CLUSTAL format seed alignment for MF_00514

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL35_SYNY3      --MPKLKTRKAAAKRFRPTGSGKKIIRRKAFKNHLLEHKSSEQKHRRLSNLALVHEADEK
RK35_CYAPA      --MYKLKTRKAAAKRYKAVGN-KKISRRKAFRSHLLQKKSTN-RKRQLSQVVIASPGDTK
RK35_TRICV      --MPKLKTRKAALKRYKKTAT-GKFLRRHAYKGHLLMKKSKT-QKRKLSQIICVSNNDSK
RK35_PORPU      --MPKLKTSKAIAKRFKVSSS-GKILRHKASKSHLLQKKSSK-HRRHLSSTCQVDSRDAK
RL35_BACSU      --MPKMKTHRGSAKRFKKTGS-GKLKRSHAYTSHLFANKSQK-QKRKLRKSAVVSAGDFK
RL35_LISMO      --MPKMKTHRGSAKRFKRTGS-GKLKRRHGFTSHMFANKSQK-QKRKLRKSAMVSAGDFK
RL35_BACHD      --MPKMKTHKGAAKRFKKTGS-GKLKRSHAFTSHLFANKSQK-QKRKLRKSAIVHSGDFK
RL35_GEOSE      --MPKMKTHRGSAKRFKKTAS-GKLKRGHAYTSHLFANKTKK-QKRHLRKATLVSPGDFK
RL35_STRPN      --MPKQKTHRASAKRFKRTGS-GGLKRFRAYTSHRFHGKTKK-QRRHLRKASMVHSGDYK
RL35_STRP1      --MPKQKTHRASAKRFKRTGS-GGLKRFRAFTSHRFHGKTKK-QRRHLRKAGLVSSGDFK
RL35_LACLA      --MPKQKTHRASAKRFKRTGN-GGLKRFRAYTSHRFHGKTVK-QRRQLRKSSMVSKGDFK
RL35_MYCFE      --MPKMKTKSALKKRIKITGT-GKIMREQAYRSHLSQNKTTK-QKRQARKSVQMHSSDVK
RL35_MYCPU      --MPKMKSKSALKKRIKITGT-GKIKRHQAFRSHLAQNKTTK-QKRQSRNAELMHKSDYK
RL35_MYCGE      -----MKTKSAAVKRFKLTKS-GQIKRKHAYTSHLAPHKSTK-QKRHLRKQATVSNSELK
RL35_MYCPN      -----MKVKSAAKKRFKLTKS-GQIKRKHAYTSHLAPHKTTK-QKRHLRKQGTVSASDFK
RL35_UREPA      MAKIRQKTKRAVAKRFSITKN-GKLKRKHAYRSHLALGRSTK-AKRHLRKDAIMSTSDTK
RL35_THEMA      --MPKVKTNRSAAKRFRITKN-GKIMRNHAYRSHKTGKKRRN-ALRALRKKDVVSSADKN
RL35_RHILO      --MPKMKTKSAAKKRFKITGT-GKVLSAAAGKRHGMIKRSNK-FIRNARGTMVLAEPDGK
RL35_RICPR      --MPKLKTKSAVKKRFKFTAT-GKVIASQAGKKHFMRRRTKA-QIRNLRGTTILCPQDGH
RL35_CAUVC      --MPKLKTKSGAKKRFKLTAT-GKLKAGVAGKRHRLIGHNGK-YIRQNRGTKVMSEADA-
RL35_DEIRA      --MPKMKTHKMAKRRIKITGT-GKVMAFKSGKRHQNTGKSGD-EIRGKGKGFVLAKAEW-
RL35_THET8      --MPKMKTHKGAKKRVKITAS-GKVVAMKTGKRHLNWQKSGK-EIRQKGRKFVLAKPEA-
RL35_MYCLE      --MPKAKTHSGASKRFRRTGT-GKIVRQKANRRHLFEHKPST-RTRRLDGHTRVSANDTQ
RL35_MYCTU      --MPKAKTHSGASKRFRRTGT-GKIVRQKANRRHLLEHKPST-RTRRLDGRTVVAANDTK
RL35_STRCO      --MPKNKSHSGASKRFKITGS-GKVLRERAGKRHLLEHKSSR-VTRRLTGNAEMAPGDAA
RL35_CAMJE      --MPKMKSVKSAVKRFKVG-K-NKIKRGSAFRSHILTKKPAK-RMRGLRTAKYVHSTNVK
RL35_HELPY      --MPKMKTNRGASKRFKVK-K-NLIKRGSAFKSHILTKKSPK-RKANLNAPKHVHHTNAH
RL35_AQUAE      MAKVKMKTNRSAAKRFKVTAK-GKIKRWKSGGAHYNTKKSSK-RKRHLRKHTYVKDNMLK
RL35_BORBU      -MANKMKTRKSAKKRYSFTVN-GKVKYKKQNLRHILTKKSSK-RKRNLRKSGNLSCFEVK
RL35_TREPA      --MAKMKTKSAAAKRFSVTGA-GKVKFKKMNLRHILTKKAPK-RKRKLRHAGFLSKVELK
RL35_CLOAB      --MPKMKTKKAAAKRFKATGT-GKLKRGKAFRSHILTKKSTK-TKRNLRKGGYVSETQEK
RL35_BUCAI      --MPKIKTLKSAAKRFKITAS-GKFKRKQANLRHILTKKTTT-KKRHLRPKILVSTGDMD
RL35_BUCAP      --MPKIKTLRSAAKRFKKTAS-GKFKRKQANLRHILTKKTTT-KKRHLRPKILVSKGDIS
RL35_ECOLI      --MPKIKTVRGAAKRFKKTGK-GGFKHKHANLRHILTKKATK-RKRHLRPKAMVSKGDLG
RL35_HAEIN      --MPKIKTVRGAAKRFKKTAS-GGFKRKQSHLRHILTKKTTK-RKRHLRHKSMVAKADQV
RL35_XYLFA      --MPKIKTNRAAAKRFRKTAS-GKYKAGHANRSHILTKKATK-RKRNLRQQNHVRAEDAG
RL35_PSEAE      --MPKMKTKSGAAKRFKKTA--GGLKHKHAFKSHILTKMTTK-RKRQLRGTSMLNKSDVA
RL35_PSESM      --MPKMKTKSGAAKRFLKTA--NGIKHKHAFKSHILTKMSTK-RKRQLRGSSLLHPSDVA
RL35_VIBCH      --MPKMKNNKGAAKRFKKTA--GGIKYKHATKRHILTKRTTK-NKRQLRPNAILPKCELA
RL35_VIBME      --MPKMKTNKGAAKRFKKTA--GGIKYKHATKRHILTKRTTK-NKRQLRPNSILPKCEVA
RL35_NEIMA      --MPKMKTKSSAKKRFKVLGN-GGVKRAHAFKRHILTKKTTK-NKRQLRGTSMVNDRDLA
RL35_CHLPN      --MPKMKTNKSVSARFKLTAS-GQLKRTRPGKRHKLSKKSSQ-EKRNLSKQPLVDKGQVG
RL35_CHLTR      --MPKMKSNKSVAARFKLTGS-GQLKRTRPGKRHKLSKRSSQ-QKRNLSKQPLVDQGQVG
RK35_GUITH      --MPKLKTRKSARKRFYISAK-GKFVRKRAFKSHILEKKTSK-RKRNLKRKMIVFKGENL
RK35_CYACA      --MNIRKNSKSVSKRFKVTSN-KLILYKPASKSHLQEKKTVS-RKKRLCRVKRIKVVDSK
                      *       *                  *                          

RL35_SYNY3      NVRLMLPYM--
RK35_CYAPA      KIYLMLPYL--
RK35_TRICV      PIKLMLPY---
RK35_PORPU      NISINLPYL--
RL35_BACSU      RIKQMLANIK-
RL35_LISMO      RIRQMVAKMK-
RL35_BACHD      RIREMLTYKK-
RL35_GEOSE      RIRQMLDNLK-
RL35_STRPN      RIKAMLTRLK-
RL35_STRP1      RIKAMVTGL--
RL35_LACLA      RIRRMVATMR-
RL35_MYCFE      RFKALI-----
RL35_MYCPU      RFKALIQK---
RL35_MYCGE      RIGILI-----
RL35_MYCPN      RIGNLI-----
RL35_UREPA      RYTQCL-----
RL35_THEMA      RVLRLLGKK--
RL35_RHILO      KVIKNFLPNGL
RL35_RICPR      NIKKYFLPYGI
RL35_CAUVC      KIIRTYLPYGL
RL35_DEIRA      ARMKLMLPRGK
RL35_THET8      ERIKLLLPYE-
RL35_MYCLE      RVNSLLNG---
RL35_MYCTU      RVTSLLNG---
RL35_STRCO      KIKKLLGK---
RL35_CAMJE      AVEKMLGI---
RL35_HELPY      SVMSLLCRA--
RL35_AQUAE      HVKALLKEF--
RL35_BORBU      RIK-TLLPYG-
RL35_TREPA      VVKRKLLPYA-
RL35_CLOAB      TMK-TLLPYL-
RL35_BUCAI      RVKSFLPYA--
RL35_BUCAP      KVKSFLPYF--
RL35_ECOLI      LVIACLPYA--
RL35_HAEIN      LVVACLPYA--
RL35_XYLFA      RLDRMLPYL--
RL35_PSEAE      RVERSLRLR--
RL35_PSESM      KVERMLRLR--
RL35_VIBCH      AVARMLPYA--
RL35_VIBME      GVMRMLPYA--
RL35_NEIMA      SVAKMLPYA--
RL35_CHLPN      MYKRMMLV---
RL35_CHLTR      MYKRMMLV---
RK35_GUITH      ALKTMLPYLR-
RK35_CYACA      SIKLRYMF---