CLUSTAL format seed alignment for MF_00508

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS10_SULAC        ----------------------------MPTKARIRLWSSNIDSLNFVVNQIRNMAQKTG
RS10_SACS2        ----------------------------MPTKARIRLWSTNVENLNYVITQIRGIVEKTG
RS10_AERPE        ----------------------------MAFKLRIWLWSTNVRSLENVVEQIRNIANKTG
RS10_HALSA        -----------------------------MQQARVRLAGVDPDDLDNICGEVQEIADKTG
RS10_HALMA        ----------------------------MSQQARVRLAGTSPEDLDDICADVREIANKTG
RS10_ARCFU        -------------------------MPIKGPKARIKLSGLNPRELDRICSQIKEIANKTG
RS10_THEAC        ---------------------------MVSYKARISLSGTEHRVVDRVCNEIKEIASRTG
RS10_THEVO        ---------------------------MASYKARISLSGTEHKIVDMVCSEIKEIASRTG
RS10_METJA        -----------------------------MQRARIKLSSTDHKVLDEICRQIKEIAEKTG
RS10_METVS        -----------------------------MQKARIKLSSTKHEELDSVCNQIKAIAEKTG
RS10_PYRAB        -----------------------------MQKARIKLASTNVRSLEEVANQIKQIAERTG
RS10_PYRHO        -----------------------------MQKARIKLASTNVRSLEEVANQIRQIAERTG
RS10_PYRFU        -----------------------------MQKARIKIASTNVRSLDEVANQIKQIAERTG
RS10_METTH        -----------------------------MHKARIKLTGTDPEKLAYVCDQLKKIAERTG
RS10_NANEQ        -----------------------------MPFLRIKIYSTDLEELNRVVEKIKEIVKQTG
B2XTC7_HETAK      -------------------------MKLKVRKIRVKIHAFDVKTLNACCEKIIVAVKDTN
B2XTT3_HETA4      -------------------------MKLKVRKIRVKIHAFDVKTLNACCEKIIVAVKDTN
D1GJQ4_FUCVE      ---------------------------MSIEKIRIILESFNHVTLHNSCNIIINVLNSEK
RR10_TRICV        ------------------------MEIKTNAKIRVRLESFNHELLTSACRKISDTIQNSD
RR10_CYACA        --------------------MVRPLNDFHEAKVRIKLSSYSASLLNLSCNNVLQSIKESN
Q85FT6_CYAM1      ------------------------------MKIRLKFYSYSAQLVQSSLDQMAQIA--SQ
RS10_ARTPT        ------------------------MATIQQQKIRIRLKAFDRRLLDTSCEKIVDTANRTG
RS10_SYNY3        ------------------------MATLQQQKIRIRLKAFDRRLLDTSCDKIVDTANRTN
RR10_PORPU        ------------------------MTVTQQPKIRIKLKAYNSSLLNTSCKKIVDTAERTN
RR10_CYAPA        ------------------------MASNQQLKIRIQLRSYDSSLLENSCEQIIEAAKRTD
RR10_GUITH        ---------------------------MQKQKIRIRLKGYETNLLLDSCNKIIETATRTN
RS10_AQUAE        ---------------------------MEQEKIRIKLRAYDHRLLDQSVKQIIETVKRTG
RS10_AQUPY        ---------------------------MEQEKIRIKLKAFDHRVLDQSVKQIIETVKRTG
RS10_CAMJE        -----------------------------MERIRLKLKAYDHRVLDRTVAAIVEAVKRTG
RS10_HELPY        -----------------------------MEKIRLKLKAYDHRVLDRSVVAIVEAVKRSG
RS10_BACHD        ---------------------------MAKQKIRIRLKAYDHRVLDQSAEKIVETAKRSG
RS10_BACSU        ---------------------------MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSG
RS10_STRMU        ---------------------------MANKKIRIRLKAYEHRTLDTAAEKIVETATRTG
RS10_STRP1        ---------------------------MANKKIRIRLKAYEHRTLDTAAEKIVETATRTG
RS10_STRPN        ---------------------------MANKKIRIRLKAYEHRTLDTAAAKIVESATRTG
RS10_LACLA        ---------------------------MATKKIRIRLKAYEHRILDAAAEKIVETAKRTN
RS10_CLOAB        ---------------------------MAKQKIRIRLKAFDHTILDQSAEKIVETAKTTG
RS10_MYCLE        ---------------------------MAGQKIRIRLKAYDHEAIDASARKIVETVVRTG
RS10_MYCTU        ---------------------------MAGQKIRIRLKAYDHEAIDASARKIVETVVRTG
RS10_PLARO        ---------------------------MAGQKIRIRLKAYDHEVIDSSAKKIVETVTRTG
RS10_STRCO        ---------------------------MAGQKIRIRLKAYDHEVIDSSAKKIVETVTRTG
RS10_THEMA        ---------------------------MPGQKIRIKLKAYDHELLDESAKKIVEVAKSTN
RS10_MYCCT        ---------------------------MAENKMRIKLKGYDHAIVDQSITKIIQAAEGTG
RS10_DEIRA        ---------------------------MVAPKIRIKLRGFDHKALDQSASKIVDTVRRTG
RS10_THET8        -----------------------------MPKIRIKLRGFDHKTLDASAQKIVEAARRSG
RS10_BORBU        --------------------------MIAKDKIRVRLFSFDVKILDQSAESIVKAVQKAK
RS10_TREPA        ---------------------------MARERIRVKLCGFDVELVDQSSRAIVHAVQKAG
RS10_BRAPL        ---------------------------MKEQKIRVKLKAFDIELIDQSAQSIVASVKKTG
RS10_BRAHO        ---------------------------MKEQKIRVKLKAFDIELIDQSAQSIVASVKKTG
RS10_LEPIN        ---------------------------MAGQKIRVKLKAFDHRLIDQSTYEIVATAKRTG
RS10_ECOLI        ---------------------------MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTG
RS10_HAEIN        ---------------------------MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTG
RS10_BUCAI        ---------------------------MQNQRIRIRLKAFDHRLIDQSTTEIVETAKRTG
RS10_VIBCH        ---------------------------MQNQRIRIRLKAFDYKLIDASTAEIVETAKRTG
RS10_PSEAE        ---------------------------MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTG
RS10_XYLFA        ---------------------------MADQKIQIRLKAFDCRLIDRSAGEIVETAKRTG
RS10_NEIGO        ---------------------------MQTQKIRIRLKAYDYALIDRSAQEIVETAKRTG
RS10_NEIMA        ---------------------------MANQKIRIRLKAYDYALIDRSAQEIVETAKRTG
RS10_CAUVC        ---------------------------MDRQNIRIRLKAFDHRVLDHSTREIVNTAKRTG
RS10_RHILO        ---------------------------MNGQNIRIRLKAFDHRVLDASTKEIVSTAKRTG
RS10_RICPR        ----------------------------MKNKIKIRLKSFDHRSLDQATKEIVSAVKRTF
RS10_CHLPN        -------------------------MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTG
RS10_CHLTR        -------------------------MKQQKQRIRIRLKGFDQGQLDQSTANIVETAKRTG
RS10_MYCGE        ---------------------MNSA--VKYPELKIKLESYDSTLLDLTIKKIVEVVKGVN
RS10_MYCPN        ---------------------MNAANAVKYPELKIKLESYDSTLLDLTTKKIVEVVKGVD
RS10_MYCGA        --------MTEQKAKSSKTSSEEAKKQKELTEIKIKLKSYDSRLLDQSVKKIFEIVKETG
RS10_UREPA        ----------------------------MNQELRIRLESYDHRLLDDTVKTIVNISNSTG
RS10_MYCH2        ---------------------------MNTTSIKIKLKSFDHRQIDAAAKKIILLARELN
RS10_MYCPU        ---------------------------MKKEKLAMKFKSFDHKLVDDAVKKVLILASKEK
RS10_WOLPM        ----------------------------MKQDIYINIKAFDCSLLEECVRKFIDELKRSS
F7XYK9_TREPP      --------------------------------MRLVLKSFSPRAVQDAAARLARSIAAAC
C6UN08_HODCD      -----------------------------MLALKLRLRSYSWRALAVYSESLVLALRHSF
E0TJ47_ZINIC      -------------------------MLFSKNKYLLKIKSFNFKIIKKYIIELKKILKFNN
F8D3C3_HALXS      ----------------------------MTFVTRLTLQSGDRAALDGIVDDIKSTAERKG
D2RQ10_HALTV      ----------------------------MTFVTRLTLQSGDRAALDAIVDDIKSTAERKG
D3SZQ5_NATMM      -----------------------MNNTAMTFVTRLTLQSGDRAALDGIVNDIKSSAERKG
Q9HS28_HALSA      ----------------------------MTFVTKLSLESGDRTALDAVVSDIKETCRRKG
Q18GP6_HALWD      ----------------------------MTFITKLSFQSGDRYVLEKEVSNLKTLLEKKG
E4NMZ8_HALBP      ----------------------------MTFVTKLTFQSGNRYELEEQVSDLQEMLERKG
D4GXW0_HALVD      ----------------------------MAFVTKLTFQSGDKAVLDRVVDDLKQFVERKG
B9LNQ3_HALLT      ----------------------------MTFVTKLSFASGDHDVLAETVQDLKSTLERKG
G0HQ09_HALHT      ---------------MAFCHSRLSVRLQMPFVTTLTFSSGDRHRLEDIVTEIKESAEQKG
Q5V488_HALMA      MTPLLKRISETQRKQMAFCHSRLSVRLQMPFVTTLTFTSGDRHRLEDTVTEIKQSAEQKG
C7NUG5_HALUD      ---------------MAFSPSTADPEDEMPFAMTLTVESGDRYVLEDVVTEIKEAAEQKG
                                                    : . . .   :      .        

RS10_SULAC        IQVS-----------GPIPLPTTRMEVPVMRLPHGEGKKKWEHWEMKVHKRIIDIAA-DE
RS10_SACS2        IEMR-----------GPIPLPTSKLEVPIMRLPHGEGRKKWEKWEMRVHKRLIDIAA-DE
RS10_AERPE        IRMR-----------GPVPLPVKRLEVPVFRLPHGEGSKYWEHWEMKVHKRLIDLEA-DE
RS10_HALSA        VKVS-----------GPVPLPTKTLEVPSRKSPDGEGTATWEHWEMRVHKRLIDIDA-DE
RS10_HALMA        VELS-----------GPVPLPTKTLEVPSRKSPDGEGTATWEHWEMRVHKRLIDIDA-DE
RS10_ARCFU        VELS-----------GPVPLPTRRMVVPVRKAPDGEGSETWDHWEMRVHKRLIDISA-DE
RS10_THEAC        VEIH-----------GPMPLPTKRLVVPVRKSPDGEGTNTWDHWEMRIHKRLIDVDA-DE
RS10_THEVO        VEIH-----------GPMPLPTKKLVVPVRKSPDGEGTNTWDHWEMRIHKRLIDVDA-DE
RS10_METJA        VDIS-----------GPIPLPTKVLRVVTRKSPDGEGSSTFDRWTMKIHKRLIDIDA-DE
RS10_METVS        VDMA-----------GPIPLPTKSLKITTRKSTDGEGSSSFDRWTMRVHKRVIDIEA-DE
RS10_PYRAB        VRMS-----------GPIPLPTKRIRIVTRKSPDGEGSATFDRWELRIHKRLIDIEA-DE
RS10_PYRHO        VRMS-----------GPIPLPTKRIRIVTRKSPDGEGSATFDRWELRIHKRLIDIEA-DE
RS10_PYRFU        VRMS-----------GPIPLPTKRIRITTRKSPDGEGSATFDRWELRVHKRLIDIEA-DE
RS10_METTH        VDMS-----------GPIPLPTKRLVVPTRKSPDGEGTATWEKWEMRIHKRLVGIEA-DE
RS10_NANEQ        VKMR-----------GPIPLPTKILRVPVLRITGHRGTKIWDTYQMRIHRRIIDIAT-DD
B2XTC7_HETAK      DTRDQDNLPKQILLKGPIPLPTKRRIYCVLRSPHVDKD-SREHFEIKIHKKFLDIYTVED
B2XTT3_HETA4      DTRDQDNLPKQILLKGPIPLPTKRRIYCVLRSPHVDKD-SREHFEIKIHKKFLDIYTVED
D1GJQ4_FUCVE      LITD---------VSGPISFPTKKRSYCVLRSPHVNKD-SREQFEIRRYKKIIDIQSNSE
RR10_TRICV        ATKL-----------SVVSLPTDKRIYCVLRSPHVDKD-SREHFELRVHKRVIEIYY--D
RR10_CYACA        TSVK-----------GPVFLPTRRRVYCVLRSPHVNKD-SREHFEIRSHFRIIDIS--SC
Q85FT6_CYAM1      TAQV-----------SKVCLPTKRKIFCVLRSPHVNKD-SREHFEIRIHRRLLELK--NA
RS10_ARTPT        ATAL-----------GPIPLPTKRRIYCVLRSPHVDKD-SREHFETRTHRRIIDIY--QP
RS10_SYNY3        AAAV-----------GPIPLPTKRKIYCVLRSPHVDKD-SREHFETRTHRRIIDIY--QP
RR10_PORPU        AIAV-----------GPIPLPTKRRIYCVLRSPHVDKD-SREHFEIRSHRRIIDIH--QP
RR10_CYAPA        ATAV-----------GPIPLPTKKKIYCVLRSPHVDKD-SREHFEIRVHRRIIDLY--LP
RR10_GUITH        SVTA-----------GPIPLPTRRKIYCVLRSPHVNKD-SREHFETRIHKRVIDIY--EP
RS10_AQUAE        GVVK-----------GPIPLPTRKRKWCVLRSPHKFDQ-SREHFEIREFSRILDII--RF
RS10_AQUPY        GVVR-----------GPIPLPTRKRKWCVLRSPHKFDQ-SREHFEIRAFSRIIDIT--RF
RS10_CAMJE        ADIR-----------GPIPMPTKIKRYTVLKSPHINKD-SREQFEIRIHARMLDIV--AA
RS10_HELPY        SEIR-----------GPIPLPTKNKRYTVLRSPHVNKD-SREQFEIRVYSRLIDII--SA
RS10_BACHD        ANVS-----------GPIPLPTEKSVYTILRAVHKYKD-SREQFEMRTHKRLIDIV--NP
RS10_BACSU        ASVS-----------GPIPLPTEKSVYTILRAVHKYKD-SREQFEMRTHKRLIDIV--NP
RS10_STRMU        ASVA-----------GPVPLPTERSLYTVIRATHKYKD-SREQFEMRTHKRLIDIV--NP
RS10_STRP1        ATVA-----------GPVPLPTERSLYTIIRATHKYKD-SREQFEMRTHKRLVDII--NP
RS10_STRPN        AQVA-----------GPIPLPTERSLYTIIRATHKYKD-SREQFEMRTHKRLIDIV--NP
RS10_LACLA        AEVS-----------GPIPLPTDRSVYTVIRATHKYKD-SREQFEMRTHKRLIDII--EP
RS10_CLOAB        AKVA-----------GPVPLPTEKDVVTILRSPHKYKD-SREQFEIRTHKRLIDII--SP
RS10_MYCLE        ANVV-----------GPVPLPTEKNVYCVIRSPHKYKD-SREHFEMRTHKRLIDIL--DP
RS10_MYCTU        ASVV-----------GPVPLPTEKNVYCVIRSPHKYKD-SREHFEMRTHKRLIDII--DP
RS10_PLARO        AKVA-----------GPVPLPTEKNVYCVIRSPHNDKD-SREHFEMRTHKRLIDII--DP
RS10_STRCO        ASVA-----------GPVPLPTEKNVYCVIKSPHKYKD-SREHFEMRTHKRLIDIL--DP
RS10_THEMA        SKVS-----------GPIPLPTERTLYCVLRSPMKHKD-SREHFEKRVHKRLIDII--DP
RS10_MYCCT        AKVR-----------GPIPLPTEKQVITILRAVHKYKD-SREQFEMRTHKRLLEIL--NP
RS10_DEIRA        ADVS-----------GPVPLPTRIRRFTVLRSPFKYKD-SREHFEIRTHNRLVDIM--NP
RS10_THET8        AQVS-----------GPIPLPTRVRRFTVIRGPFKHKD-SREHFELRTHNRLVDII--NP
RS10_BORBU        AQIK-----------GPIPLPTKIKKYTVLRSPHVNKK-SREQFEMRTHKRLIDIL--EP
RS10_TREPA        AEVL-----------GPIPLPTRMHKFTVLRSPHVNKK-SREQFEMRTHKRLIDII--EP
RS10_BRAPL        ARVS-----------GPIPLPTSIRKVTVIRSPHVNIK-SREQFEMRVYKRLIDIF--DV
RS10_BRAHO        ARVS-----------GPIPLPTSIRKVTVIRSPHVNIK-SREQFEMRIYKRLIDIF--DV
RS10_LEPIN        ATVS-----------GPIPLPTKKEIYTVLRSPHVNKK-SREQFELKTHKRLIDIL--DT
RS10_ECOLI        AQVR-----------GPIPLPTRKERFTVLISPHVNKD-ARDQYEIRTHLRLVDIV--EP
RS10_HAEIN        AQVR-----------GPIPLPTRKERFTVLISPHVNKD-ARDQYEIRTHKRLVDIV--EP
RS10_BUCAI        AQVR-----------GPIPLPTRKERFTILVSPHVNKD-ARDQYEIRTHKRLIDIV--EP
RS10_VIBCH        AQVR-----------GPIPLPTRKERFTVLISPHVNKD-ARDQYEIRTHKRLIDIV--EP
RS10_PSEAE        AQVR-----------GPIPLPTRKERFTVLISPHVNKD-ARDQYEIRTHKRVLDIV--QP
RS10_XYLFA        AHVR-----------GPIPLPTKIERCTILVSPHADKD-ARDQYETCTYKRVLYIV--DP
RS10_NEIGO        AVVK-----------GPIPLPTKIERFNILRSPHMNKT-SREQLEIRTHLRLMDIV--DW
RS10_NEIMA        AVVK-----------GPIPLPTKIERFNILRSPHVNKT-SREQLEIRTHLRLMDIV--DW
RS10_CAUVC        ATVR-----------GPIPLPTLIEKFTVNRSPHVDKK-SREQFEIRTHKRVLDIV--DP
RS10_RHILO        ANVR-----------GPIPLPTRIEKFTVNRSPHVDKK-SREQFEMRTHKRLLDIV--DP
RS10_RICPR        ATIN-----------GPIPLPRKIERFTVNRSPHVHKK-SREQFEIRKHKRLLVID--DP
RS10_CHLPN        ARVV-----------GPIPLPTKREVYTVLRSPHVDKK-SREQFEIRTHKRLVDIL--DP
RS10_CHLTR        ARVV-----------GPIPLPTKREVYTVLRSPHVDKK-SREQFEIRTHKRLIDIL--DP
RS10_MYCGE        IKIK-----------GPLPLPTKKEVITIIRSPHVDKA-SREQFEKNTHKRLMILV--DV
RS10_MYCPN        VKIK-----------GPLPLPTKKEVITIIRSPHVDKA-SREQFEKNRHKRLMILV--DV
RS10_MYCGA        SKFC-----------GPIPLPTKKEVFTIIRSPHVDKA-SREQFERRTHKRLIIIK--NL
RS10_UREPA        SKLR-----------GPIPLPTKKEIFTILRSPHVNKS-SREQFERRTHKRLIILE--NP
RS10_MYCH2        IETR-----------GPVPLPTSRAIYTILRSVHINKK-SREQFESRTHKRLVILKVLPT
RS10_MYCPU        IDYS-----------GPIPLPTKREIFTILRSVHVNKK-SREQFERRTYKRFIVFN--NP
RS10_WOLPM        AKLS-----------GPIALPRKDSKFIVNRSPHVDKK-SREQFEMRTSRRLIVLH--DL
F7XYK9_TREPP      IGRVC-----------TVPLPMRRRRFDLLRSPHIDKR-AMDQMEVRTHKRLIHMPC---
C6UN08_HODCD      QLVVAG----------PTGLPTKLVKFTLNKSPHVNKK-SGDQLEIRTHAKLISVHA---
E0TJ47_ZINIC      IILIS-----------EVFLPTKIERFNLLRSPHIDKK-SRDQLEIRTHKRFLYILN---
F8D3C3_HALXS      AALK-----------GPHSHPPEKLSVPQHSRLHADDDRQFSSWTYTVFTRELEIHGHDN
D2RQ10_HALTV      AALK-----------GPHSHPPQKHSVPQHCRLHADDERRFSSWSYTVFTRELEIHGHDN
D3SZQ5_NATMM      AALK-----------GPHSHPPKKISVPQPCRLHTDDDRHFDSWEYTVFTRELEIHGHDN
Q9HS28_HALSA      ARLK-----------GPHSDAPAEIRVPLYARLGGDSAEKTNDWQYTVYRRRVELHGHDD
Q18GP6_HALWD      AECK-----------GPHADPPKEIVVPQYRQLAPGN--RFNSWQYTVYARHLEIHGNDH
E4NMZ8_HALBP      AECK-----------GPHASPPEQHTVPQYRNLEPGD--EFSSWNYTVYSRKLEIHGNDH
D4GXW0_HALVD      AECR-----------GPHSDQPKQVSVPQYRTLQPGD--QFSSWTYPVYTRRLEIHGADQ
B9LNQ3_HALLT      AECK-----------GPHATPAETVRVPLYKQLRAGD--EFSPWNYDVYKRSMEIHGADD
G0HQ09_HALHT      VELK-----------GPHPKQPQELRVPQSKSLGPSGG-RFESWTHTVYTRTIEIVGYEE
Q5V488_HALMA      VELK-----------GPHPKQPQELRIPQSKSLGPDGG-RFDSWTHTVYTRTIEIVGYEE
C7NUG5_HALUD      VQLK-----------GPHPQAPQELRVPQSADLSADGN-RLDPWHYTVFTRTIEIIGHDE
                                                           .        : : .     

RS10_SULAC        RVMRQLMR---VRVPDDVYIEIELI-------------------------------
RS10_SACS2        RVMRQLMR---VRVPEDVYIEIQLI-------------------------------
RS10_AERPE        RVLRHLMR---IKVPEDVYIEIKQMTG-----------------------------
RS10_HALSA        RALRQLMR---IQVPNDVNIEIVLED------------------------------
RS10_HALMA        RALRQLMR---IQVPNDVSIEIVLED------------------------------
RS10_ARCFU        RALRQIMR---IQVPRDVNIEIVLES------------------------------
RS10_THEAC        RTLRQLMR---IPIPDGVQIEIQIKS------------------------------
RS10_THEVO        RTLRQLMR---IPIPDGVQIEIQIKS------------------------------
RS10_METJA        RALRHIMK---IRIPDNVQIEIQFK-------------------------------
RS10_METVS        RTMKHIMK---VRIPDAVQIEIELRS------------------------------
RS10_PYRAB        RAMRQIMR---IRVPEDVTIEIELIS------------------------------
RS10_PYRHO        RAMRQIMR---IRVPEDVTIEIELIS------------------------------
RS10_PYRFU        RAMRQIMR---IRVPEDVTIEIELIS------------------------------
RS10_METTH        RAMRQVMK---VNVPDNVSIEIELKS------------------------------
RS10_NANEQ        RTIKLLMRTPLITKPEKIQIQLKYIKDKNL--------------------------
B2XTC7_HETAK      AASFL----NLLQMPTGAFFEILPVVTTMEANEITGPPIEQEGTLRYYDKQRRLRA
B2XTT3_HETA4      AASFL----NLLQMPTGAFFEILPVVTTMEANEITGPPIEQEGTLRYYDKQRRLRA
D1GJQ4_FUCVE      EIINT----LLLELSPGVSTKLFSYK------------------------------
RR10_TRICV        PTVKC----RIISKFRITVRSIISY-------------------------------
RR10_CYACA        SSETI-EMLMRLDLPTGVNIEIKT--------------------------------
Q85FT6_CYAM1      SAATI-DALMKVDLAYGVEVEIQQA-------------------------------
RS10_ARTPT        SSKTI-DALMKLDLPAGVDIEVKL--------------------------------
RS10_SYNY3        SSKTI-DALMKLDLPAGVDIEVKL--------------------------------
RR10_PORPU        SSQTI-DALMKLNLPSGVDIEVKL--------------------------------
RR10_CYAPA        SSKTI-DTLTRLDLPAGVDVEVKL--------------------------------
RR10_GUITH        NSTTI-DSLMKLDLPAGIDIDIKI--------------------------------
RS10_AQUAE        TPQTI-EALMEISLPAGVDVEVKMRG------------------------------
RS10_AQUPY        TPQTI-EALMEINLPAGVDVEVKMRG------------------------------
RS10_CAMJE        TPDTV-DSLTKLDLAPEVSVEVRAMGK-----------------------------
RS10_HELPY        TPETV-DSLMKLDLAPEVDVEVTSMETK----------------------------
RS10_BACHD        TPQTV-DALMRLDLPSGVDIEIKL--------------------------------
RS10_BACSU        TPQTV-DALMRLDLPSGVDIEIKL--------------------------------
RS10_STRMU        TQKTV-DALMKLDLPSGVNVEIKL--------------------------------
RS10_STRP1        TQKTV-DALMKLDLPSGVNVEIKL--------------------------------
RS10_STRPN        TQKTV-DALMKLDLPSGVNVEIKL--------------------------------
RS10_LACLA        TQKTV-DSLMKLDLPSGVNIEIKL--------------------------------
RS10_CLOAB        SPKTV-DALMRLDLPAGVDIEIKL--------------------------------
RS10_MYCLE        TPKTV-DALMRIDLPASVDVNIQ---------------------------------
RS10_MYCTU        TPKTV-DALMRIDLPASVDVNIQ---------------------------------
RS10_PLARO        TPKTV-DSLMRLDLPAGVDISIKL--------------------------------
RS10_STRCO        TPKTV-DSLMRLDLPAGVDIEIKL--------------------------------
RS10_THEMA        SPKTI-DALMRINLPAGVDVEIKL--------------------------------
RS10_MYCCT        TAATM-DVLKRVQLPSGVDIEIKL--------------------------------
RS10_DEIRA        TKKTI-DSLMTLDLPTGVDIEIKTVGGRA---------------------------
RS10_THET8        NRKTI-EQLMTLDLPTGVEIEIKTVGGGR---------------------------
RS10_BORBU        TSALM-DSLMKLELPAGVEVDIKQ--------------------------------
RS10_TREPA        SQEVM-NALMGLELSAGVDVRIKQ--------------------------------
RS10_BRAPL        TPQTT-ESLKKLALPAGVDVQLK---------------------------------
RS10_BRAHO        TPQTT-ESLKKLALPAGVDVQLK---------------------------------
RS10_LEPIN        NEDTV-EALMKLQLPAGVSVDIKS--------------------------------
RS10_ECOLI        TEKTV-DALMRLDLAAGVDVQISLG-------------------------------
RS10_HAEIN        TEKTV-DALMRLDLAAGVDVQISLG-------------------------------
RS10_BUCAI        TEKTV-DALMRLDLAAGVDVQISLG-------------------------------
RS10_VIBCH        TDKTV-DALMRLDLAAGVDVQISLG-------------------------------
RS10_PSEAE        TDKTV-DALMKLDLAAGVEVQISLG-------------------------------
RS10_XYLFA        NDKTV-DALMKLELAAGVDVQIKLT-------------------------------
RS10_NEIGO        TDKTT-DALMKLDLPAGVDVEIKVQ-------------------------------
RS10_NEIMA        TDKTT-DALMKLDLPAGVDVEIKVQ-------------------------------
RS10_CAUVC        TPQTV-DALMKLDLSAGVDVEIKL--------------------------------
RS10_RHILO        TPQTV-DALMKLDLAAGVDVEIKL--------------------------------
RS10_RICPR        NPAVV-DALSKVDLAAGVDVVIELESGE----------------------------
RS10_CHLPN        TGKTI-DALKMLALPAGVDIKIKAA-------------------------------
RS10_CHLTR        TGKTI-DALKMLSLPAGVDIKIKAA-------------------------------
RS10_MYCGE        NQGGI-DSLKKIKIPVGVTLRFSK--------------------------------
RS10_MYCPN        NQGAI-DSLKRIKIPVGVTLRFSK--------------------------------
RS10_MYCGA        KNETI-QKLKRFVIPSGVELRIYL--------------------------------
RS10_UREPA        QPKTM-EALKRLSVPFGVEVTFKI--------------------------------
RS10_MYCH2        NQKLVTEKISRSQLPAGVWIEIEVS-------------------------------
RS10_MYCPU        GPKFV-EILKRTEMPAGVEVEFKVK-------------------------------
RS10_WOLPM        TPTMM-QMLTGLSFSAGVEVDLKVKEVKEVKV------------------------
F7XYK9_TREPP      PTARTAEELMSAEVPAGV--AIRVMP------------------------------
C6UN08_HODCD      RDAAGVLKSVCDSVPEGVFADVWLAPSTRWRASAWC--------------------
E0TJ47_ZINIC      NKKINILNIIKNLNLNFTGLEIKLKLI-----------------------------
F8D3C3_HALXS      LARNIAEQNFPDSVHIEAEVEQIRGTGRGN--------------------------
D2RQ10_HALTV      LARNIASQNFPDSVHIEAEVEQIRGAGQSN--------------------------
D3SZQ5_NATMM      LARNIASQNFPDSVHIEAEVEQIHGAGRGN--------------------------
Q9HS28_HALSA      LARDIMERDFPASVHVEAEVERIEPLGSSV--------------------------
Q18GP6_HALWD      IAREVGHMDFPDSIHVEIELEQRKPAGHKQS-------------------------
E4NMZ8_HALBP      IAREVGHMEFPESLHVEIEVEQKKPLGHRNK-------------------------
D4GXW0_HALVD      IAREVGLREFPDGVHLEIEVEQKKPLGHRR--------------------------
B9LNQ3_HALLT      IAREVVGRDFPDSIHVEVEVDQKKPLGHRRD-------------------------
G0HQ09_HALHT      FARNVTQRTFPNAIHVEAGVEQRTQVGSGS--------------------------
Q5V488_HALMA      FARDVTQRTFPNAIHVEAGVEQRTQVGSGS--------------------------
C7NUG5_HALUD      FARDVTEWDFPERVHIGVSVEQRRGAGR----------------------------