPG_MARHV      N-----------------------------------------------------
HTPG_HAHCH      NAG---------------------------------------------------
HTPG_MARMS      K-----------------------------------------------------
HTPG_CHRSD      ------------------------------------------------------
HTPG_ALCBS      ------------------------------------------------------
HTPG_RUTMC      ------------------------------------------------------
HTPG_VESOH      ------------------------------------------------------
HTPG_HYDCU      ------------------------------------------------------
HTPG_FRAT1      ------------------------------------------------------
HTPG_FRATT      ------------------------------------------------------
HTPG_FRATW      ------------------------------------------------------
HTPG_FRATN      ------------------------------------------------------
HTPG_FRATF      ------------------------------------------------------
HTPG_FRATH      ------------------------------------------------------
HTPG_FRAP2      ------------------------------------------------------
HTPG_PELLD      LSR---------------------------------------------------
HTPG_CHLPM      LSR---------------------------------------------------
HTPG_CHLCH      LTR---------------------------------------------------
HTPG_CHLPD      MSR---------------------------------------------------
HTPG_CHLTE      RS----------------------------------------------------
HTPG_DESHY      R-----------------------------------------------------
HTPG_DESPS      SRA---------------------------------------------------
HTPG_DESAG      GWYAEVRKL---------------------------------------------
HTPG_DESVH      DWYKAVRGL---------------------------------------------
HTPG_BACFR      KKWDELKQQKDSIFAGYAGKNKVVRQLIDLALLQNNMLKGEALNNFVKRSIELI
HTPG_BACFN      KKWDELKQQKDSIFAGYAGKNKVVRQLIDLALLQNNMLKGEALNNFVKRSIELI
HTPG_BACTN      KKWDELKNKKEGIFAGYASNNKVIRQLIDLALLQNNMLKGEALNNFVKRSIELI
HTPG_PORGI      VEQAKTEGSINDQLTKYAQDNELIGQLIDLALLGSGLLTGEALAEFIRRSQRLL