CLUSTAL format seed alignment for MF_00519

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARAA_MYCSM       ---------MAEHFTDEEIWFVTGSQSLYGQEILDQVAEQSRALAERLDASADLPVAVRW
ARAA_MYCS2       ---------MAEHFTDEEIWFVTGSQSLYGQEILDQVAEQSRALAERLDASADLPVAVRW
ARAA_NOCSJ       ---------MTHHPDELEIWFLTGSQHLYGPEVIDQVAEHAARIVAALDASPHLPVRVVS
ARAA_PAEAT       MPSATSNPANNTSLEQYEVWFLTGSQHLYGEDVLKQVAAQSQEIANALNANSNVPVKLVW
ARAA_ARTS2       MSNPNYTSANGTSLSQYEVWFLTGSQHLYGEDVLKQVAAQSQEIADALNGSSDVPVKVVW
ARAA_CLAM3       ------MSRITTSLDHYEVWFLTGSQNLYGEETLQQVAEQSQEIARQLEEASDIPVRVVW
ARAA_ACIC1       --------MTDLPYPEYECWFLTGSQHLYGEDVLSAVARQSQAIVEALNAAG-LPVRLVW
ARAA_GEOSE       ----------MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSMMIVNELNQDSVFPFPLVF
ARAA_GEOKA       ----------MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVF
ARAA_GEOTN       ----------MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSRTIVNELNRDSVFPFPLVF
ARAA1_BACLD      ----------MIQAKTHVFWFVTGSQHLYGEEAVQEVEEHSKMICNGLN-DGDLRFQVEY
ARAA_BACSU       ----------MLQTKDYEFWFVTGSQHLYGEETLELVDQHAKSICEGLS-GISSRYKITH
ARAA_BACHD       ----------MLQTKPYTFWFITGSQHLYGEDAIEQVRQHSQTMVEKLNKIGELPYTIEL
ARAA_BACSK       ----------MHKQGKYQFWFITGSQPLYGQEALDEVAAHSKAMVERLK--EKLPEELVL
ARAA2_BACLD      ----------MLTTGKKEFWFVVGSQHLYGEETLAEVRAHAQAMTDALNESAVLPYPLVL
ARAA_OCEIH       ----------MLTLKEKEFWFVVGSQQLYGEEALQEVKAQAQTVTDALNESGALPYPIVL
ARAA1_CLOAB      ----------MLKNKKLEFWFVVGSQNLYGEEALNAVKKDSKEIVDSLNESGKLPYPIVF
ARAA2_CLOAB      ----------MLENKKMEFWFVVGSQHLYGEEALKEVRKNSETIVDELNKSANLPYKIIF
ARAA_LACBA       ----------MLSVPDYEFWFVTGSQHLYGEEQLKSVAKDAQDIADKLNASGKLPYKVVF
ARAA_LACPL       ----------MLSVPDYEFWFVTGSQHLYGEEQLKSVAKDAQDIADKLNASGKLPYKVVF
ARAA_LACSS       ----------MLNTENYEFWFVTGSQSLYGEETLRSVEKDAKEIVEKLNASHQLPYPIVF
ARAA_PEDPA       ----------MKKVQDYEFWFVTGSQFLYGEETLRSVEKDAKEIVDKLNESKKLPYPVKF
ARAA_LEUMM       ----------MADIKDYKFWFVTGSQFLYGPEVLKQVEEDSKKIIEKLNESGNLPYPIEF
ARAA_ECO57       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVKALNTEAKLPCKLVL
ARAA_SHIDS       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_ECOLI       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SHIBS       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SHISS       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_ECOK1       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_ECOUT       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_ECOL5       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_ECOL6       ----------MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SHIFL       ----------MAIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPYKLVL
ARAA_SHIF8       ----------MAIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SALPA       ----------MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SALTI       ----------MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SALCH       ----------MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_SALTY       ----------MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLPCKLVL
ARAA_YERPN       ----------MDVFKQSEVWFVIGSQNLYGPKTLQQVMDNAHQVVNSLNNEAGLPVKLVL
ARAA_YERPP       ----------MDVFKQSEVWFVIGSQNLYGPKTLQQVMDNAHQVVNSLNNEAGLPVKLVL
ARAA_YERPE       ----------MDVFKQSEVWFVIGSQNLYGPKTLQQVMDNAHQVVNSLNNEAGLPVKLVL
ARAA_YERPA       ----------MDVFKQSEVWFVIGSQNLYGPKTLQQVMDNAHQVVNSLNNEAGLPVKLVL
ARAA_YERPS       ----------MDVFKQSEVWFVIGSQNLYGPKTLQQVMDNAHQVVNSLNSEAGLPVKLVL
ARAA_YERE8       ----------MDVFKQSEVWFVIGSQNLYGPKTLQQVMDNAHHVVNSLNSEAGLPVKLVL
ARAA_PECAS       ----------MDHFKQLEVWFVIGSQHLYGPETLRQVKENAEKVVAGLNQQANLPVKLVL
ARAA_AERHH       ----------MELMKQLEVWFLVGSQHLYGAATLKQVADHAHTITSQLNERAGLPVKIVL
ARAA_AERS4       ----------MEFMKQLEVWFLVGSQHLYSATTLKQVADHAHTMTSQLNEGAGLPIKIVL
ARAA_MANSM       ----------MEFLKKLEVWFVVGSQDLYGDEALKQVNANAEQITRYLNDQ-NPFIQIKL
ARAA_SHESA       ----------MKAFKQKQVWFITGSQDLYGPKVLEQVAKNSEQIVHGFNESSAISIEVVY
ARAA_SHESR       ----------MKAFKQKQVWFITGSQDLYGPKVLEQVAKNSEQIVHGFNESSAISIEVVY
ARAA_SHESM       ----------MKAFKQKQVWFITGSQDLYGPKVLEQVAKNSEQIVYGFNESSAISIEVVY
ARAA_SHESW       ----------MKAFKQKQVWFVTGSQDLYGPKVLEQVAKNSEQIVNGFNQSDAISMEVVY
ARAA_SACD2       ----------MKIYGEKKIWFVTGSQHLYGPGVLAQVAENSQAIAAGLTASEHVSANIES
ARAA_VIBPA       ----------MKIFNDKQVWFVTGSQHLYGPQVLESVAQNSEEIIAGLNSSDDISVSIAN
ARAA_GRAFK       ----------MTNFENKEVWFITGSQHLYGEETLRQVANNSKEIVEGLNGSDNVPVKLIH
ARAA_KORVE       ----------MIDLKKFEVWFVTGSQHLYGPETLEKVAEHSREIAGGLDATPQMPVRVVF
ARAA_THEMA       ----------MIDLKQYEFWFLVGSQYLYGLETLKKVEQQASKIVDSLNDDPIFPSKIVL
ARAA_BACTN       ---------MNNVFDQYEVWFVTGAQLLYGGDAVIAVDAHSNEMVNGLNESGKLPVKVVY
ARAA_BACV8       ---------MEKAFDQYEVWFVTGAQLLYGGDAVIAVDAHSNEMVNGLNESGKLPVKVVY
ARAA_BIFAA       -------MAMENPFEGKEIWFGVGSQDLYGEEALRQVAQQTGEMVDFLNATGKIPAKIVL
ARAA_BIFLO       -------MVMENPFEGKEIWFGVGSQDLYGEEALRQVAIHSAEMVDYLNNTGKIPAKIVL
                                    **  *:* **.   :  *  .:  :             .  

ARAA_MYCSM       KPVVTTSEAILDVLRDASSSPQCVGVITWMHTFSPAKMWIRGLSALQKPMLHLHTQFGVE
ARAA_MYCS2       KPVVTTSEAILDVLRDASSSPQCVGVITWMHTFSPAKMWIRGLSALQKPMLHLHTQFGVE
ARAA_NOCSJ       KPVLTETDSIRRALLDATATDSCVGVIAWMHTFSPAKMWITGLDALRKPLLHLHTQANQA
ARAA_PAEAT       KPVLTDSDAIRRTALEANADDSVIGVTAWMHTFSPAKMWIQGLDALRKPLLHLHTQANRD
ARAA_ARTS2       KPVLTDSDAIRRTALEANADDSVIGVTAWMHTFSPAKMWIQGLDLLRKPLLHLHTQANVE
ARAA_CLAM3       KPVLKDSDSIRRMALEANASDGTIGLIAWMHTFSPAKMWIQGLDALQKPFLHLHTQANVA
ARAA_ACIC1       KPVLTDATGIRRMCSEASATDACIGVIAWMHTFSPAKAWINGLLALRKPLLHLHTQANLT
ARAA_GEOSE       KSVVTTPEEIRRVCLEANASEQCAGVITWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRD
ARAA_GEOKA       KSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRD
ARAA_GEOTN       KPIVTTPEEIRNICLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRD
ARAA1_BACLD      KAVATSLDGVRKLFEEANRDEECAGIITWMHTFSPAKMWIPGLSELNKPLLHFHTQFNRD
ARAA_BACSU       KPVVTSPETIRELLREAEYSETCAGIITWMHTFSPAKMWIEGLSSYQKPLMHLHTQYNRD
ARAA_BACHD       KEVLTTPDAIRKMVIAANSDDDCAGMITWMHTFSPAKMWINGLKQLKKPLLHLHTQFNRE
ARAA_BACSK       KPVASSPERILELFRAANGDNNCAGIITWMHTFSPAKMWIAGLNELNKPMLHFHTQYNRD
ARAA2_BACLD      QDLAVNADKITSIMKEVNYRDEVAGVITWMHTFSPAKMWIRGTKLLQKPLLHLATQFNES
ARAA_OCEIH       KDLAINADQITNVMKEVNYRDEVAGVITWMHTFSPAKMWIRGTKLLQKPLLHLATQFNES
ARAA1_CLOAB      KTLATSADEIKNIVKEINYRDEVAGVITWMHTFSPAKMWIAGTKLLQKPLLHLATQFNEN
ARAA2_CLOAB      KDLATSADKIKEIMKEVNYRDEVAGVITWMHTFSPAKMWIAGTKILQKPLLHFATQYNEN
ARAA_LACBA       KDVMTTAESITNFMKEVNYNDNVAGVITWMHTFSPAKNWIRGTELLQKPLLHLATQYLNN
ARAA_LACPL       KDVMTTAESITNFMKEVNYNDKVAGVITWMHTFSPAKNWIRGTELLQKPLLHLATQYLNN
ARAA_LACSS       KLVATTADNITKVMKEANYNDHVAGVITWMHTFSPAKNWIRGTKLLQKPLLHLATQFLNK
ARAA_PEDPA       KLVATTAENITEVMKEVNYNDKVAGVITWMHTFSPAKNWIRGTELLQKPLLHLATQFLNH
ARAA_LEUMM       KTVGVTAENITEAMKEANYDDSVAGVITWAHTFSPAKNWIRGTQLLNKPLLHLATQMLNN
ARAA_ECO57       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_SHIDS       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_ECOLI       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_SHIBS       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_SHISS       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_ECOK1       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_ECOUT       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_ECOL5       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_ECOL6       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_SHIFL       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_SHIF8       KPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAA
ARAA_SALPA       KPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFHTQFNAA
ARAA_SALTI       KPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFHTQFNAA
ARAA_SALCH       KPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFHTQFNAA
ARAA_SALTY       KPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFHTQFNAA
ARAA_YERPN       KPLVTTPDEITALCREANYDTACIGIMTWLHTFSPAKMWIGGLSILNKPLLQFHTQFNAQ
ARAA_YERPP       KPLVTTPDEITALCREANYDTACIGIMTWLHTFSPAKMWIGGLSILNKPLLQFHTQFNAQ
ARAA_YERPE       KPLVTTPDEITALCREANYDTACIGIMTWLHTFSPAKMWIGGLSILNKPLLQFHTQFNAQ
ARAA_YERPA       KPLVTTPDEITALCREANYDTACIGIMTWLHTFSPAKMWIGGLSILNKPLLQFHTQFNAQ
ARAA_YERPS       KPLVTTPDEITALCREANYDTACIGIMTWLHTFSPAKMWIGGLSILNKPLLQFHTQFNAQ
ARAA_YERE8       KPLVTTPDEITALCREANYDTACIGVMTWLHTFSPAKMWIGGLSILHKPLLQFHTQFNAQ
ARAA_PECAS       KPLVKTPDEILALCRDANYQDNCIGLLTWLHTFSPAKMWIGGLSVLSKPLLQFHTQFNAE
ARAA_AERHH       KPTGTTLDEISAIARDANHDQRCIGLMVWMHTFSPAKMWIPALSQLQKPLLQFHTQFNRD
ARAA_AERS4       KPTGTTLDEISSVARDANHSEQCVGLMVWMHTFSPAKMWIPALSQLQKPLLQFHTQFNRD
ARAA_MANSM       KPLATTPEDILSLCQAANYEENCVGVIAWMHTFSPAKMWIGGLTRLNKPLLQFHTQLNKN
ARAA_SHESA       KPTVKSPREIHAVCQAANSDENCVGVILWMHTFSPAKMWIAGLNELSKPFMHLHTQFNAE
ARAA_SHESR       KPTVKSPREIHAVCQAANSDENCVGVILWMHTFSPAKMWIAGLNELSKPFMHLHTQFNAE
ARAA_SHESM       KPTVKSPREIHAVCQAANSDENCVGVILWMHTFSPAKMWIAGLNELSKPFMHLHTQFNAE
ARAA_SHESW       KPTVKSPREIYAVCQAANSDENCVGIILWMHTFSPAKMWIAGLNELSKPFMHLHTQFNAE
ARAA_SACD2       RGVVTTPKEILDVCQAANSDENCVGLILWMHTFSPAKMWIAGLSALNKPYMHLHTQFGAA
ARAA_VIBPA       KGTVKTPDEILAVCRAANNDPDCIGLMLWMHTFSPAKMWIAGLTQLNKPFLHLHTQFNAA
ARAA_GRAFK       QDTVKSSDEITKVMLDANNSSSCIGVILWMHTFSPAKMWIKGLSIIKKPICHFHTQFNAE
ARAA_KORVE       KPVLTTADAVHELCREANNAAHCIGLVTWMHTFSPAKMWIAGLKALQKPFLHLHTQYNRE
ARAA_THEMA       KPVLKSSSEITEIFEKANADPKCAGVIVWMHTFSPSKMWIRGLSINKKPLLHLHTQYNRE
ARAA_BACTN       KGTANSSKEVEAVFKAANNDDKCVGVITWMHTFSPAKMWIHGLQQLKKPLLHLHTQFNKE
ARAA_BACV8       KGTANSSKEVEAVFKAANNDEKCIGVITWMHTFSPAKMWIHGLQQLKKPLLHLHTQFNKE
ARAA_BIFAA       KPTLKSSDGVKAFMTEASANPNVIGVITWCHTFSPAKMWIRGLEVLTKPLLQLATQHHKE
ARAA_BIFLO       KPTLKSSDGVKEFMVEASANPNVIGVITWCHTFSPAKMWIRGLEVLTKPLLQLATQHHKE
                 :        :              *:  * *****:* ** .     **  :: **    

ARAA_MYCSM       IPWDTIDMDFMNLNQAAHGDREFGYIQTRLSVPRTTVAGHVGDPRTTARIGSWMRAALGA
ARAA_MYCS2       IPWDTIDMDFMNLNQAAHGDREFGYIQTRLSVPRTTVAGHVGDPRTTARIGSWMRAALGA
ARAA_NOCSJ       LPWAEIDMDFMNLNQAAHGDREFASVQTRMGVARKTVTGHVEDPEVARRIGLWARAALGR
ARAA_PAEAT       LPWADIDFDFMNLNQAAHGDREFGYIQSRLGVPRKTVVGHVSNPEVARQVGAWQRASAGW
ARAA_ARTS2       LPWADIDFDFMNLNQAAHGDREFGYIQSRLGIPRKTVVGHVSNPEVTRQVGVWQRASAGW
ARAA_CLAM3       LPWSSIDMDFMNLNQAAHGDREFGYIQSRLGVVRKTVVGHVSTESVRASIGTWMRAAAGW
ARAA_ACIC1       LPWSTIDMDFMNLNQAAHGDREFGYVAARLAIPRKIVTGHFSDPDVVRDIAAWQRAAAGL
ARAA_GEOSE       IPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAF
ARAA_GEOKA       IPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAF
ARAA_GEOTN       IPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAF
ARAA1_BACLD      IPWDKIDMDFMNINQSAHGDREYGFIGARLGIPRKVIAGYWEDREVKRSIDKWMSAAVAY
ARAA_BACSU       IPWGTIDMDFMNSNQSAHGDREYGYINSRMGLSRKVIAGYWDDEEVKKEMSQWMDTAAAL
ARAA_BACHD       IPYDDIDMDFMNLNQSAHGDREYGHIGARLNISRKVIVGHWQNNDVQERLGAWMRTAAAF
ARAA_BACSK       IPWGDIDMDFMNLNQSAHGDREFGFMVSRMNIDRKVVAGHWQDARVMKRIGDWMKTVNAY
ARAA2_BACLD      IPWPTIDMDFMNLNQSAHGDREYGFINARLKKQNKVVVGYWERPEVQQQIAEWMDVAVAY
ARAA_OCEIH       IPWDTIDMDFMNLNQSAHGDREYGFINARLNKQNKVVVGYWGKSEVQRQIAEWMDVAAAY
ARAA1_CLOAB      IPWKTIDMDYMNLHQSAHGDREYGFINARLNKNNKVVVGYWKDNQVQKEIAEWMQVAYGY
ARAA2_CLOAB      IPWKTIDMDYMNLHQSAHGDREYGFINARLKKHNKVVVGYWKDKEVQKQVSDWMKVAAGY
ARAA_LACBA       IPYADIDFDYMNLNQSAHGDREYAYINARLNVNNKIVYGYWGDEDVQDQIARWEDVAVAY
ARAA_LACPL       IPYADIDFDYMNLNQSAHGDREYAYINARLQKHNKIVYGYWGDEDVQEQIARWEDVAVAY
ARAA_LACSS       IPYDTIDFDYMNLNQSAHGDREYAFINARLRKNNKIISGYWGDEDVQKAMAKWMDVAVAY
ARAA_PEDPA       IPYDTIDFDYMNLNQSAHGDREYAFINARLRKNNKIISGYWGDEGIQKQIAKWMDVAVAY
ARAA_LEUMM       IPYDSIDFDYMNLNQSAHGDREYAFINARLRLNNKIVFGHWADEAVQVQIGKWMDVAVAY
ARAA_ECO57       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_SHIDS       LPWDSIDMDFMNLNQTAHGGREFSFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_ECOLI       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_SHIBS       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_SHISS       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_ECOK1       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_ECOUT       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_ECOL5       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_ECOL6       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_SHIFL       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_SHIF8       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSK
ARAA_SALPA       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAWMRQAVSK
ARAA_SALTI       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAWMRQAVSK
ARAA_SALCH       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAWMRQAVSK
ARAA_SALTY       LPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAWMRQAVSK
ARAA_YERPN       IPWKTMDMDFMNLNHTAHGGREFGFIGARMRQQHSVITGHWQDKEAHQRIGQWMRVAAAK
ARAA_YERPP       IPWKTMDMDFMNLNQTAHGGREFGFIGARMRQQHSVITGHWQDKEAHQRIGQWMRVAAAK
ARAA_YERPE       IPWKTMDMDFMNLNQTAHGGREFGFIGARMRQQHSVITGHWQDKEAHQRIGQWMRVAAAK
ARAA_YERPA       IPWKTMDMDFMNLNQTAHGGREFGFIGARMRQQHSVITGHWQDKEAHQRIGQWMRVAAAK
ARAA_YERPS       IPWETMDMDFMNLNQTAHGGREFGFIGARMRQQHSVITGHWQDKEAHQRIGQWMRVAAAK
ARAA_YERE8       IPWETMDMDFMNLNQTAHGGREFGFIGARMRQQHSVITGHWQDKEAHQRISQWMRVAAAK
ARAA_PECAS       VPWDTMDMDFMNLNQTAHGGREFGFIGARMRQAHQVVVGHWQDKNAHVRIGKWMRVAAAI
ARAA_AERHH       LPWSEIDMDFMNLNQTAHGGREFGFMGARLRLPRTVVVGHWQDEEAHRKLGNWMRVAAAI
ARAA_AERS4       LPWSEIDMDFMNLNQTAHGGREFGFMGARLRLPRTVVVGHWQDEEAWSKIGNWMRIAAAI
ARAA_MANSM       IPWNEIDMDYMNLHQTAHGDREFGFMVSRFRKPRTIVVGHWQSESVKQKLDRWMRVLAAI
ARAA_SHESA       LPWSEINMNYMNTHQSAHGCREFGFIGTRMRKERKVVVGHWQSSDVQAQIDDWCRAAAGW
ARAA_SHESR       LPWSEINMNYMNTHQSAHGCREFGFIGTRMRKERKVVVGHWQSSDVQAQIDDWCRAAAGW
ARAA_SHESM       LPWSEINMNYMNTHQSAHGCREFGFIGTRMRKERKVVVGHWQSSDVQAQIDDWCRAAAGW
ARAA_SHESW       LPWADINMNYMNTHQSAHGCREFGYIGTRMRKERKVVVGHWQTNDVQAQVDDWCRAAAGW
ARAA_SACD2       LPWGDINMNYMNLNQSAHGDREFGYIGTRLRQERKVVVGHWQKESVQIQVDDWVRAAMGW
ARAA_VIBPA       LPWDEIDMDFMNLNQSAHGCREFGFIGTRLNIERKVVVGHWQEPQVHRDIDDWCRAAIGV
ARAA_GRAFK       IPWSKIDMDFMNLNQSAHGDREFGFIMSRMRKKRKVIVGHWKTEVTQKKVGNWQRVALGW
ARAA_KORVE       LPWATIDMDFMNLNQAAHGDREFGFIGSRMRLDRKVVVGFWQDLEVISELGTWARAAAGW
ARAA_THEMA       IPWDTIDMDYMNLNQSAHGDREHGFIHARMRLPRKVVVGHWEEKEVREKIAKWMRVACAI
ARAA_BACTN       IPWDTMDMDFMNLNQSAHGDREFGHICTRMRIRRKVVVGYWKEEETLHKIAVWMRVCAGW
ARAA_BACV8       IPWDTMDMDFMNLNQSAHGDREFGHICTRMRIRRKVVVGYWKDEDTQHKIAVWMRVCAGW
ARAA_BIFAA       IPWETIDMDFMNLNQAAHGDREFGYIVSRLGIPRKIVVGHYTDPEVAEKVGTWARACAGW
ARAA_BIFLO       IPWETIDMDFMNLNQAAHGDREFGYIVSRLGIKRKVVVGHYTDPEVAEKLGTWARACAGW
                 :*:  :::::** :::*** **.. : :*:   .  : *.         :  *     . 

ARAA_MYCSM       AELRSLRIARFGDNMRDVAVTEGDKVEAESHFGVSVNTYSVNDLAKAVYDVSDPEIDKLV
ARAA_MYCS2       AELRSLRIARFGDNMRDVAVTEGDKVEAESHFGVSVNTYSVNDLAKAVYDVSDPEIDKLV
ARAA_NOCSJ       HALAGMRLARFGDNMRNVAVTEGDKVEAERRFGVSVNTWGVNDLVAVVDEVADADVDKLC
ARAA_PAEAT       AAVRTLKLTRFGDNMRNVAVTEGDKTEAELRFGVSVNTWSVNELADAVHGAAESDVDSLV
ARAA_ARTS2       AAVRTLKLTRFGDNMRNVAVTEGDKTEAELRFGVSVNTWSVNELADAVHGAAESDVDALV
ARAA_CLAM3       AAVHELKVARFGDNMRNVAVTEGDKTEAELKFGVSVNTWGVNDLVARVDAATDAEIDALV
ARAA_ACIC1       ADLRSTRLVRFGDTMRNVAVTDGDRVEAQIRLGSAIETYGVHDLGVRVDAVAESDVDALV
ARAA_GEOSE       AESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELL
ARAA_GEOKA       AESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELL
ARAA_GEOTN       AESRHLKVARFGDNMREVAVTEGDKVGAQIQFGWSINGYGIGDLVQSIRDVSEQSVNELL
ARAA1_BACLD      IESRHIKVARFGDNMRNVAVTEGDKIEAQIQLGWSVDGYGIGDLVTEINAVSEQSLSELI
ARAA_BACSU       NESRHIKVARFGDNMRHVAVTDGDKVGAHIQFGWQVDGYGIGDLVEVMDRITDDEVDTLY
ARAA_BACHD       VDGHHLKVARFGDNMREVAVTEGDKVEAQIQFGWSITAFGIGDLVEKMKAVSEDEVRRLF
ARAA_BACSK       QESKQLKIARFGDNMREVAVTEGDKVEAQIKLGWSVSGFGIGDLVEVINSVSTEEVNALM
ARAA2_BACLD      NESFNIKVARFGDNMRNVAVTEGDKIEAQIQFGWTVDYFGIGDLVQYVNAVTDEEINRLF
ARAA_OCEIH       NESFNVKVARFGDNMRNVAVTDGDKIEAQIQFGWTVDYFAIGDLVQYVNAVKEEEIDVLF
ARAA1_CLOAB      VASENIKVARFGDNMRNVAVTEGDKVEAQIQFGWTVDYFAIGDLVAEMNKVSQKDIDATY
ARAA2_CLOAB      IASESIKVARFGDNMRNVAVTEGDKVEAQIQFGWTVDYFGIGDLVAEMDKVSQDEINKTY
ARAA_LACBA       NESFKVKVARFGDTMRNVAVTEGDKVEAQIKMGWTVDYYGIGDLVEEINKVSDADVDKEY
ARAA_LACPL       NESFKVKVARFGDTMRNVAVTEGDKVEAQIKMGWTVDYYGIGDLVEEINKVSDADVDKEY
ARAA_LACSS       NESFKIKVVTFADKMRNVAVTDGDKVEAQIKFGWTVDYWGVGDLVAEVNAVSEADIDAKY
ARAA_PEDPA       NESYGIKVVTFADKMRNVAVTDGDKIEAQIKFGWTVDYWGVADLVEEVNAVSDEDIDKKY
ARAA_LEUMM       EESFKIKVVTFADKMRNVAVTDGDKIEAQIKFGWTVDYWGVGDLVTYVNAIDDADIDNLY
ARAA_ECO57       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_SHIDS       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_ECOLI       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_SHIBS       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_SHISS       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_ECOK1       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_ECOUT       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_ECOL5       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_ECOL6       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALV
ARAA_SHIFL       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGYLVQVVNSISDGDVNALV
ARAA_SHIF8       QDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTRAVGDLVQVVNSISDGDVNALV
ARAA_SALPA       QDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIGDGDISALI
ARAA_SALTI       QDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIGDGDISALI
ARAA_SALCH       QDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIGDGDINALI
ARAA_SALTY       QDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIGDGDINALI
ARAA_YERPN       QESQQLKVARFGDNMREVAVTEGDKVAAQIQFGYSVNAYGIGDLVAVVDAVSKGDIDTLV
ARAA_YERPP       QESQQLKVARFGDNMREVAVTEGDKVAAQIQFGYSVNAYGIGDLVAVVDAVSKGDIDTLV
ARAA_YERPE       QESQQLKVARFGDNMREVAVTEGDKVAAQIQFGYSVNAYGIGDLVAVVDAVSKGDIDTLV
ARAA_YERPA       QESQQLKVARFGDNMREVAVTEGDKVAAQIQFGYSVNAYGIGDLVAVVDAVSKGDIDTLV
ARAA_YERPS       QESQQLKVARFGDNMREVAVTEGDKVAAQIQFGYSVNAYGIGDLVAVVDAVSKGDIDTLV
ARAA_YERE8       QENQQLKVARFGDNMREVAVTEGDKVAAQIQFGYSVNAYGIGDLVTVVDAVSKGEIDALV
ARAA_PECAS       QESKQLKVARFGDNMREVAVTEGDKVGAQIQFGYSVSAWGLGDLTAVVDAVSKGDIDALI
ARAA_AERHH       HDSRHLKIARFGDNMRNVAVTEGDKIEAQIQFGYQVNYHPVGDLVKVIDAVPASDIEALL
ARAA_AERS4       HDSRHLKIARFGDNMRNVAVTEGDKIEAQIQFGYQVNYHPVGDLVKIIDAVPAADIEALL
ARAA_MANSM       YDQQHLKVARFGDNMREVAVTEGDKVEAQIKFGYSVNGYGLYQLVNSINTVNDEDITALV
ARAA_SHESA       HESQNLRIARFGDNMRQVAVTEGDKVAAQIQFGYEVHAYSLGELNEAIADIAEGDVTAQL
ARAA_SHESR       HESQNLRIARFGDNMRQVAVTEGDKVAAQIQFGYEVHAYSLGELNEAIAAIAEGDVTAQL
ARAA_SHESM       HESQNLRIARFGDNMRQVAVTEGDKVAAQIQFGYEVHAYSLGELNEAIAAIAEGDVTAQL
ARAA_SHESW       NESQNLRIARFGDNMRQVAVTEGDKVAAQIQFGYEVHAYSLGELNDAINAISENDITAQI
ARAA_SACD2       AESQTLKVARFGDNMRQVAVTEGDKVSAQIQFGYEVHAFGLGDLAKACEKITAEQITAQL
ARAA_VIBPA       NAGQHLKVARFGDNMRQVAVTEGNKVSAQIQFGYEVNAYGLGELSDVVNSISDADVNHQL
ARAA_GRAFK       DELQHIKVARIGDNMRQVAVTEGDKVAAQIKFGVEVNAYDSSDVTQHIDKVSDDEVNSLL
ARAA_KORVE       HDAQHLKVARFGDNMRNVAVTEGDKVQAKIQLAYSVDGFGVGDLVARIHAASDRDVDHLV
ARAA_THEMA       QDGRMGQIVRFGDNMREVASTEGDKVEAQIKLGWSINTWGVGELAERVKAVPEREVEELL
ARAA_BACTN       ADSQDMLIIRFGDQMNNVAVTDGDKVEAEQRMGYHVDYCPASELMEYHKDIKNADVDALV
ARAA_BACV8       ADSQDMLIIRFGDQMNNVAVTDGDKVEAEQRMGYHVDYCPASELMKYHKNIKDTDVEALV
ARAA_BIFAA       DASQNMKVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNDLVAAYEKVKDSQVKDLI
ARAA_BIFLO       DASNNMKVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNELVAAYDAVKDDQVKEII
                        :   .* *..** *:*::  *.  :.  :       :          .:    

ARAA_MYCSM       QEYEDTYAVAEELRR-GGERHASLREGARIELGLRHFLADG-FGAFTTNFEDLGD-----
ARAA_MYCS2       QEYEDTYAVAEELRR-GGERHASLREGARIELGLRHFLADG-FGAFTTNFEDLGD-----
ARAA_NOCSJ       EEYADSYDVAAELLP-SGERHESLRYGARIELGLRSFLTEGGFTAFTSNFEDLGG-----
ARAA_PAEAT       AEYERLYEVVPELKK-GGARHESLRYSAKIELGLRSFLEANGSAAFTTSFEDLGA-----
ARAA_ARTS2       AEYERLYEVVPELKA-GGARHESLRYSARIELGLRSFLEANGSAAFTTSFEDLGE-----
ARAA_CLAM3       DEYETLYDIQPELRR-GGERHESLRYGAAIELGLRSFLEEGGFGAFTTSFEDLGG-----
ARAA_ACIC1       DRYLADYDMAPELTI-GGARHESLRYAAKLELALRSFLHDGRFTAFTTNFEDLGP-----
ARAA_GEOSE       DEYEELYDIVPAGRQ-EGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHG-----
ARAA_GEOKA       DEYEELYDIVPAGRQ-EGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHG-----
ARAA_GEOTN       DEYAELYDIVPAGRQ-DGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHG-----
ARAA1_BACLD      SEYEELYEWPE-----GEAARESVKEQARIELGLKRFLSSGGYTAFTTTFEDLHG-----
ARAA_BACSU       AEYDRLYVISEETKR-DEAKVASIKEQAKIELGLTAFLEQGGYTAFTTSFEVLHG-----
ARAA_BACHD       DEYQELYRLSPSILE-QDEVKAAVLEQAKMELALKEFLEEGGYTAFTTNFEDLHG-----
ARAA_BACSK       DEYRSLYTFHR------DANIAAVEEQARIEIGIERFLQQGDFRAFSTTFEDLHG-----
ARAA2_BACLD      AEYADLYEFDYGTYS-REDWEKSVKVQASYEIAIKRFLDDGGYNAFTTNFEDLYG-----
ARAA_OCEIH       AEYKDSYDFDYGDYS-KDDWEASVRVQASYEIAIKRFLDDGGYNAFTSNFEDLYG-----
ARAA1_CLOAB      EEFKDIYILDIGDND-PEFYENHVKEQIKIEIGLRNFLEAGNYTAFTTNFEDLYG-----
ARAA2_CLOAB      EEFKDLYILDPGEND-PAFYEKQVKEQIKIEIGLRRFLEKGNYNAFTTNFEDLYG-----
ARAA_LACBA       ADLESKYTMVQGDND-AETYKHSVRVQLQQYLGIKRFLEKGGYTAFTTNFEDLWG-----
ARAA_LACPL       ADLESRYEMVQGDND-ADTYKHSVRVQLAQYLGIKRFLERGGYTAFTTNFEDLWG-----
ARAA_LACSS       ADLQKEYDFVEGQNT-PEKFEHNVKYQIREYFGLKKFMDDRGYTAFTTNFEDLVG-----
ARAA_PEDPA       EEMKNDYNFVEGQNS-SEKFEHNTKYQIREYFGLKKFMDDRGYTAFTTNFEDLAG-----
ARAA_LEUMM       IELQDKYDFVAGQND-SEKYEHNVKYQLREYLGIKRFLTDKGYSAFTTNFEDLVG-----
ARAA_ECO57       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SHIDS       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_ECOLI       DEYESCYTMTPATQI-HGKKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SHIBS       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SHISS       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_ECOK1       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_ECOUT       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_ECOL5       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_ECOL6       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SHIFL       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SHIF8       DEYESCYTMTPATQI-HGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SALPA       DEYESSYTLTPATQI-HGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SALTI       DEYESSYTLTPATQI-HGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SALCH       DEYESSYTLTPATQI-HGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_SALTY       DEYESSYTLTPATQI-HGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFEDLHG-----
ARAA_YERPN       EEYEATYRFTDAVKL-NGDKRENLLDAARIELGMTRFLEQGGFKAFTTNFENLYG-----
ARAA_YERPP       EEYEATYRFTDAVKL-NGDKRENLLDAARIELGMTRFLEQGGFKAFTTNFENLYG-----
ARAA_YERPE       EEYEATYRFTDAVKL-NGDKRENLLDAARIELGMTRFLEQGGFKAFTTNFENLYG-----
ARAA_YERPA       EEYEATYRFTDAVKL-NGDKRENLLDAARIELGMTRFLEQGGFKAFTTNFENLYG-----
ARAA_YERPS       EEYEATYRFTDAVKL-NGDKRENLLDAARIELGMTRFLEQGGFKAFTTNFENLYG-----
ARAA_YERE8       EEYEATYRLTDAVQL-HGNKRENLLDAARIELGMKRFLEQGGFKAFTTNFENLYG-----
ARAA_PECAS       EEYETSYQLTDAVKL-NGANRQNLLDAAQIELGMKRFLEQGGYHAFTTDFENLYG-----
ARAA_AERHH       AEYEESYTLTEAVQA-GGVLRASLYEAARQELGMKKFLTDGGFGAFTTTFEDLHG-----
ARAA_AERS4       AEYEQSYTLTEAVQA-GGPLRASLYEAARQELGMKKFLTEGGFGAFTTTFEDLHG-----
ARAA_MANSM       KEYEASYQLADSLKD-GGEKRQSLIDSARIELGLKAFLDKGGFKAFTDTFQNLAG-----
ARAA_SHESA       DRYASEYQVGNELFG-DEYQLDRLRKEAKIELGLTQFLTQGGFGAFTNCFENLTG-----
ARAA_SHESR       DRYASEYQVGNELFG-DEYQLDRLRKEAKIELGLTQFLTQGGFGAFTNCFENLTG-----
ARAA_SHESM       DRYASEYQVGNELFG-DEYQLDRLRKEAKIELGLTQFLTQGGFGAFTNCFENLTG-----
ARAA_SHESW       DRYASEYIISNELFN-DEYQLDRLRKEAKIELGLAQFLKDGEFGAFTNCFENLTG-----
ARAA_SACD2       ELYKQDYEIDADVFT-DVHSLEMLQNEARLELGMEAFLEEGNFKAFTNCFENLTG-----
ARAA_VIBPA       DKYACMYEMSPDLFN-DSDLKKLMAQEARLELGMESFLKSVGAGAFTNTFENLTG-----
ARAA_GRAFK       KKYEKDYDLTDALKD-GGDQRQSLVDAAKIELGLRAFLEEGGFMAFTDTFENLGA-----
ARAA_KORVE       SEYEDTYTLSEPLTA-KGKQRASLLDAARIELGLRHFLKDGNFHAFTDTFEDLHG-----
ARAA_THEMA       KEYREKYIMPE-----DEYSLKAIREQAKIEIALREFLKEKNAVGFTTTFEDLHD-----
ARAA_BACTN       ATYFNDYDHDASLEDKSTEAYQKVWNAAKAELALRAILKAKGAKGFTTNFDDLGQTDGSY
ARAA_BACV8       ATYFNEYDHDASLEDKSTEAYQKVWNAAKAELALRAILKAKGAKGFTTNFDDLGQTDGSY
ARAA_BIFAA       EDYKAKYDVAPELLD---SRYDELFIAAKEEAAMVNMMRENGCTAGVDNFEDLGT-----
ARAA_BIFLO       EDYKAKYDVDPALLD---AKYDSLFIAAKEEAAMVNMMRANGCTAGVDNFEDLGA-----
                       *                         .:  ::      .    *: *       

ARAA_MYCSM       LRQLPGLAVQRLMAD-GFGFGAEGDWKTSAMVRTVKTMGVGLPGGTSFMEDYTYDLTPGS
ARAA_MYCS2       LRQLPGLAVQRLMAD-GFGFGAEGDWKTSAMVRTVKTMGVGLPGGTSFMEDYTYDLTPGS
ARAA_NOCSJ       LRQLPGLAVQRLMAD-GYGFGGEGDWKTSVLLRTLKVVADGLPGGTSFMEDYTYHLVPGE
ARAA_PAEAT       LRQLPGMAVQRLMAD-GYGFGAEGDWKTAILVRAAKVMGGDLPGGASLMEDYTYHLEPGS
ARAA_ARTS2       LRQLPGMAVQRLMAD-GYGFGAEGDWKTAILVRAAKVMGSGLPGGASLMEDYTYHLAPGQ
ARAA_CLAM3       LRQLPGLAVQRLMAE-GYGFGAEGDWKTAVLIRAAKVMGSGLPGGASLMEDYTYHLVPGE
ARAA_ACIC1       LRQLPGIAVQRLMAD-GFGFGAEGDWKTALLVRAVKTMSRGLPGGTSFMEDYTYHLEPSG
ARAA_GEOSE       MKQLPGLAVQRLMAE-GYGFGGEGDWKTAALVRLMKVMADGK--GTSFMEDYTYHLEPGN
ARAA_GEOKA       MKQLPGLAVQRLMAE-GYGFGGEGDWKTAALVRLMKVMADGK--GTSFMEDYTYHFEPGN
ARAA_GEOTN       MKQLPGLAVQRLMAE-GYGFGGEGDWKTAALVRLMKVMADGK--GTSFMEDYTYHFEPGN
ARAA1_BACLD      MKQLPGLAVQRLMAE-GYGFGGEGDWKTAALVRMMKMMAGGK--ETSFMEDYTYHFEPGN
ARAA_BACSU       MKQLPGLAVQRLMEK-GYGFAGEGDWKTAALVRMMKIMAKGK--RTSFMEDYTYHFEPGN
ARAA_BACHD       MKQLPGLAVQRLMAE-GYGFGGEGDWKTAALLRMMKIIADGK--GTSFMEDYTYHLAEGN
ARAA_BACSK       MKQLPGLAVQRLMAK-GYGFAGEGDWKTAALLRVLKVLAGNV--GTSFMEDYTNHLEPGQ
ARAA2_BACLD      MKQLPGLAVQRLMAQ-GYGFAGEGDWKTAALDRLLKVMSRNQ--STGFMEDYTYELAAGQ
ARAA_OCEIH       MKQLPGLAVQRLMGQ-GYGFAGEGDWKTAALDRLLKVMSHNQ--STGFMEDYTYELAEGK
ARAA1_CLOAB      MKQLPGLAVQRLNAE-GYGFAGEGDWKTAALNRLFKIMTDNK--KTGFMEDYTYELSAGN
ARAA2_CLOAB      MKQLPGLAVQRLNAE-GYGFAGEGDWKTAALDRLLKVMTNNT--ATGFMEDYTYELSRGN
ARAA_LACBA       MEQLPGLAAQLLIRD-GYGFGAEGDWKTAALGRVMKIMSHND--RTAFMEDYTLDLRKGH
ARAA_LACPL       MEQLPGLASQLLIRD-GYGFGAEGDWKTAALGRVMKIMSHNK--QTAFMEDYTLDLRHGH
ARAA_LACSS       LEQLPGLAAQLLMAE-GYGFAGEGDWKTAALDRLLKIMAHNE--KTVFMEDYTLDLRQGH
ARAA_PEDPA       LEQLPGLAAQMLMAE-GYGFAGEGDWKTAALDRLLKIMAHNK--QTVFMEDYTLDLREGH
ARAA_LEUMM       LEQLPGLAAQLLMAD-GFGFAGEGDWKTAALTRLLKIVSHNQ--ATAFMEDYTLDLRQGH
ARAA_ECO57       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SHIDS       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_ECOLI       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SHIBS       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SHISS       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_ECOK1       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_ECOUT       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_ECOL5       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_ECOL6       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SHIFL       LKQLPGLPVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SHIF8       LKQLPGLPVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SALPA       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SALTI       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTDHFEKGN
ARAA_SALCH       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_SALTY       LKQLPGLAVQRLMQQ-GYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGN
ARAA_YERPN       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRILKVMGTGLKGGTSFMEDYTYNFQPGN
ARAA_YERPP       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRILKVMGTGLKGGTSFMEDYTYNFQPGN
ARAA_YERPE       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRILKVMGTGLKGGTSFMEDYTYNFQPGN
ARAA_YERPA       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRILKVMGTGLKGGTSFMEDYTYNFQPGN
ARAA_YERPS       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRILKVMGTGLKGGTSFMEDYTYNFQPGN
ARAA_YERE8       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRILKVMGTGLKGGTSFMEDYTYNFQPGN
ARAA_PECAS       LKQLPGLAVQRLMQQ-GYGFGGEGDWKTAALLRIMKVMAGGLSGGTSFMEDYTYNFQNGN
ARAA_AERHH       LHQLPGLACQRLMQQ-GFGFGAEGDWKTAALLRTLKVMGTGLAGGTSFMEDYTYHLEAGN
ARAA_AERS4       LHQLPGLACQRLMQQ-GFGFGAEGDWKTAALLRTIKVMGTGLAGGTSFMEDYTYHLEAGN
ARAA_MANSM       IKQLPGLPVQRLMAQ-GYGFGAEGDWKTAALVRAIKVMSYGLPNGCSFMEDYTYNLDDNN
ARAA_SHESA       MTGLPGLATQRLMAN-GFGYGGEGDWKTAAMVRIMKVMGQGRAGGTSFMEDYTYNFGA-T
ARAA_SHESR       MTGLPGLATQRLMAN-GFGYGGEGDWKTAAMVRIMKVMGQGRAGGTSFMEDYTYNFGA-T
ARAA_SHESM       MTGLPGLATQRLMAN-GFGYGGEGDWKTAAMVRIMKVMGQGRAGGTSFMEDYTYNFGA-T
ARAA_SHESW       MTGLPGLATQRLMAN-GIGYGGEGDWKTAAMVRIMKVMGQGRVGGTSFMEDYTYNFGA-T
ARAA_SACD2       LSGLPGLATQRLMSK-GYGYGGEGDWKTAAMCRIVKVMSLGKAAGTSFMEDYTYNFGD-P
ARAA_VIBPA       LTNLPGLATQRLMAK-GFGYGGEGDWKTAAMTHIMKVMGQGKPGGTSFMEDYTYNFGE-K
ARAA_GRAFK       LKQLPGLAVQRLMAD-GYGFGAEGDWKTAALLRAMKVMAQGMEGGTSFMEDYTNHFTEGK
ARAA_KORVE       LNQLPGIAVQRLMAD-GYGFGAEGDWKTAALVRTMKVMAAGLDAGTSFMEDYTYHLEN-G
ARAA_THEMA       LPQLPGLAVQRLMEE-GYGFGAEGDWKAAGLVRAIKVMGTSLPGGTSFMEDYTYHLTPGN
ARAA_BACTN       FDQIPGLASQRLMAE-GYGFGAEGDWKSAALYRTVWVMNQGLPKGCSFLEDYTLNFDGAN
ARAA_BACV8       FDQIPGLASQRLMAE-GYGFGAEGDWKSAALYRTVWVMNQGLSKGCSFLEDYTLNFDGAN
ARAA_BIFAA       LPQLPGVGPQRFPSEYGWGFSAEGDWKTSVLVRIGAVMGYGLEGGASLMEDYSYNFVPGN
ARAA_BIFLO       LPQLPGVGPQRFPSEYGWGFSAEGDWKTAVLVRIGAVMGYGLEGGASLMEDYSYNFTEGD
                 :  :**:  * :  . * *:..*****:: : :    :  .      ::***: .:    

ARAA_MYCSM       ERILGAHMLEVCPSIAGQ-TPSLEVHPLGIGN-REDPVRLRFTAAPG-SGVVLGICDMGS
ARAA_MYCS2       ERILGAHMLEVCPSIAGQ-TPSLEVHPLGIGN-REDPVRLRFTAAPG-SGVVLGICDMGS
ARAA_NOCSJ       ERILGAHMLEVCPSIAEG-RPSLEIHPLSIGG-REDPVRLVFDAAPG-PAVLLGLADLGE
ARAA_PAEAT       EKILGAHMLEVCPSLTAK-KPRVEIHPLGIGG-KEDPVRMVFDTDAG-PGVVVALSDMRD
ARAA_ARTS2       EKILGAHMLEVCPSLTAT-KPRVEIHPLGIGG-KEDPVRMVFDTDAG-PGVVVALSDMRD
ARAA_CLAM3       EKILGAHMLEICPTLTTG-RPSLEIHPLGIGG-REDPVRLVFDTDPG-PAVVVAMSDMRD
ARAA_ACIC1       RLVLGAHMLEVCPTLTSA-TPRCEIHPLLMGG-REDPVRLVFTADPA-PAVIVGLCDMGD
ARAA_GEOSE       EMILGAHMLEVCPTIAAT-RPRIEVHPLSIGG-KEDPARLVFDGGEG-AAVNASLIDLGH
ARAA_GEOKA       ELILGAHMLEVCPTIAAT-RPRVEVHPLSIGG-KEDPARLVFDGGEG-AAVNASLIDLGH
ARAA_GEOTN       EMILGAHMLEVCPTIAAT-RPRIEVHPLSIGG-KEDPARLVFDGGEG-AAVNASLIDLGH
ARAA1_BACLD      EMILGSHMLEVCPSIAEH-KPRIEVHPLSMGA-KDDPARLVFDGIAG-PAVNVSLIDLGG
ARAA_BACSU       EMILGSHMLEVCPTVALD-QPKIEVHSLSIGG-KEDPARLVFNGISG-SAIQASIVDIGG
ARAA_BACHD       ELVLGSHMLEICPTIAAN-QPEIQVHPLGIGG-KEDPARLVFDGADG-PALNASLIDLGH
ARAA_BACSK       EMILGSHMLEVCPTISAQ-KPEIVVAPLSMGN-REDPARLVFKGKAG-RALNAALIDMGS
ARAA2_BACLD      ESILQSHMLEVDPSLASN-KPKIIVSPLGIGD-REDPARLVFDGKAG-DGVVVSMADFGT
ARAA_OCEIH       EAILQSHMLEVDPTLAST-KPKITVFPLGIGD-REDPARLVFDGKAG-DGVVVSMADFGT
ARAA1_CLOAB      ERILGAHMLEVDPTLAAS-KPRVVVKPLGIGD-KEAPARLIFDGVVG-DGVVVSMLDLGT
ARAA2_CLOAB      EKALGAHMLEVDPTFASD-KPKVIVKPLGIGD-KEDPARLIFNGSTG-KGVAVSMLDLGT
ARAA_LACBA       EAILGSHMLEVDPTIASD-KPRVEVHPLDIGG-KADPARLVFTGSEG-DAIDVTVADFRD
ARAA_LACPL       EAILGSHMLEVDPSIASD-KPRVEVHPLDIGG-KDDPARLVFTGSEG-EAIDVTVADFRD
ARAA_LACSS       EAILGSHMLEVDPSIASD-KPRVEVHPLDIGD-KDDPARLVFTGMQG-DAVDVTMADYGD
ARAA_PEDPA       EAILGSHMLEVDPSIASD-TPRVEVHPLDIGG-KEDPARFVFTGMEG-DAVDVTMADYGD
ARAA_LEUMM       EAILGSHMLEVDPTIASD-KPRVEVHPLGIGG-KEDPARLVFSGRTG-DAVDVTISDFGD
ARAA_ECO57       DLVLGSHMLEVCPSIAAEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SHIDS       DLVLGSHMLEVCPSIAAEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_ECOLI       DLVLGSHMLEVCPSIAAEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SHIBS       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SHISS       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_ECOK1       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_ECOUT       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_ECOL5       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_ECOL6       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SHIFL       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SHIF8       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KDDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SALPA       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KEDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SALTI       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KEDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SALCH       DLVLGSHMLEVCPSIAVEEKLILDVQHLGIGG-KEDPARLIFNTQTG-PAIVASLIDLGD
ARAA_SALTY       DLVLGSHMLEVCPSIAVEEKPILDVQHLGIGG-KEDPARLIFNTQTG-PAIVASLIDLGD
ARAA_YERPN       DLVVGSHMLEVCPSIAKEEKPLLDVQHLGIGG-KADPARLIFSTPAG-PALNASLIDMGN
ARAA_YERPP       DLVVGSHMLEVCPSIAKEEKPLLDVQHLGIGG-KADPARLIFSTPAG-PALNASLIDMGN
ARAA_YERPE       DLVVGSHMLEVCPSIAKEEKPLLDVQHLGIGG-KADPARLIFSTPAG-PALNASLIDMGN
ARAA_YERPA       DLVVGSHMLEVCPSIAKEEKPLLDVQHLGIGG-KADPARLIFSTPAG-PALNASLIDMGN
ARAA_YERPS       DLVVGSHMLEVCPSIAKEEKPLLDVQHLGIGG-KADPARLIFSTPAG-PALNASLIDMGN
ARAA_YERE8       DLVVGSHMLEVCPSIAKEEKPLLDVQHLGIGG-KADPARLIFSTPAG-PALNASLIDMGN
ARAA_PECAS       DLVVGSHMLEVCPTIAKEQKPILDAQHLGIGG-KADPARLIFSTPAG-PSLNASVIDMGD
ARAA_AERHH       NLVLGAHMLEVCPSIAAD-KPVLDAQHLGIGK-KADPARLLFAAPAG-KAVNASLIDLGN
ARAA_AERS4       NLVLGSHMLEVCPSIAAD-KPVLDAQHLGIGK-KADPARLLFAAPAG-KAVNASLIDMGN
ARAA_MANSM       EIVLGAHMLEVCPSIANN-KPILDIKPLGIGG-KEDPARLIFTSKSG-KATASTIVDLGN
ARAA_SHESA       DQVLGAHMLEVCPSIAAA-KPRLEVHRHTIGV-RCDVPRLLFTGKAG-PAINVSTIDLGN
ARAA_SHESR       DQVLGAHMLEVCPSIAAA-KPRLEVHRHTIGV-RCDVPRLLFTGKAG-PAINVSTIDLGN
ARAA_SHESM       DQVLGAHMLEVCPSIAAA-KPRLEVHRHTIGV-RCDVPRLLFTGKAG-PAINVSTIDLGN
ARAA_SHESW       DQVLGAHMLEVCPSIAAS-KPRLEVHRHTIGV-RCDVPRLLFTAKAG-PAINVSTIDLGN
ARAA_SACD2       DQVLGAHMLEVCPSISNE-KPKVVVERHTIGI-KKDIARLIFTGTPG-PAINISTIDMGT
ARAA_VIBPA       GQVLGAHMLEVCPTIAAA-KPRLEVHRHTIGC-RCDIPRLIFSGQSG-EALNVSIIDLGD
ARAA_GRAFK       DYVLGSHMLEICPSIADS-KPTCEVHPLGIGG-KEDPVRLVFNSPKG-KALNASLVDMGT
ARAA_KORVE       GLVLGAHMLEICPSIASG-KPSCEIHPLSIGG-KGDPVRLVFDSQTG-PAVVATIVDVGE
ARAA_THEMA       ELVLGAHMLEVCPTIAKE-KPRIEVHPLSIGG-KADPARLVFDGQEG-PAVNASIVDMGN
ARAA_BACTN       SSILQSHMLEICPLIAAN-KPRLEVHFLGIGIRKSQTARLVFTSKTG-TGCTATVVDMGN
ARAA_BACV8       SAILQSHMLEVCPLIAAS-KPRLEVHFLGIGIRKSQTARLVFTSKVG-SGCTATVVDLGN
ARAA_BIFAA       EFDMGSHMLEVSPSIGTIAKPKLAIYPLGIGG-KSDPVRLVFSGKPA-DAVVVSMADERE
ARAA_BIFLO       ELDMGSHMLEVSPSIGTIAKPKLEIHPLGIGG-KADPVRLVFSGKPAKDAVVVSMSDVRE
                    : :****: * .              :*  :    *: *    .  .      *   

ARAA_MYCSM       RFRLVANHVTVVEPSAPLPNLPVACAVWEPEPSWSTSTEAWLMAGGPHHTVLTTAVSPTT
ARAA_MYCS2       RFRLVANHVTVVEPSAPLPNLPVACAVWEPEPSWSTSTEAWLMAGGPHHTVLTTAVSPTT
ARAA_NOCSJ       RFRFVGNEVEVVAPTEPLPNLPVARAVWRPAPDLRTSTEAWLMAGGPHHTVLSTALGAEH
ARAA_PAEAT       RFRLVANVVDVVDLDQPLPNLPVARALWEPKPNFATSAAAWLTAGAAHHTVLSTQVGLDV
ARAA_ARTS2       RFRLVANAVDVVDLDEPLPNLPVARALWSPKPDFATSAAAWLTAGAAHHTVLSTQVGMDV
ARAA_CLAM3       RFRIVANVVEVVPLDEPLPNLPVARAVWKPAPDLATSAAAWLTAGAAHHTVMSTQVGVEV
ARAA_ACIC1       RLRLVANTADLVAPPEPLPRLPVARAVWQPHPELKTAATAWIAAGGPHHTALSTAVSARE
ARAA_GEOSE       RFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQ
ARAA_GEOKA       RFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQ
ARAA_GEOTN       RFRLIVNEVDAVKPEFDMLKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTAEQ
ARAA1_BACLD      RFRLVINKVEAVKVPHDMPNLPVARVLWKPQPSLRTSAEAWILAGGAHHTCLSYQLTAEQ
ARAA_BACSU       RFRLVLNEVNGQEIEKDMPNLPVARVLWKPEPSLKTAAEAWILAGGAHHTCLSYELTAEQ
ARAA_BACHD       RFRLVVNEVEAIKPERDMPKLPVAKVLWKCKPSLSEATEAWIHAGGAHHTVFSFEVTPEQ
ARAA_BACSK       RFRLVANEVEAVENPHDMPKLPVASVLWKPLPSFSEATEAWIYAGGAHHTVFSYEISKEQ
ARAA2_BACLD      HYKLLINEVSAFEPTVPAPNLPVARVLWEVKPNFQDGVKAWLENGGGHHTVVSLFLTTDQ
ARAA_OCEIH       HFKLLINEVNAFEPTTPAPNLPVARVLWEVKPNFQDGVKAWIENGGGHHTVVSLNLTTDQ
ARAA1_CLOAB      HYRLLINEVKAVKPTEDAPNLPVAKLVWQPQPNFKDAVKAWIYAGGGHHTVATLELTVEQ
ARAA2_CLOAB      HYRLIINGLTAVKPDEDMPNLPVAKMVWKPEPNFIEGVKSWIYAGGGHHTVVSLELTVEQ
ARAA_LACBA       GFKMIGYAVDANKPEGETPNLPVAKQLWTPKVGLKTGALEWMKAGGGHHTMLSFSLTEEQ
ARAA_LACPL       GFKMISYAVDANKPEAETPNLPVAKQLWTPKMGLKKGALEWMQAGGGHHTMLSFSLTEEQ
ARAA_LACSS       EFKLMSYDVRGNKPEADTPHLPVAKQLWTPKQGLREGAVGWLTVGGGHHTVLSFAVDSEQ
ARAA_PEDPA       EFKLMSYDVTGNKTEKETPYLPVAKQLWTPKQGWKQGAEGWLTLGGGHHTVLSFAIDAEQ
ARAA_LEUMM       EFKLISYDVTGNKPEAETPYLPVAKQLWTPKAGLKAGAEGWLTVGGGHHTTLSFSVDSEQ
ARAA_ECO57       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_SHIDS       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_ECOLI       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_SHIBS       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_SHISS       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_ECOK1       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_ECOUT       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_ECOL5       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_ECOL6       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPSASEAWILAGGAHHTVFSHALNLND
ARAA_SHIFL       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_SHIF8       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLND
ARAA_SALPA       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALDLND
ARAA_SALTI       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALDLND
ARAA_SALCH       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALDLND
ARAA_SALTY       RYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALDLND
ARAA_YERPN       RFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAEAWIIAGGAHHTVFSQAVGVDE
ARAA_YERPP       RFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAEAWIIAGGAHHTVFSQAVGVDE
ARAA_YERPE       RFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAEAWIIAGGAHHTVFSQAVGVDE
ARAA_YERPA       RFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAEAWIIAGGAHHTVFSQAVGVDE
ARAA_YERPS       RFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAEAWIIAGGAHHTVFSQAVGVDE
ARAA_YERE8       RFRLLVNVVDTVEQPHPLPKLPVARAIWQAQPSLATAAEAWIIAGGAHHTVFSQAIGVDE
ARAA_PECAS       RFRMLVNLVDTIEQPRPLPKLPVARAIWKAQPSLEVAAEAWILAGGAHHTVFSQALDLDH
ARAA_AERHH       RFRLVVNQLEVVDLPEAMPKLPVASALWQPMPDLQTSAEAWILAGAAHHSVFTQSVDIEQ
ARAA_AERS4       RFRLVVNQLEVVDLPEAMPKLPVASALWKPLPSLQTSAEAWILAGAAHHSVFTQSVDIEQ
ARAA_MANSM       RFRMITADMQAVDKPQDMPNLPVGHAFWKLEPNFDIGTQAWILSGGAHHNVFSLDIDADM
ARAA_SHESA       RFRIILNELDTVTPPQDLPNLPVASALWEPRPNLAVAAAAWIHAGGAHHSAYSQAITTDQ
ARAA_SHESR       RFRIILNELDTVTPPQDLPNLPVASALWEPRPNLAVAAAAWIHAGGAHHSAYSQAITTDQ
ARAA_SHESM       RFRIILNELDTVTPPQDLPNLPVASALWEPRPNLAVAAAAWIHAGGAHHSAYSQAITTDQ
ARAA_SHESW       RFRIILNELDTVTPPQDLPNLPVASALWEPRPNLSIAAAAWIHAGGAHHSAYSQAISTEN
ARAA_SACD2       RFRIIANEVDTVKPPQDLPNLPVAKALWEPRPSLEVAAAAWIHAGGAHHSVYTQGINLDQ
ARAA_VIBPA       RFRMIVNVIDTVTPPQSLPHLPVAHALWEPQPNLNIAAAAWIHAGGAHHAVYSQAVTLPM
ARAA_GRAFK       RFRLIVNEVEAVEPEADLPNLPVARVLWDPKPDMDTAVTAWILAGGAHHTVYTQALSTEF
ARAA_KORVE       RFRMVINKVNVIPPEVPLPKLPVARAVWIPEPNLAVAAACWIYAGGAHHTGFSLCLTAQH
ARAA_THEMA       RFRLVVNKVLSVPIERKMPKLPTARVLWKPLPDFKRATTAWILAGGSHHTAFSTAIDVEY
ARAA_BACTN       RFRLIVNDVECIEP-KPLPKLPVASALWIPMPNLEVGAGAWILAGGTHHSCFSYDLTAEY
ARAA_BACV8       RFRLIVNDVECIES-KPLPKLPVASALWIPMPNFEVGAGAWILAGGTHHSCFSYDLTAEY
ARAA_BIFAA       RFRLLMDEVTIVEPQGSLKNLPCARAVWKPKPDLKTAVQCWITAGGSHHTCMTTSVGREA
ARAA_BIFLO       RFRLLMDVVDVVEPQGSLKELPCARAVWEPKPSLKTAVECWITAGGSHHTCMTTSVGREA
                   :::               ** .  .*        .   *:  *. **   :  :    

ARAA_MYCSM       LDDFATITGTELLQIDQHTTPREFQREMRWNAVYHHIAAGL-
ARAA_MYCS2       LDDFATITGTELLQIDQHTTPREFQREMRWNAVYHHIAAGL-
ARAA_NOCSJ       LDDLAEMTGTELVLVDADTTIRGLAKELRWSAAYHRLAQGL-
ARAA_PAEAT       FEDFAEIAKTELLTIDEDTTIKQFKKELNWNAAYYKLAGGL-
ARAA_ARTS2       FEDFAEIAKTELLTIDEGTTIRQFKKELNWNAAYYRLAGGL-
ARAA_CLAM3       FEDFAEIARTELLVIDEDTTLKGFTKEVRWNQAYHRLAQGL-
ARAA_ACIC1       IRDFARMAGLELVLIDEHTALDAALDRL-WAIEQTRASRPW-
ARAA_GEOSE       LQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR----
ARAA_GEOKA       LQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR----
ARAA_GEOTN       LEDFAEMTGIECVVINEHTSVSSFKNELRWNEVFWRGR----
ARAA1_BACLD      MLDWAEMSGIEAVLINRDTTILNLRNELKWSEAAYRLRKF--
ARAA_BACSU       MLDWAEMAGIESVLISRDTTIHKLKHELKWNEALYRLQK---
ARAA_BACHD       LYDWATLADIEVVFINDKTDVLQFQQQLQWNEAFRRLFK---
ARAA_BACSK       LADWASLMGIECIVIDDQSNVGQVRKELFWNRRAY-------
ARAA2_BACLD      MITYAKLVDLEYVVIK--------------------------
ARAA_OCEIH       VVSYAKLVGLDYIVIK--------------------------
ARAA1_CLOAB      VYDWSRMVGLETIVIDHNTNLRDIIKETSR------------
ARAA2_CLOAB      VYDWSRMVGLEAVIIDKDTKLRDIIEKTTK------------
ARAA_LACBA       MEDFATMVGMTKAFIK--------------------------
ARAA_LACPL       MEDYATMVGMTKAFLK--------------------------
ARAA_LACSS       LQDLSHLFDLTYVNIK--------------------------
ARAA_PEDPA       LQDLSNMFGLTYVNIK--------------------------
ARAA_LEUMM       LTDLANLFGVTYVDIK--------------------------
ARAA_ECO57       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_SHIDS       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_ECOLI       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_SHIBS       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_SHISS       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_ECOK1       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_ECOUT       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_ECOL5       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_ECOL6       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_SHIFL       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_SHIF8       MRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR---
ARAA_SALPA       MRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR---
ARAA_SALTI       MRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR---
ARAA_SALCH       MRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR---
ARAA_SALTY       MRQFAEIHDIEIAVIDNDTHLPAFKDALRWNEVYYGFKR---
ARAA_YERPN       LRLYAEMHGIEFLLIDNDTTLPAFKNEIRWNEVYYQLNR---
ARAA_YERPP       LRLYAEMHGIEFLLIDNDTTLPAFKNEIRWNEVYYQLNR---
ARAA_YERPE       LRLYAEMHGIEFLLIDNDTTLPAFKNEIRWNEVYYQLNR---
ARAA_YERPA       LRLYAEMHGIEFLLIDNDTTLPAFKNEIRWNEVYYQLNR---
ARAA_YERPS       LRLYAEMHGIEFLLIDNDTTLPAFKNEIRWNEVYYQLNR---
ARAA_YERE8       LRLYAEMHGIEFLLIDNDTTLPAFKNEIRWNEVYYHLNR---
ARAA_PECAS       MRLYAEMQNIELLVIDNETRLHEFKDALRWNEVYYKLCSR--
ARAA_AERHH       LRTFADLMGIEFVVIDKHTRIPELKQTLQWNEVYYKLCH---
ARAA_AERS4       LRTFADIMGIEFVVIDEHTRIPALKETLRWNEVYYKICH---
ARAA_MANSM       LRTFAEYFDIEFIHINVKTELPNLKNELRWNEAAYK------
ARAA_SHESA       IVDFAEMAGAELVIIDADTKIREFKNELRQNSVYYGLARGL-
ARAA_SHESR       IVDFAEMAGAELVIIDADTKIREFKNELRQNSVYYGLARGL-
ARAA_SHESM       IVDFAEMAGAELVIIDADTKIREFKNELRQNSVYYGLARGL-
ARAA_SHESW       IVDFAEMAGAELVIIDADTQIRQFKNELRQNSVYYGLARGL-
ARAA_SACD2       LNDFAEMAGVEMVVIGADTNVNEFKKELRFNAVYYHLSHGI-
ARAA_VIBPA       LADYAEILGIEMVVIDNSTNLRQFKQELRNNGVYYRLG----
ARAA_GRAFK       LEDFADIAGIELLVIDDNTSVRQFKDTLNANEAYYHLFQHGM
ARAA_KORVE       LQDYAEMAGIECVLIDNDTTVHACKNELRWNDAYYRLTGWR-
ARAA_THEMA       LIDWAEALEIEYVVIDENLDLEDFKKELRWNELYWGLLKR--
ARAA_BACTN       WEDYAEIAGIEMVHINKDTTISCFKKELRMNEVYYMLNKALC
ARAA_BACV8       WEDYAEIAGIEMIRIDKDTTISNFKKELRMNEVYYMLNKALC
ARAA_BIFAA       WEDFARIAGVELAVIDENTNARQFEKELELSEMYHRLNNRH-
ARAA_BIFLO       WEDFARIAGVELAVIDENTTARQFEKELELSEMYHRLNNQH-
                     :         :