CLUSTAL format seed alignment for MF_00523

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LPXD1_KORVE      ---------------------MKLSEIARRLG--------CTLDNCPDPDAVEITAVTGI
LPXD2_GLOVI      ---------------------MKLSDISAKLG--------CALEGD---GQVDIVGIAGI
LPXD_THEEB       ---------------------MRLADVAERFG--------ATLDCP-EHGDRPVLGVAPL
LPXD_TRIV2       ---------------------MKFSDIISKL------EVTNYSLTQNPNNDPEITGMAAI
LPXD_NOSS1       ---------------------MKFSDIISKL------EVTNHSLTQNPNNDPEITGMAAI
LPXD_TRIEI       ---------------------MKFSKLASKLGS----ETITCSLEKINHLDPDIQGVAAI
LPXD_SYNP6       ---------------------MRWSEFLQHLEA----KTGPCTAKAIAG-DPELHGVAAI
LPXD_SYNE7       ---------------------MRWSEFLQHLEA----KTGPCTAKAIAG-DPELHGVAAI
LPXD_SYNY3       ---------------------MEFSQLVERLQT----HIQCHSLEKFGDRNPTLGGVAAL
LPXD3_GLOVI      ---------------------MKLGELAAHL---------GCPVE--GNPDVEIRGLASI
LPXD_SYNJA       ---------------------MQLQEIAQKL---------GCPYE--GDPTLEIHGVASL
LPXD_SYNJB       ---------------------MQLQEIAQKL---------GCAYE--GDPTLEIHSVASL
LPXD_PROM9       ---------------------MLLSDLVDLIK-----KGNSNFISSNIFEDLNIEDAASL
LPXD_PROMP       ---------------------MLLSKLVDLIK-----SGESKFIKANIFENIDIENAASI
LPXD_PROMA       ---------------------MEFSKLIEILN-----NGDSGLIDHNLSSNPEINSAASL
LPXD_PROMT       ---------------------MQFIEIVEKLK-----KGQSGVVDFKIKNNPVILTAASL
LPXD_SYNPX       ---------------------MRFSSLIKALQ-----AGESGLRWSQLGQDPDLSGAAAL
LPXD_SYNSC       ---------------------MRFSTLIKVLQ-----TGDAGLRWSQAGLDPWLEGAASL
LPXD_SYNS9       ---------------------MRFSTLLKDLQ-----TGEAELRWSQCGADPILAGAASL
LPXD_PROMM       ---------------------MRFSQLIASLQ-----QGSAGLQDHQLAEDPELLSGASL
LPXD_DESAG       ---------------------MKVSDIAGALG-----------LKLKGP-DREISGVNTL
LPXD_DESVH       -------------------MVRRLSEIAGLLG-----------LELRGE-DREVSGVNTL
LPXD_LAWIP       ------------------MPQYKLSEIAKLLN-----------LTLQGD-DIEVVGVNTL
LPXD_NITOC       -------------------MEIRLSEIAQFLG-----------CAIEGDGEAPIRGIAPL
LPXD_ANADE       ------------------MASYTLAELAARVG-----------GQVDGDGKLRLEGIAPL
LPXD_MYXXD       -------------------MPRQLGELAAHVG-----------GELLGDPSQLIHGLNGL
LPXD_SYNAS       -------------------MKKSINEIADFLG-----------GKVVGDGGILIKAVRGI
LPXD_GEOMG       -----------------MAVSRTLRELAEYLG-----------GTVAGDESKTISGVASL
LPXD_GEOSL       -----------------MAVSKTLQELADYLG-----------GTLVGDGSRQIVGVASL
LPXD_PELCD       --------------------MATLNELAELIG-----------GEVVGDGSVVLNRMAPI
LPXD1_GLOVI      -----------------MGVQFSAAELTDLVG-----------GELSGDPGRLVVGARPP
LPXD_DESPS       -----------------MKENITVAMLAELVD-----------GEVIGDGEVLVGNFVSL
LPXD_PSE14       ----MSITIKLGQ---------LAEFLGATLR--------GDKDKD-------ITGLAAL
LPXD_PSESM       ----MSITIKLGQ---------LAEFLGATLR--------GDKDKD-------ITGLATL
LPXD_PSEU2       ----MSITIKLGQ---------LAEFLGATLR--------GDKDIE-------ITGLATL
LPXD_PSEF5       ----MTATIKLGQ---------LAEFLGATLS--------GDGEKE-------ITGLATL
LPXD_PSEPF       ----MTVTIKLGQ---------LAEFLGATLS--------GDPEKQ-------ITGLATL
LPXD_PSEPK       ----MSVTMTLGQ---------LAEVLGATLK--------GPEALQ-------ITGLATL
LPXD_PSEAE       --MMSTLSYTLGQ---------LAAHVGAEVR--------GDADLP-------IQGLATL
LPXD_HAHCH       -MGKTDLSYTLAD---------IAFRIGAELR--------GDGSVE-------VKGLATL
LPXD_CHRSD       MKTLTPCAFTLGE---------LAERLKARLV--------GDSDRR-------VTGLATL
LPXD_ALCBS       -------MLTLGE---------LAKKLDAELI--------GEASHV-------VDGLGTI
LPXD_XANC5       ------MRLTASA---------IAEQFGLTVV--------GDGTTE-------VSGVATL
LPXD_XANAC       ------MRLTASA---------IAEQFGLTVV--------GDGTTE-------VSGVATL
LPXD_XANOM       ------MRLTASA---------IAGQFGLTVL--------GDGSTE-------VSGVATL
LPXD_XANOR       ------MRLTASA---------IAGQFGLTVL--------GDGSTE-------VSGVATL
LPXD_XANC8       ------MRLTASE---------IAAQFGLTVV--------GDGATE-------VSGVATL
LPXD_XANCP       ------MRLTASE---------IAAQFGLTVV--------GDGATE-------VSGVATL
LPXD_XYLFA       -----MPIFTAQE---------LAERFNLQLF--------GDGNLR-------IHGVATL
LPXD_XYLFT       -----MPIFTAQE---------LAERFNLQLF--------GDGNIR-------IHGVATL
LPXD_BLOPB       -----MIEMRLSD---------LAQQLNAKL--------HGDENII-------ITGVASI
LPXD_BLOFL       ----MAVKISLVD---------LAQNIGAEL--------HGDKNIL-------ITHVSSI
LPXD_ECOL5       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SHIBS       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SHISS       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_ECOL6       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_ECO57       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SHIFL       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SHIDS       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_ECOLI       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_ECOUT       -----MPSIRLAD---------LAQQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SALTI       -----MPSIRLAD---------LAEQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SALTY       -----MPSIRLAD---------LAEQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SALPA       -----MPSIRLAD---------LAEQLDAEL--------HGDGDIV-------ITGVASM
LPXD_SALCH       -----MPSIRLAD---------LAEQLDAEL--------HGDGDIV-------ITGVASM
LPXD_PECAS       -----MYSIRLDA---------LAQQLDAQL--------HGDGDIV-------ITGVASM
LPXD_SODGM       -----MSSIRLAD---------LAQQLDAQL--------HGDGDIV-------ITGIASM
LPXD_YERPA       -----MPSIRLAD---------LAQQLDAQV--------HGDGDLV-------ITGIASM
LPXD_YERPN       -----MPSIRLAD---------LAQQLDAQV--------HGDGDLV-------ITGIASM
LPXD_YERPE       -----MPSIRLAD---------LAQQLDAQV--------HGDGDLV-------ITGIASM
LPXD_YERPS       -----MPSIRLAD---------LAQQLDAQV--------HGDGDLV-------ITGIASM
LPXD_YEREN       -----MPSIRLAD---------LAQQLDAQV--------HGDGDLV-------ITGIASM
LPXD_PHOLL       -----MSSIRLAD---------LAQQLNAQL--------HGDGDIV-------ITSIAPM
LPXD_WIGBR       -----MLEIKLSD---------VSKIISAKL--------YGDKNFI-------IKGISSI
LPXD_HAEI8       ----MQKSYSLQE---------LATQIGATV--------RGNADVV-------VENIAPL
LPXD_HAEIN       ----MQKSYSLQE---------LATQIGATV--------RGNTDVV-------VENIAPL
LPXD_PASMU       -----MQVYSLQE---------LAQQIGATI--------RGNADVV-------VESIAPL
LPXD_HAES1       -----MQGYSLLE---------LAQQIGATI--------RGNADVI-------VTDIAPL
LPXD_MANSM       -----MSVYSLKE---------LAEHIGATS--------RGNTDVV-------VDSIAPL
LPXD_HAEDU       -----MAVFRLSE---------LAEQIGATL--------KGNADLA-------ITSIAAL
LPXD_ALIF1       -----MSRITLAE---------LAEKLDATV--------HGDGTVV-------VHSIASM
LPXD_PHOPR       -----MARITLAE---------IADKLGAEL--------RGDGSVE-------IQSIAGM
LPXD_VIBVU       -----MMTLTLAE---------LAKITGGEL--------HGDETVC-------VSRVAPM
LPXD_VIBVY       -----MMTLTLAE---------LAKITGGEL--------HGDETVC-------VSRVAPM
LPXD_VIBPA       -----MKKLTLAE---------LATITGGEL--------FGDESLV-------VGRVAPM
LPXD_VIBCH       -----MTTLTLAE---------LATITGGEL--------FGDPTAL-------VSAVAPM
LPXD_COLP3       ------MTYTLAE---------IAIKLDAKLIVPAALDEQNEALTQ-------ISGLATL
LPXD_PSEA6       ----MNQTVSLQQ---------LADKIGASL----HLTDGDSGETQ-------IHSLSTL
LPXD_PSET1       -----MQNYTLSQ---------IAELLSAEL--------QGDGALE-------ITKIATL
LPXD_IDILO       -----MSEYTLQQ---------LADHVGGEV--------RGNSQLP-------ILRVATL
LPXD_SHESM       -----MKSVTLKE---------LSLLLDGVV--------QGDETLV-------INSVATL
LPXD_SHESR       -----MKSVTLKE---------LSLLLDGVV--------QGDETLV-------INSVATL
LPXD_SHEON       -----MKSVTLKE---------LSLLLDGVV--------QGDETLV-------INSVATL
LPXD_SHEFN       ------MKVTLKE---------LSQLLGATI--------KGDATLE-------ITSVATL
LPXD_SHEDO       ------MKMTLKE---------LGEMLGARV--------QGNELLT-------ISSVGTL
LPXD_SACD2       ---MSNCKFTLAQ---------LADHLDAQM--------VGDANYT-------VECIAPL
LPXD_ALKEH       ----MTETVTVSE---------LAEGLGAELV--------GKPTRV-------IRRVATL
LPXD_AROAE       -------MFRLDE---------LVERLGGELLG--------DPATA-------VRRVATL
LPXD_DECAR       MASLGKVVLTLAD---------IAAQLGGDVLG--------DSQTP-------ISRVAPL
LPXD_METFK       ----MNKSYSLRE---------IVSTLGGELLG--------KDDVL-------ISRVASL
LPXD_THIDA       ------MAVTLAA---------LVERFGGELVG--------DSARS-------VRQVAPL
LPXD_BORBR       ------MPVLLDPENALALDVLLAGTDAQGLDW--------HLSAPDAADLPRIRGIGTL
LPXD_BORPA       ------MPVLLDPENALALDVLLAGTDAQGLDW--------HLSAPDAADLPRIRGIGTL
LPXD_BORPE       ------MPVLLDPENALALDVLLAGIDAQGLDW--------HLSAPDAADLPRIRGIGTL
LPXD_BORA1       ------MPVLLDSSRAPRLDALLSKGNTQGLEC--------QIDSP-TGDLPLIAGIGTL
LPXD_POLSJ       ------MTLRLAD-----IVQSLAPTVQAELVG--------NPDVQ-------IERLSTL
LPXD_RHOFT       ------MTLLLGS-----IVELLG----GDLQG--------DASLK-------IEGLAPL
LPXD_BURCA       ------MALTLEE---------LVKRFGGEIAG--------DAQCK-------VGGLAPL
LPXD_BURL3       ------MALTLEE---------LVKRFGGEIAG--------DAQCK-------VGGLAPL
LPXD_BURP1       ------MALTLEA---------LAARFGGEIVG--------DGRCE-------VRALAPL
LPXD_BURPS       ------MALTLEA---------LAARFGGEIVG--------DGRCE-------VGALAPL
LPXD_BURMA       ------MALTLEA---------LAARFGGEIVG--------DGRCE-------VGALAPL
LPXD_BURTA       ------MALTLEA---------LVARFGGEIVG--------DGRRE-------VGGLAPL
LPXD_PARXL       ------MAFTLED---------IVQRFGGEVVG--------NGSQR-------VGSLAPL
LPXD_CUPPJ       -----MQTPTLGQ---------LATENGAQVVG--------DPDLA-------IIGLAPL
LPXD_CUPMC       -----MKTPTLGQ---------LATENGAQVVG--------DPDLA-------VVGLAPL
LPXD_RALSO       ------MSFSLDE---------LAASLGATVQG--------DAGLI-------VKSIAPL
LPXD2_FRAT1      -------MYSLDF---------LASKLDGEVK--------GDKNVE-------IKKIATL
LPXD2_FRATH      -------MYSLDF---------LASKLDGEVK--------GDKNVE-------IKKIATL
LPXD2_FRATO      -------MYSLDF---------LASKLDGEVK--------GDKNVE-------IKKIATL
LPXD2_FRATT      -------MYSLDF---------LASKLDGEVK--------GDKNVE-------IKKIATL
LPXD_COXBU       --MTRGLTYSLTE---------LATAIGATVQ--------GDGDCK-------IHNVAAI
LPXD_NEIG1       ---MIPATCTLSQ---------ITARLGGEWR---------GEDIS-------VTAVRPL
LPXD_NEIMA       ---MIPATYTLSQ---------ITARLGGEWR---------GEDTS-------VTAVRPL
LPXD_NEIMB       ---MIPATYTLSQ---------ITARLGGEWR---------GEDIS-------VTAVRPL
LPXD_CHRVO       ------MSYTLEH---------IVKQLGGALR---------GPNRE-------VSRLAPL
LPXD_PSYA2       MITIEQLISQIEQR--------QPVLNKAELN---------AEQRR-----LSLKGIGNL
LPXD_PSYCK       MITIEQLISQIEQR--------QPVLNKAELS---------AEQRR-----LSLEGIGNL
LPXD_ACIAD       MNIPHYSLETLAH------------LVQGELF---------GDEH------FNLSGLASL
LPXD_HYDCU       ----MKLKNIVNYL--------KEVGIDVELK---------GDDS------INVDQVSGL
LPXD_BACFN       ------MEFSAKQ---------IAAFIQG--------EIIGDENAT-------VHTFAKI
LPXD_BACFR       ------MEFSAKQ---------IAAFIQG--------EIIGDENAT-------VHTFAKI
LPXD_BACTN       ------MEFSAKQ---------IAAFIQG--------EIIGDENAT-------VHTFAKI
LPXD_PORGI       ------MEFTAQQ---------IADYLHG--------SVEGNPKVR-------LHDFAKI
LPXD_CYTH3       ------MEFTLEE---------IAHLLGG--------EVKGDGKAK-------VSSIAKI
LPXD_CHLCH       -------MMTIQE---------IYEYLSRFFTPV---ELIGNGEEL-------IHAPAKI
LPXD_PELLD       --------MTIQE---------IRQYLTQFFDPV---ELVGEGDAV-------IAGPAKI
LPXD_CHLTE       --------MKIAD---------IKAFLGRYFDPV---ELVGTGDIE-------IVGPAKI
LPXD2_KORVE      ----------------------MSATLQKLAEL--------TGSSLIGDSTLTICSVANL
LPXD_METCA       ------------------MHVTVSEILERFQPE--------GLITNHIGPDSVITRVAPI
LPXD_CHLAB       ------------------MPQELVYTLQQLADL--------LKVEVQGNTETPISGVEEI
LPXD_CHLFF       ------------------MPQELVYTLQQLADL--------LKVEVQGNTETPISGVEEI
LPXD_CHLCV       ------------------MPQKLVYTLQELADL--------LKVEVQGNTETPISGVEEI
LPXD_CHLPN       ------------------MSEAPVYTLKQLAEL--------LQVEVQGNIETPISGVEDI
LPXD_CHLTA       -------------------MSQSTYSLEQLADF--------LKVEFQGNGATLLSGVEEI
LPXD_CHLTR       -------------------MSQSTYSLEQLADF--------LKVEFQGNGATLLSGVEEI
LPXD_CHLMU       -------------------MSQPVYSLKQLADF--------LNVEFQGNGATLLSGVEEI
LPXD_PARUW       ------------------MNEKKHFTLQELALL--------TDCKLVGNPSQIIKSVADL
LPXD1_FRAT1      ------MQYTLKQ---------ISEHLNAKVIN--------EPSGE-----VIITGLTYA
LPXD1_FRATT      ------MQYTLKQ---------ISEHLNAKVIN--------EPSGE-----VIITGLTYA
LPXD1_FRATH      ------MQYTLKQ---------ISEHLNAKVIN--------EPSGE-----VIITGLNYA
LPXD1_FRATO      ------MQYTLKQ---------ISEHLNAKVIN--------EPSGE-----VIITGLNYA
LPXD_FUSNN       ------MEYRVTD---------IITLLNAEYKG--------EVV-------EKVSKLSPF
LPXD_AQUAE       ------METTLGE---------IARIIKGELKG--------NHN-------IKIKGISTP
LPXD1_LEGPA      ------MNSSLRD---------IANLVQGMVIG--------NDA-------ITVSTLSPI
LPXD1_LEGPH      ------MNSSLRD---------IANLVQGMVIG--------NDA-------ITVSTLSPI
LPXD1_LEGPL      ------MNSSLRD---------IANLVQGMVIG--------NDA-------ITVSTLSPI
LPXD_RHOBA       --MASSNGLSLQE---------IADLVGGQLLD--------FSD-------CINDETNSS
LPXD_CAMJR       ---------------------------MKLSEIAEF------LSLEYKGEDIEISALNSL
LPXD_CAMJE       ---------------------------MKLSEIAEF------LSLEYKGEDIEISALNSL
LPXD1_SULDN      ---------------------------MNLKDIAKI------INSDFSGEYFEITKMNTL
LPXD2_SULDN      ---------------------------MLLSSIAQH------LKLPFFGEDLELDSMNEL
LPXD_HELPH       ---------------------------MKLSELLST-----YSIETEFSNDFEVHALAEL
LPXD_HELPY       ---------------------------MKLSELLNA-----YSIETEFSNDFEVHALAEL
LPXD_HELPJ       ---------------------------MKLSELLSA-----YSIETEFSNDFEVHALAEL
LPXD_HELHP       ---------------------------MLLSLAIDTAFKGYLSLQNTIENDFELNGIAPL
LPXD_WOLSU       ---------------------------MKLSLIAQF------LELPLPSIEKEIVGISSL
LPXD_GRABC       -----------MSVQEVVGDPRFFARSGPYDVAAVAEAVGASIPADCT-L--SLTGVAPL
LPXD_MAGSA       -----------------MADPRFFRVAGPFTLAQLAELSGASVAEGCD-LGASFVDVAPL
LPXD_CHESB       -----------------MTEPAFFAPARRFEVGEIAALTGARLRDASQ-EKITISRLAPA
LPXD_RHILO       -----------------MTDPVFFAPSRRYTAAEVANLTGSVLVDSGQ-SDVSIEALAPA
LPXD_BARHE       -----------------MADTFFFTPSRRLTVANVAELTGAKLLNPEF-SNTVINTLSSL
LPXD_BARQU       -----------------MADTFFFTPSRRLTVANVAELTGAKLLNPEF-SNIVISTLSSL
LPXD_BRUAB       -----------------MADPIFFKPSRELTIGDVADFTGASLRDPKL-APRSVERLASL
LPXD_BRUA2       -----------------MADPIFFKPSRELTIGDVADFTGASLRDPKL-APRSVERLASL
LPXD_BRUME       -----------------MADPIFFKPSRELTIGDVADFTGASLRDPKL-APRSVERLASL
LPXD_BRUSU       -----------------MADPIFFKPSRELTIGDVADFTGASLRDPKL-APRSVERLASL
LPXD_NITHX       -----------------MTQPAFFKQPPPLTLVEIAASTGAQLIDASR-GEQRITGLASL
LPXD1_NITWN      -----------------MTQPAFFKRPLPSTLAEIAASTGAQLVDASR-GGIRIIGLASL
LPXD_BRADU       -----------------MAQPTFFTKPPATALADIATLTKALLVDPTR-GDHVITGLASL
LPXD_RHOP2       -----------------MTSTLFFKPRPSSTLAEIAALTKAELVDPSQ-GDRVISGIASL
LPXD_RHOPS       -----------------MTSTLFFKPRPSSTLAEIAALTKAELIDPSQ-GDRVITGIASL
LPXD1_RHOPB      -----------------MAQPSFFKQGPSSTLAEIAALTKAELVDASR-ADHRITGVASL
LPXD_RHOPA       -----------------MASTSFFPPRPSSTLAEIASLTKATLVDASY-AEHRITGLASL
LPXD2_RHOPB      -----------------MSESGFFLDAVGLSVGDIVALTGATPRDGAD-LSRAISDLAPL
LPXD2_NITWN      -----------------MSGETFFLSNHSVAASQIAALAGLSFVT----EDFAISAAGAL
LPXD_RHIEC       -----------------MEQNVFFLPHEGLKLAELAEFLGAELANSDH-SDVIVRSVAPI
LPXD_RHIL3       -----------------MEQNVFFLPHEGLKLAELAEFLGAELVNSDY-ADVIVRSVAPI
LPXD_AGRFC       -----------------MEYNAFFPPHEGLRLKDIADLFGAELSDDAA-GERIIRSVAPV
LPXD_RHIME       -----------------MEQNWFFPPHQGIRLGDLANQIGAELLDISA-ADRTVRAVAPV
LPXD_HYPNA       ----------------MTVDSRFYAPLGALTLEEIAGRTGSNLAGKP---NQVISGIASA
LPXD_CAUVC       -----------------MPDPRFFDSLGPALLSELAQAGAATLADAAL-GERVITHAAPL
LPXD_MARMM       -----------------MADPRFYDRLGPLTLKDIAALSGAAISDSGT-ADQSVDRVTPL
LPXD2_LEGPH      -----------------MSNYQFTKPAGPFRLFELAKISGATLYEGKG-ETFTVSGLAKL
LPXD2_LEGPL      -----------------MSNYQFTKPAGPFYLAELAEISGSTLYEGKG-EAFTVSGLAKL
LPXD2_LEGPA      -----------------MSNYQFTKPAGPFRLSELAKISGATLYEGKG-ETFTVSGLAKL
LPXD_RICCN       -----------------MVSSNFYKNLGPRKLTAIIDFLHDIIAPPKIHEDIAIHDIKIL
LPXD_RICRI       -----------------MVSSNFYKNLGPRKLTAIIDFLHDIIAPPKI-EDIAIHDIKIL
LPXD_RICFE       -----------------MVSSNFYKNLGPRKLTAIIDFLHDIIEPPKIHEDIAIHDIKIL
LPXD_RICPR       -----------------MVSSNFYKNLGPRKLTAIVDFLHDIIEPTKIYEDIDIYDIKIL
LPXD_RICTY       -----------------MVSSNFYKNLGPRKLTAIIDFLHDIIEPTKIHEDIDIHDIKIL
LPXD_RICBR       -----------------MVNSNFYRNLGPRKLMAIADFLQDFIEAPKIHEDVAIHDIKIL
                                                                             

LPXD1_KORVE      EAAGPT------------------------DITFVSNPR---YAAAAKTTHAGAIIVSDD
LPXD2_GLOVI      EEAEAG------------------------HLTFLSNPK---YKAKLRHTKASAAIVPAD
LPXD_THEEB       ETATAT------------------------DISFLANPK---YTALLQTTQAAAVFVRPD
LPXD_TRIV2       DEATSG------------------------TLSYIEG-A--KFASFIAKTNASALILPQN
LPXD_NOSS1       DEATSA------------------------NLSYIEG-A--KFASFIAQTNASALILPQN
LPXD_TRIEI       DEAKPG------------------------TLSYIEG-A--KFANYLKTTNASALILPMD
LPXD_SYNP6       NEAQSG------------------------QVSFLDQES--GLQDWIEQTAASALILPPD
LPXD_SYNE7       NEAQSG------------------------QVSFLDQES--GLQDWIEQTAASALILPPD
LPXD_SYNY3       TEALTG------------------------QISYVDS-A--KYAPQMKTTQASALILPPD
LPXD3_GLOVI      QQAGPG------------------------ELSFIES-E--KYARFIKLTRAEALIL---
LPXD_SYNJA       AEARPG------------------------ELSFLSE-A--RYLPLLEQTQASAVIVE--
LPXD_SYNJB       AEARPG------------------------ELSFLSE-A--RYLPLLEQTQASAVIVE--
LPXD_PROM9       DEAVNH------------------------QISFLEENN--ILKEKLDKSNASAIIT-SN
LPXD_PROMP       DIALKN------------------------QISFLEENN--ILKDNLGKTSASAIIT-SN
LPXD_PROMA       EKAEVN------------------------QISFIENAS--YLFNEINQTKASALIL-GE
LPXD_PROMT       ENAKDN------------------------DISFLDNNSPLNLRNLIETSKASALLLPAN
LPXD_SYNPX       DQALGD------------------------QLSFLEAGN--VLSASLSDSAVGALLL-PD
LPXD_SYNSC       DQASAA------------------------QLSFLEKGN--ALTAALGASGVGALLL-PD
LPXD_SYNS9       EQAKGD------------------------QLSFLEKGN--ALIAALTETGAGALLL-PD
LPXD_PROMM       DQAKAN------------------------QLSFLEQGN--ALTTQLSHSKVGAVLI-PP
LPXD_DESAG       EAAGPE------------------------EISFLANPK---YIPMLAGTRAAAVIVSEE
LPXD_DESVH       EAAGPD------------------------EISFLANPR---YMGQLSTTRAGAVIVAAE
LPXD_LAWIP       QDASPN------------------------EISFLANAK---YIHQLVLSQAGAIILSKE
LPXD_NITOC       HQAQAS------------------------ELSFYTNRK---YAAQARLSKAGAIIVGAK
LPXD_ANADE       EEATAA------------------------EISFFSNRK---YRKAFEASRAGAVVVEPG
LPXD_MYXXD       EEAGPG------------------------DVSFYGNPR---YRRQFEATRASAVLVGAD
LPXD_SYNAS       DEAGPG------------------------DITFVANPQ---YEKKLNETGASAVLVTRD
LPXD_GEOMG       DDAADH------------------------QITFLANPR---YAPKVATTGAGAVVLPPG
LPXD_GEOSL       DDATDS------------------------QITFLANPR---YAPKVASTRAGAVILPPG
LPXD_PELCD       ESAGPG------------------------DITFVANPK---YLAKLKDTTASAVIVKAG
LPXD1_GLOVI      EEAEGG------------------------DLTFALDLH---ARKLIETTRAGVAITPVR
LPXD_DESPS       ETAGEG------------------------DITFLVKAG---DQDLLTSTKAGAVIVHRK
LPXD_PSE14       QEAGPG------------------------QISFLAKSQ---YRKFLVDAQAAAVLLKPA
LPXD_PSESM       EEAGPG------------------------QISFLAKPQ---YRKYLVDTQAAAVLLKPA
LPXD_PSEU2       QEAGPG------------------------QVSFLANPK---YRKLLVDTQATAVLLKPA
LPXD_PSEF5       QEAGPA------------------------QLSFLANPQ---YRKYLVDCQAGAVLLKAA
LPXD_PSEPF       QEAGPA------------------------QLSFLANPQ---YRKYLAGTQAAALLLKAA
LPXD_PSEPK       QEAGPT------------------------QLSFLANPQ---YRKYLDNSQAGAVLLKAA
LPXD_PSEAE       QEAGPA------------------------QLSFLANPQ---YRKYLPESRAGAVLLTAA
LPXD_HAHCH       QKAQAG------------------------QISFLANKN---YLKHLKDTCASAVIIPSS
LPXD_CHRSD       LDAGPN------------------------DITFLANKT---YLKYLPDTRAAAVLVHPA
LPXD_ALCBS       QSAGPS------------------------QLTFLANPR---YRSFLEQTNAGAVLIPES
LPXD_XANC5       AHAGAG------------------------QLSFLSNPR---YRPQLADTQAAVVVLRAD
LPXD_XANAC       AHAGAG------------------------QLSFLSNPR---YRPQLADTQAAVVVLRAD
LPXD_XANOM       AHAGAG------------------------QLSFLSNPR---YRPQLADSQAAVVVLRAD
LPXD_XANOR       AHAGAG------------------------QLSFLSNPR---YRPQLADSQAAVVVLRAD
LPXD_XANC8       AHAGTG------------------------QLSFLANPR---YRPQLAETQASVVILRAD
LPXD_XANCP       AHAGTG------------------------QLSFLANPR---YRPQLAETQASVVILRAD
LPXD_XYLFA       TQASPE------------------------QLSFLANPR---YLTQLLNSRAGVIVLHAD
LPXD_XYLFT       TQASPE------------------------QLSFLANPR---YLTQLPNSRAGVIVLHAD
LPXD_BLOPB       NNAQVG------------------------HITFLKDQR---FLSQLSSCRASAVILSKN
LPXD_BLOFL       KNAQVG------------------------HITFLKNSR---FREQLKSCAASAVILSQD
LPXD_ECOL5       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SHIBS       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SHISS       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_ECOL6       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_ECO57       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SHIFL       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SHIDS       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_ECOLI       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_ECOUT       QSAQTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SALTI       QSATTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SALTY       QSATTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SALPA       QSATTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_SALCH       QSATTG------------------------HITFMVNPK---YREHLGLCQASAVVMTQD
LPXD_PECAS       HSAKTG------------------------QITFLSDSR---YREQLAETQASAVVLTEA
LPXD_SODGM       GSAQAG------------------------QITFLSDSR---FREKLSSCQASAVVLTAD
LPXD_YERPA       HSAQPE------------------------QITFLSNSR---YREQLASCNAGAVVLTEA
LPXD_YERPN       HSAQPE------------------------QITFLSNSR---YREQLASCNAGAVVLTEA
LPXD_YERPE       HSAQPE------------------------QITFLSNSR---YREQLASCNAGAVVLTEA
LPXD_YERPS       HSAQPE------------------------QITFLSNSR---YREQLASCNAGAVVLTEA
LPXD_YEREN       HSAEPS------------------------QITFLSNSR---YQEQLATCNAGAVVLTEA
LPXD_PHOLL       HSANGE------------------------QITFLSDSR---YRERLGECQAAAVVLQAS
LPXD_WIGBR       EDSKPG------------------------YISFIYKNK---FRKYLPSCKASAIILAKD
LPXD_HAEI8       DKAQSN------------------------QLTFISNVK---FRALLKDSKAGILVVSEE
LPXD_HAEIN       DKAQSN------------------------QLTFISNVK---FRVLLKDSKAGILIVSEE
LPXD_PASMU       DKATEK------------------------QLTFISNPK---FRSLLAQSHAGILVVSEA
LPXD_HAES1       DKADNN------------------------QLTFISNPK---FREHLLQSQAGALIVTES
LPXD_MANSM       DKAQAN------------------------QLTFISNAK---FRPFLAQSQAGILVVSEA
LPXD_HAEDU       NNAEPT------------------------HITFISNAK---YRSQLSQSKAGAIIVTAE
LPXD_ALIF1       SKAKEG------------------------DITFLSDAK---YRKHLVECQASAVIVKEA
LPXD_PHOPR       EKAAEG------------------------QITFLSASK---YRKHLAECQASAVMLKEA
LPXD_VIBVU       DKAGEG------------------------DVTFLSNPK---YAVHLAECKATVVMLKAE
LPXD_VIBVY       DKAGEG------------------------DVTFLSNPK---YAVHLAECKATVVMLKAE
LPXD_VIBPA       DKAQEG------------------------DVTFLSNPK---YAKHLSECKATVVMVKAE
LPXD_VIBCH       DKAQLG------------------------HVTFLSNPK---YSKHLGDCKATVIMVKTS
LPXD_COLP3       AKAGTG------------------------QVAFLANSK---YQQQLSSTNASAVIVSPD
LPXD_PSEA6       ASAGNG------------------------QISFLSNSR---YRSQLEKTAAQAVILKSE
LPXD_PSET1       AHARSG------------------------HIAFLANKK---YRSQLEVTQASAVIVSEA
LPXD_IDILO       QSATGD------------------------AIAFLANSR---YKSQLETTSAGAVIVSEK
LPXD_SHESM       EHATAG------------------------QISFLANSK---YRAQLELTQASAVLLSAK
LPXD_SHESR       EHATAG------------------------QISFLANSK---YRAQLESTQASAVLLSAK
LPXD_SHEON       EHATSG------------------------QISFLANSK---YRAQLESTQASAVLLSAK
LPXD_SHEFN       EDATQG------------------------QLSFLANSK---YRAQLEATQASAVLLSEK
LPXD_SHEDO       ESAQTD------------------------QLSFLANSK---YRSQLESTQAGAVLLSEK
LPXD_SACD2       ESAGKN------------------------ALSFLANSK---YEKALATSQAGIMLLAQD
LPXD_ALKEH       CDAGPD------------------------AIGFCSNAN---YLEDLRATGAGAVIVRAE
LPXD_AROAE       EQAGEG------------------------DLAFLANPK---YQSRLAACGASAVILAPA
LPXD_DECAR       ATAGEG------------------------DITFLANPK---FRSQLSACKASAVILRPD
LPXD_METFK       ANAQPG------------------------QISFLTDSK---YRSVLATTNASAVILTPQ
LPXD_THIDA       DRACAD------------------------DIGFVSQSK---YLAELATTGAGAVILPPD
LPXD_BORBR       SSAGSE------------------------EISFLSNPR---YQNQLATTRAAAVIVTPD
LPXD_BORPA       SSAGNE------------------------EISFLSNPR---YQNQLATTRAAAVIVTPD
LPXD_BORPE       SSAGNE------------------------EISFLSNPR---YQNQLATTRAAAVIVTPD
LPXD_BORA1       ASAGAQ------------------------EIAFLSNPR---YQSQVASTAAAAVIVTLD
LPXD_POLSJ       DAAGPH------------------------DLSFLSHPK---YLAKLAQSAAACVVVAPA
LPXD_RHOFT       ESATPQ------------------------QLSFLSHPK---YQNQLAASRAACVIVSPE
LPXD_BURCA       DQAGPQ------------------------QLAFLANPK---YLSQVESTRAGAVLIAPK
LPXD_BURL3       DQAGPQ------------------------QLAFLANPK---YLSQVESTRAGAVLIAPK
LPXD_BURP1       DQAGPR------------------------QLAFLANPK---YLAQVETTGAGAVLIAPG
LPXD_BURPS       DQAGPR------------------------QLAFLANPK---YLAQVETTGAGAVLIAPG
LPXD_BURMA       DQAGPR------------------------QLAFLANPK---YLAQVETTGAGAVLIAPG
LPXD_BURTA       DQAGPQ------------------------HLAFLANPK---YLAQVETTAAGAVLIAPR
LPXD_PARXL       DQAGPD------------------------QLAFLANPK---YLSQVETTRAGAVLINAE
LPXD_CUPPJ       DQAGSG------------------------ELSFLSNPL---YLAQALSSAAGAVIVSAA
LPXD_CUPMC       DQAGPG------------------------DLSFLSNPL---YLPQALASAAGAVIVSPA
LPXD_RALSO       DQAGAD------------------------QLAFLSNPL---YLNQAVTSGAGAIIVSPR
LPXD2_FRAT1      SQAGEG------------------------DISFCTNPK---YLKALSETKASAVLITEE
LPXD2_FRATH      SQAGEG------------------------DISFCTNPK---YLKALSETKASAVLITEE
LPXD2_FRATO      SQAGEG------------------------DISFCTNPK---YLKALSETKASAVLITEE
LPXD2_FRATT      SQAGEG------------------------DISFCTNPK---YLKALSETKASAVLITEE
LPXD_COXBU       AQAQPG------------------------EISFVTDRK---YRKYLTQTKASAILLDEK
LPXD_NEIG1       ADAQAE------------------------HISFLANPK---YKAEVHDSSAGAIIVSAK
LPXD_NEIMA       ADAQAE------------------------HISFLANPK---YKAEVHDSSAGAVIVSAK
LPXD_NEIMB       ADAQAE------------------------HISFLANPK---YKAEVHDSSAGAVIVSAK
LPXD_CHRVO       ELAGAG------------------------EIAFVASAK---FRRQMLESAADALIVTEA
LPXD_PSYA2       MMANRQ------------------------QLSFLANPH---YLSSLANTHAGAVLITAE
LPXD_PSYCK       TMANRQ------------------------QLSFLANPH---YLSSLANTDAGAVLITEE
LPXD_ACIAD       EQAQSH------------------------HISFVNGEK---YVEAAKQSKAGALIVTSA
LPXD_HYDCU       VEAQQN------------------------HISFLSDSK---RIHELETTSAGVVLIHPK
LPXD_BACFN       EEGIPG------------------------AISFLSNPK---YTPYIYETKASIVLVNKD
LPXD_BACFR       EEGIPG------------------------AISFLSNPK---YTPYIYETKASIVLVNKD
LPXD_BACTN       EEGMPG------------------------AISFLSNPK---YTPYIYETQSSIVLVNKD
LPXD_PORGI       EEGRSG------------------------CLSFLANAK---YEHYLYQTQSDAVLVNQD
LPXD_CYTH3       EEASSG------------------------SISFLSNPK---YESFIYSTNASAVIVKKD
LPXD_CHLCH       ESAQAG------------------------EVTFVANKK---YLRFLALTEASLVIVERS
LPXD_PELLD       ESAARG------------------------EVSFIANEK---YLRYLSLTSASLVIVHRS
LPXD_CHLTE       EEASTG------------------------HVSFVANEK---YYRYIAQTGASLVIVSQK
LPXD2_KORVE      NHATPR------------------------DLVFCEDEK---YLGDAFASPAAAIVVGEF
LPXD_METCA       EDCAPG------------------------DLVFIDKPK---YVGDVLQRKPAAVLTTPA
LPXD_CHLAB       SAAKAH------------------------HVTFLDNEK---YARFIKITEAGAIILSKA
LPXD_CHLFF       SEAQSH------------------------HVTFLDNEK---YSRFIKNTEAGAIILSKA
LPXD_CHLCV       SEAQAH------------------------HITFLDNEK---YSRFIKITEAGAIILSKA
LPXD_CHLPN       SQAQPH------------------------HIAFLDNEK---YSSFLKNTKAGAIILSRS
LPXD_CHLTA       EEAKTA------------------------HITFLDNEK---YAKHLKSSEAGAIIISRT
LPXD_CHLTR       EEAKTA------------------------HITFLDNEK---YAKHLKSSEAGAIIISRT
LPXD_CHLMU       GEAKAA------------------------HVTFLDNEK---YAKHLKSSEAGAIILSRT
LPXD_PARUW       ENASEE------------------------DASFFANNR---YLQSLKESQAGVVFVDLQ
LPXD1_FRAT1      EQAKEN------------------------DLTLIDKQE---HIKLWQNSKATAAIVSKK
LPXD1_FRATT      EQAKEN------------------------DLTLIDKQE---HIKLWQNSKATAAIVSKK
LPXD1_FRATH      EQAKEN------------------------DLTLIDKQE---HIKLWQNSKAAAAIVSKK
LPXD1_FRATO      EQAKEN------------------------DLTLIDKQE---HIKLWQNSKAAAAIVSKK
LPXD_FUSNN       FHSDEK------------------------SLTFAADEK---FLKNLSQTKAKVIIVPDI
LPXD_AQUAE       ENPKEN------------------------TVVFCRNME---EVEKAKEKASAVVTQEE-
LPXD1_LEGPA      DNILPG------------------------SLVFAEGED---NIKLAENSEAAAILIGQ-
LPXD1_LEGPH      DNILPG------------------------SLVFAEGED---NIKLAENSEAAAILIGQ-
LPXD1_LEGPL      DNILPG------------------------SLVFAEGED---NIKLAENSEAAAILIGQ-
LPXD_RHOBA       DGAVQGKSPSVEISSTICTGAAPPAEAGPQQITLIDQAN---HAGQLADSQAFAVIAPE-
LPXD_CAMJR       LKANFT------------------------ELTYCDGE---KNTKDIPHTGAAAILVSKE
LPXD_CAMJE       LKANFT------------------------ELTYCDGE---KNTKDIPHTGAAAILVSKE
LPXD1_SULDN      RDATKS------------------------EISFVANA---KYIKEIQNSNAGAIIVSKD
LPXD2_SULDN      ALSLPS------------------------QLTFAINK---KYSQELESSKSKAFLIIDT
LPXD_HELPH       DKATPN------------------------DISYIDQA---RYLKLLKDSKAGAVFIRKK
LPXD_HELPY       NKATPN------------------------DISYIDQA---RYLKLLKDSKAGAVFIRKK
LPXD_HELPJ       DKATPN------------------------DISYIDQV---CYLKLLKDSKAGAVFIRKK
LPXD_HELHP       ESATPT------------------------QISYIDQD---KYLSNLTDSQAGAVFIRPH
LPXD_WOLSU       EGATPD------------------------EISFVEQD---RYASSLKESRAGAVLIRAS
LPXD_GRABC       QIAGPS------------------------EVSFLDNR---RYADALEQTRAGAVIIKAD
LPXD_MAGSA       EQAGQD------------------------NVSFLDNR---KYVGAFQASKAGLCVIAPE
LPXD_CHESB       AEGGEE------------------------TLVFIDGR---RHASRIGSVRAAALLCSEE
LPXD_RHILO       SEGGAN------------------------ALVFVDGR---RNSALMPSLRAAAVLCPAE
LPXD_BARHE       ESAGKG------------------------SLVFVEHR---KFSDALVGSSAVAVFCTNE
LPXD_BARQU       EGAGEG------------------------SLVFVEHR---KFSDALLGSSAVAVFCTNE
LPXD_BRUAB       KDAGEG------------------------ALVFVEGK---KNVSSLVGLKAAGVLCTES
LPXD_BRUA2       KDAGEG------------------------ALVFVEGK---KNVSSLVGLKAAGVLCTES
LPXD_BRUME       KDAGEG------------------------ALVFVEGK---KNVSSLVGLKAAGVLCTES
LPXD_BRUSU       KDAGEG------------------------ALVFVEGK---KNVSSLVGLKAAGVLCTES
LPXD_NITHX       DQAGPM------------------------HLTFFDNH---KYAAQLAATRAGACFVSPR
LPXD1_NITWN      DQAGPM------------------------HLAFFDNH---KYAGQLAATKAGACLVSPR
LPXD_BRADU       DEAGPM------------------------HLAFFDNL---KYADQLKATRAGACLVSPR
LPXD_RHOP2       DEAGPM------------------------HLGFFENI---KYVAELEQTHAGACLVTQR
LPXD_RHOPS       DEAGPM------------------------HLGFFENL---NYVAELEQTCAGACLVTQR
LPXD1_RHOPB      DEAGPM------------------------HLGFFENI---KYAGQLAQTRAGAVLVSPR
LPXD_RHOPA       DEAGPM------------------------HLSFFENL---RYSDELANTRAGACLVSER
LPXD2_RHOPB      DRAGIA------------------------DLSFIAET---KYAGVLAATQAGAVLTTER
LPXD2_NITWN      ATAGIG------------------------EICYMDDT---KYIEELKVTRASACLISPR
LPXD_RHIEC       SRARAG------------------------DVCYILSR---RNREEFATCEASAVICDKA
LPXD_RHIL3       SRARAG------------------------DVCYILSR---RSRDELATCEASAVICDKA
LPXD_AGRFC       YRAKPD------------------------QLCYILSR---KSGEELLTCEAGAVICDAA
LPXD_RHIME       YRAKPG------------------------DICYMLSR---KNREELQTCRAAAIICDKA
LPXD_HYPNA       ANAKAA------------------------EIAFIEGD---GKRQPTISPSLAAVFVAAE
LPXD_CAUVC       DASDAQ------------------------AITFFSDA---KRKDAAASTRAGACFVRPE
LPXD_MARMM       GEPVAG------------------------ALSYAESGKLLRSAPDGALSGVAVICPPDA
LPXD2_LEGPH      SEATSN------------------------DLVMLHQK---KYVKELKHTAARVCIIGPD
LPXD2_LEGPL      SEATTH------------------------NLVMLHQK---KYLKELKNTAARACIIGPE
LPXD2_LEGPA      SEATSN------------------------DLVMLHQK---KYVKELKNTAARSCIIGPD
LPXD_RICCN       QEASPN------------------------DISFLSNP---KYSEFLKTTKAAACIVPKN
LPXD_RICRI       QEASPN------------------------DISFLSNP---KYSEFLKTTKAAACIVPKN
LPXD_RICFE       QEASPN------------------------DISFLSNP---KYSEFLKTTKAAACIVPKN
LPXD_RICPR       QEASPN------------------------DISFLSNP---KYSEFLKTTKAAACIVPKN
LPXD_RICTY       QEASPN------------------------DISFLSNP---KYSEFLKTTKAAACIVPKD
LPXD_RICBR       QEASSN------------------------DISFLSNI---KYSRFLKNTKAAACIVPKD
                                                                             

LPXD1_KORVE      ----FTAGRA-------PLVRSKNPYLTFAKAIE-LFYQAPKYAP------GIHPTAVIS
LPXD2_GLOVI      ----FEASAAWP----LPLLRHANPYLTFAHAIE-LFYSPPPAPH------GVHPTAVVA
LPXD_THEEB       ----FQGEAAC------PLLRVPHPYLAFAKCIE-WFYPQPKPVA------KIHPTAILG
LPXD_TRIV2       EA-MQAQAQERG----IVWMATPEPRLLFAKAIA-LFYQPYTPTP------EIHPTAVIH
LPXD_NOSS1       EA-MQAQAQARG----IVWMTTPEPRLLFAKAIA-LFYQPYTPTP------EIHPTAVIH
LPXD_TRIEI       ET-LQKLAGERG----IGWLSSKEPRLLFAQAIA-LFYRPFQPTP------EIHATSIVH
LPXD_SYNP6       PA-LQARAEARN----LPWMTTAQPRLAFAAAIA-VFYQPFRPVA------GIHPSAVID
LPXD_SYNE7       PA-LQARAEARN----LPWMTTAQPRLAFAAAIA-VFYQPFRPVA------GIHPSAVID
LPXD_SYNY3       AK-LQAEADAQG----IAWCATAQPRLLFAAAIA-VFYQPYRPPA------GIHATAVID
LPXD3_GLOVI      ----DWRTPVSK----VPCIRSEQPRLTFAHALE-LFYQPRRPAP------GIHPTAILG
LPXD_SYNJA       ----ESLVLPRP----IACLRGKDPRLLFAQAIE-LFYQPYRLPV------GIHPTAVID
LPXD_SYNJB       ----EGLALPCS----IACLRGRDPRLLFAQAIE-LFYQPYRLPV------GIHPTAVID
LPXD_PROM9       NNEIISALKKLN----ISNIIVKNPRIAFAEVLN-HLYKTINFNP------GIHASAVID
LPXD_PROMP       NNEILGLLESLN----ISNIVVENPRIAFAEVLN-FLYEEINFNP------GIDDSAVIK
LPXD_PROMA       KVDITEKLDLKN----IAWVTVKNPRIAFAEILE-EINPTKVFPE------SIHPSAVIG
LPXD_PROMT       DTYIIEIAKKIS----VDWIILKEPKIAFAETLE-FLYPSNVESE------GIHKSAVIG
LPXD_SYNPX       QQDLIDLASQRG----IAFAVVSDPRLAFAEALD-CLHPRQRPQA------DIHHTAVID
LPXD_SYNSC       QQDLIDLASQRG----IAFAVFADPRLAFAEALD-QLYPRRRPLA------EIHPSAVID
LPXD_SYNS9       QPDLIQCASERG----IAFAVLANPRLAFAEALE-RLHPRLRPLA------EIHPSAVVD
LPXD_PROMM       QDDLRVIAEQRG----LAFAVLRDPRLAFAEALE-QLHPRSRPKA------GVHPTAVIG
LPXD_DESAG       -----YAGQVE------TALISANPYFDFGRTLH-LFARPQGSFS------GISDMAYIH
LPXD_DESVH       -----HAQDVA------VALVSANPYFDFGRTLA-LFARKQGSFE------GVSEQAVVH
LPXD_LAWIP       -----YASRVP------RALISTEPYRDFGRVLS-LFSIPQGCFD------GISHQAYIH
LPXD_NITOC       -----DREQFAG----RRLLISDNPYRDFARVVDRWFNRSYRPAP------GVHPTAIVG
LPXD_ANADE       E------KVPAG----RPVLRVVNAYLAFAKISTLFHPPREAMP-------EVAPTAVIH
LPXD_MYXXD       V------PPREG----VALVRVANPHLAYAKLLRLFHAPERPAA-------GVRPGAWVH
LPXD_SYNAS       TE-----RPGEN----VTLIQVDDPYVSLGKLLTIFYPEEREKP-------GISAQAIVE
LPXD_GEOMG       G-------ERHG----RNAIHVANPYLAFAKLLTLFHVAPRKPQ-------GVMEGALVG
LPXD_GEOSL       A-------ERHN----HNAIMVPNPYLAFARLLTLFYVAPRAAR-------GVMDGAHVG
LPXD_PELCD       I-------ECPG----VNLLICANPYLAFAKVLTALHAQRPAPQ-------GVMDGAWVD
LPXD1_GLOVI      W-------PFEH----LTQIVVANPRLAMAQVLAHMFPQPIAMPPA-----GIHPSAVVH
LPXD_DESPS       V------EVESP----ATLIKVDDAYLAAAKIHTFLLEDEFSPE-------GIHRSAFVG
LPXD_PSE14       DADSYT----------GDALLVPDPYLAYARISHFFDPKP-KGVA------GVHPTAVIA
LPXD_PSESM       DADGYT----------GDALLVPDPYLAYARISHFFDPKP-KSSA------GVHPTAVIA
LPXD_PSEU2       DADGYA----------GNALVVPDTYLAYARISHFFDPKP-KSSA------GVHPTAVIA
LPXD_PSEF5       DAEAYA----------GDALVVADPYLAYARISHLFDPKP-KAQA------GVHPSAVIA
LPXD_PSEPF       DAEGYA----------GNALVVPDPYLAYARISHLFDPKP-KATA------GIHPTAVIA
LPXD_PSEPK       DAESFA----------GNTLVVADPYLAYARISHLFDPKP-KAEA------GIHPSAVVA
LPXD_PSEAE       DADGFA----------GTALVVANPYLAYASLSHLFDRKP-KAAA------GIHPTAIVA
LPXD_HAHCH       FADQCS----------TNVLVMENSYFGYALCSQLFSPQW-WSMS------GISPSAAIS
LPXD_CHRSD       HGTDAP----------CARLELENPYLGYAELSRLFDPLAGQAPE------GVHPSAVVA
LPXD_ALCBS       QREFCP----------VPALIVKDPYLSFAKASAFFEVAP-QVQP------GVHPAAVVD
LPXD_XANC5       DADAAK----------GTALVAKDPYTAFAKIAALFDVAP-VREP------GIHASAVID
LPXD_XANAC       DAEAAK----------GTALVAKDPYTAFAKIAALFDLAP-VREP------GIHASAVID
LPXD_XANOM       DAEAAK----------GTALVAKDPYTAFAKIAALFDVAQ-VCEP------GIHPSAFID
LPXD_XANOR       DAEAAK----------GTALVAKDPYTAFAKIAALFDVAP-VCEP------GIHPSAVID
LPXD_XANC8       DAESAQ----------GTALVAKDPYTAFAKIAALFDVAP-VRAP------GIHASAVID
LPXD_XANCP       DAESAQ----------GTALVAKDPYTAFAKIAALFDVAP-VRAP------GIHASAVID
LPXD_XYLFA       DVKTAS----------GTVLIAKDPYVTFAKIAALFDIKP-AREA------GIHPLATVD
LPXD_XYLFT       DVKAAS----------GAVLIAKDPYVTFAKIATLFDIKP-AREA------GIHPLATVD
LPXD_BLOPB       NLIFCK----------IAALVVEDPYIAYVKIARLMDTTPKPSK-------NIASGAIIA
LPXD_BLOFL       NLSFCR----------VSALVVKNPYLAYVKVAQLLDSSPKLNA-------NIKSQSVIH
LPXD_ECOL5       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SHIBS       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SHISS       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_ECOL6       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_ECO57       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SHIFL       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SHIDS       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_ECOLI       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_ECOUT       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPKPAQ-------NIAPSAVID
LPXD_SALTI       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SALTY       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SALPA       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_SALCH       DLPFAK----------SAALVVKNPYLTYARMAQILDTTPQPAQ-------NIAPSAVID
LPXD_PECAS       DLPYCQ----------VAALVVKNPYLTYAHMAQLLDTTPQPAT-------DIAPSAVIA
LPXD_SODGM       SLPFFT----------GAALVVRNPYLTYARMAQLMDITPKPAE-------DIGAGAVIA
LPXD_YERPA       DLPFCK----------VAALVVENPYFTYARMAQIMDTTPQPAQ-------DIAPSAVIS
LPXD_YERPN       DLPFCK----------VAALVVENPYFTYARMAQIMDTTPQPAQ-------DIAPSAVIS
LPXD_YERPE       DLPFCK----------VAALVVENPYFTYARMAQIMDTTPQPAQ-------DIAPSAVIS
LPXD_YERPS       DLPFCK----------VAALVVENPYFTYARMAQIMDTTPQPAQ-------DIAPSAVIS
LPXD_YEREN       DLPFCK----------SAALVVKNPYLTYARMAQIMDTTPQPAQ-------NIAPGAVIS
LPXD_PHOLL       DLPYCN----------IPALVVANPYLAYAYMAQIMDTTPIPAQ-------DIHSSAVIS
LPXD_WIGBR       NLPFCK----------QFALVVKDPYIAYVKLVKFMYVKKIPKY-------RIRSTAIVS
LPXD_HAEI8       DVEHCSPE--------SNLLIVKDPYVAYAILAQYMDSTPKAAQ-------GIAKSAVIF
LPXD_HAEIN       DVEHCSPE--------SNLLIVKDPYVAYAILAQYMDSTPKAAQ-------GIAKSAVIF
LPXD_PASMU       DVAFCAEQ--------SNLLIVKDPYVAYAVLAQYMDSTPKAAS-------GIAASAVVS
LPXD_HAES1       DIEFCSAQ--------SNLLVVKDPYVAYAILAQYMDSTPKAAQ-------GIHQSAVVS
LPXD_MANSM       DIEFCSAN--------SNLLITKNPYVAYALLAQYMDTTPKAAS-------DIASTAVIA
LPXD_HAEDU       DVEFCQAT--------QNLLIVKDPYLAYALLAQYMDDLPKSAN-------EISESAVIS
LPXD_ALIF1       DVEFCQ----------SNVLIMRDPYLGFALAAQALDTTPAPAS-------DIAPSAYIA
LPXD_PHOPR       DLPFFD----------GNALVLKDPYLGYALLAQLLDTTPKSAS-------NIAPSAYIA
LPXD_VIBVU       QRKHCS----------GHVLVVDDPYVAFAKVAQALDTTPKPAD-------GIAPSAVIA
LPXD_VIBVY       QRKHCS----------GHVLVVDDPYVAFAKVAQALDTTPKPAD-------GIAPSAVIA
LPXD_VIBPA       HKDQCA----------GNALVVADPYVAFARVVQAMDTTPKPAE-------DIAPSAVIA
LPXD_VIBCH       ERELCP----------SNALVVADPYVAFAKVAQALDSTPSPAH-------GIAPSAVIA
LPXD_COLP3       AVEACQ----------VSALVMDNPYMGYAMLASLLDSTPKVSC-------GIHPNAVIA
LPXD_PSEA6       DLSHCQ----------CSALVMDNPYVGFALAAQLLDSTPRSAD-------GISPLAVIA
LPXD_PSET1       DAPYFN----------GNKLIVANPYVSYAKLAQLMDTTPRSAAT------GIHPSAVVH
LPXD_IDILO       DDSDAI----------DNAIRVVNPYAAFARIAQLLDTTPKPAH-------GIAESAKIA
LPXD_SHESM       DAQDYS----------GTALVVKDPYVGFARVAQLLDTTPKAAI-------GIHPSAQID
LPXD_SHESR       DAQDYS----------GTALVVKDPYVGFARVAQLLDTTPKAAI-------GIHPSAQID
LPXD_SHEON       DAQDYQ----------GTALVVKDPYVGFARVAQLLDTTPKAAM-------GIHPSAQID
LPXD_SHEFN       EASCYH----------GNALIVSDPYVGFARVAQLLDTTPKETP-------GIHPSAQID
LPXD_SHEDO       EANNFQ----------GNALIVKDPYVAFARVAQRLDTTPKAAV-------GIHPSAQID
LPXD_SACD2       SAEKFN----------GNKLIVKNPYLCYAKLSELFNFRLAKKQ-------GVHPSATVD
LPXD_ALKEH       HVAECP----------TTALVVDDPYYAYAAVATRLHPAERPPA-------GVHPTAVVA
LPXD_AROAE       ARDLTGL----------PRIVTADPYIYFARVAQLFNPP--EAFVP-----GVHPAASVA
LPXD_DECAR       VAEEFPG----------PRIVTGNPYAYYARVATLLNPY--QSGLS-----GVHASAVVE
LPXD_METFK       NRDITAL----------PRILTDNPYAYFAKVSDLLNPK--PEYVA-----GVDDTAVIA
LPXD_THIDA       ARDATDL----------PRILTPNPYLYFARVSALLNPP--PRPAA-----GVHPAATVA
LPXD_BORBR       VAQARQEQGASG----HVLVVCKHPYLLYARLAQWFERASRPAGPA-----GVHPSAVVD
LPXD_BORPA       VAQARQEQGASG----HVLVVCKHPYLLYARLAQWFERASRPAGPA-----GVHPSAVVD
LPXD_BORPE       VAQARQEQGASG----HVLVVCKHPYLLYARLAQWFERASRPAGPA-----GVHPSAVVD
LPXD_BORA1       VAQALRAQGST-----LVFVVCRHPYLLYARLAQWFDAERRGLPPA-----GVHPSAVVA
LPXD_POLSJ       AREAAVSRGAC--------IVVDDPYHYFALITQLWKYRHVLQAAP-----HIHPSAFID
LPXD_RHOFT       MRGVALARGAC--------IVTEQPYLYFARVTQLWKKSLPRTVRP-----QIHPSAVID
LPXD_BURCA       DLEKLGAAAQGRTAGPRNFIVTPNPYAYFARVAQMFIDLATPPRAA-----GVHPSATID
LPXD_BURL3       DLEKLGAAAGG-----RNFIVTPNPYAYFARVAQMFIDLATPQRAA-----GVHPSATID
LPXD_BURP1       DLEKLGAAAHG-----RNFIVTPNPYAYFARVAQMFIDLAAPPRAA-----GVHPSATID
LPXD_BURPS       DLEKLGAAAHG-----RNFIVTPNPYAYFARVAQMFIDLAAPPRAA-----GVHPSATID
LPXD_BURMA       DLEKLGAAAHG-----RNFIVTPNPYAYFARVAQMFIDLAAPPRAA-----GVHPSATID
LPXD_BURTA       DLEKLGAAANG-----RNFIITPNPYAYFARVAQMFIDLAAPQRAA-----GVHPSATID
LPXD_PARXL       DLARLASRESR------NFIVTPNPYAYFARVAQTFIDLAAPKAVP-----GVHPSATID
LPXD_CUPPJ       DLERIRAEGQADG---RNWLVARNPYVCFARIAQRFDKA-NQDART-----GIDPRASVA
LPXD_CUPMC       DLERIRADGQAEG---RNWLVARNPYVCFARVAQRFDRAANADSRT-----GIDPRASVA
LPXD_RALSO       DLETLTAEGHAAG---RNWLVAANPYAAFARIAQRFAALGARPAAA-----GIHPSASVG
LPXD2_FRAT1      VLEFCN----------TNAVVLSNPYMALAKVMELFDKSPRPDG-------KIHSKAVIA
LPXD2_FRATH      VLEFCN----------TNAVVLSNPYMALAKVMELFDKSPRPDG-------KIHSKAVIA
LPXD2_FRATO      VLEFCN----------TNAVVLSNPYMALAKVMELFDKSPRPDG-------KIHSKAVIA
LPXD2_FRATT      VLEFCN----------TNAVVLSNPYMALAKVMELFDKSPRPDG-------KIHSKAVIA
LPXD_COXBU       LASRCP----------INALVMSNPKLGFAKLLTLLRPQSLPTG-------GIHPTAVVG
LPXD_NEIG1       AADGFEG---------RNLIVADDPYLYFAKVARLFSPVVKARG-------GIHPTAVVE
LPXD_NEIMA       AADGFEG---------RNLIVADDPYLYFAKVARLFSPVVKARG-------GIHPTAVVE
LPXD_NEIMB       AADGFEG---------RNLIVADDPYLYFAKVARLFSPVVKARG-------GIHPTAVVE
LPXD_CHRVO       LAAELPD---------RSLIVAADPYLYFARLATLFHPPKAPRA-------GIHPRAVVG
LPXD_PSYA2       HHNEAPND--------TVALIVASPYLAYASVSQLFARQPSVSG--------IHPTAVIA
LPXD_PSYCK       HHEEVPND--------TVALIVAVPYLAYASVSQIFARQHSFSG--------IHPTAFIA
LPXD_ACIAD       FKDQLPAS--------QNYIVVKNPYLAFAQLTHVFEKKMTQRG--------IESTAKIH
LPXD_HYDCU       F--ESLTT--------TTCLLVENPYFAFAKVSQLLNPENFPAG--------IHASAVVD
LPXD_BACFN       FTPEQEV--------KATLIKVDNAYESLAKLLNLYEMS-KPKRT------GIDERAYVA
LPXD_BACFR       FTPEQEV--------KATLIKVDNAYESLAKLLNLYEMS-KPKRT------GIDERAYVA
LPXD_BACTN       FVPEHEI--------RATLIKVDNAYESLAKLLNLYEMS-KPKKQ------GIDSLAYIA
LPXD_PORGI       FEPRESV--------KTTLIRVPNAYTALAQLMQLVDSM-KPQRK------GVDSTAFVH
LPXD_CYTH3       FQPRESL--------KTSLILVDDPYTSFTTILEAYQQALNASKM------GKEEPSFIG
LPXD_CHLCH       LAVEEYVG-------KHSFLKVNDPYSAFVFLLQRFIPPRRIAKQ------GIAATASIG
LPXD_PELLD       VDVSLYAG-------ERSFLKVSDPYTAFVFVLQKFARPRTLAKP------GVAPTAAIG
LPXD_CHLTE       APLDDASP-------GTSFLKVADPYTAFVFILQHFSGKRRIADT------GIAASASVA
LPXD2_KORVE      AASAHDAPK------PLLISTQPR----LAFAKAAKVLRSHKKRSGG----IVHPTAVVP
LPXD_METCA       IAAEFGESP------ALAVLIAPNVRLAIALIKQAYADRDVRDTEWP----RIHPSAVIH
LPXD_CHLAB       QAQKYGHLN------KNFLIVSEFPSIAFQKCIELFISPV--DSGFP----GIHPTAVIH
LPXD_CHLFF       QAQKYGHLN------KNFLIVSEFPSIAFQKCIELFIPPI--DSGFP----GIHPTAVIH
LPXD_CHLCV       QAQKYGHLN------KNFLVVSEFPSIAFQKCIELFIPPV--ESGFP----GIHPTAVIH
LPXD_CHLPN       QAMQHAHLK------KNFLITNESPSLTFQKCIELFIEPV--TSGFP----GIHPTAVIH
LPXD_CHLTA       QFQKYRDLN------KNFLITSESPSLVFQKCLELFITPV--DSGFP----GIHPTAVIH
LPXD_CHLTR       QFQKYRDLN------KNFLITSESPSLVFQKCLELFITPV--DSGFP----GIHPTAVIH
LPXD_CHLMU       QFQKYRELN------KNFLIVSESPSLVFQKCLELFIAPV--DSGFP----GIHPTAVIH
LPXD_PARUW       TPLIEG---------KNYLLS-ENPSRSFQHLIDTLYPQKKHPSGFT----GIHTSAVIH
LPXD1_FRAT1      ISKELAQVND------KPLIVVNNADLAMAKILELFSVPYPEQNG-------IHEKAIID
LPXD1_FRATT      ISKELAQVND------KPLIVVNNADLAMAKILELFSVPYPEQNG-------IHEKAIID
LPXD1_FRATH      ISKELAQVND------KPLIVVNNADLAMAKILELFSVPYPEQNG-------IHEKAVID
LPXD1_FRATO      ISKELAQVND------KPLIVVNNADLAMAKILELFSVPYPEQNG-------IHEKAVID
LPXD_FUSNN       ---DLPLIEG------KGYIVVKDSPRVIMPKLLHFFSRNLK----------KIEKMR-E
LPXD_AQUAE       -------VKD------FPHIKVKDVKLALAEFLEHFFPEEHPWGF-------LRTPAS-E
LPXD1_LEGPA      ---GTIDSP-------KPLIQVKNPFKAFIALLNHFYPPRRISPG-------VHPTAVIG
LPXD1_LEGPH      ---GTIDSP-------KPLIQVKNPFKAFIALLNHFYPPRRISPG-------VHPTAVIG
LPXD1_LEGPL      ---GTIDSP-------KPLIQVKNPFKAFIALLNHFYPPRRISPG-------VHPTAVIG
LPXD_RHOBA       ---YVAASPI------RLQILVDDPHAAFTKLVSHYRPAL---GE-------TMPVSGID
LPXD_CAMJR       YENLVPKD--------TKALITQSPHLSFAFLSKLFAKPLIS--------------TAKE
LPXD_CAMJE       YENLVPKD--------TKALITQSPHLSFAFLSKLFAKPLIS--------------TAKE
LPXD1_SULDN      TKEFVPSG--------CVALVVENPYWEMATLSKYFAPSIED--------------ETLP
LPXD2_SULDN      LVENLPKE--------SSYIICPDVSISMAQATKLFNKRPIE--------------PQLP
LPXD_HELPH       ESSKVPKR--------MQALIVDNPHLAFAKASHAFKIPFFKN-------------PESV
LPXD_HELPY       ESSKVPKR--------MQALVVDNPHLAFAKASHAFKIPFFKN-------------PESV
LPXD_HELPJ       ESSKVPKS--------MQALIVDNPHLAFAKVSHAFKIPFFKN-------------PQSV
LPXD_HELHP       LLDKVPSH--------IQPLVVENPHLAFALLSQLFAAPCFT---------------LTT
LPXD_WOLSU       LLSLVPQG--------CTPLVSAHPYLDMARLSKLFAKPPLG---------------LNA
LPXD_GRABC       MVDRVPAG--------VIALVVPEPYLAWARVAALFYPLPPV-------QPGIHPSAVVD
LPXD_MAGSA       MADKAPEG--------MALLLSPDPYRAYARIAQAFYPNPAP-------EPWVAPTAWVD
LPXD_CHESB       LAENAPDG--------VAVLVSPKPQQAFAMVARLLFPEANRPQPVTG-ETGVSPRAVIA
LPXD_RHILO       FANKAPSS--------VAVLIHPRPQQAFALVGRLLFPTAATPGPMTS-ETGVSAHAHID
LPXD_BARHE       IVFKVPES--------MAILVTSTPQRDFAQIGRILFPDSVKPMPWFG-QREISPHAHIH
LPXD_BARQU       IVFKVPES--------MAILVTSTPQRDFAQIGRILFPDSVKPMPWFG-QREISPYAHIH
LPXD_BRUAB       LADSVPSG--------IAVLVSRHPHRDFSAVGRMLFPASVRPESWLG-ETGISPAAFIH
LPXD_BRUA2       LADSVPSG--------IAVLVSRHPHRDFSAVGRMLFPASVRPESWLG-ETGISPAAFIH
LPXD_BRUME       LADSVPSG--------IAVLVSRHPHRDFSAVGRMLFPASVRPESWLG-ETGISPAAFIH
LPXD_BRUSU       LADSVPSG--------IAVLVSRHPHRDFSAVGRMLFPASVRPESWLG-ETGISPAAFIH
LPXD_NITHX       FEASVPGH--------VAVLRSAAPFRAFVRIARDCHADTLRPQSWFD-NATIAASAVVH
LPXD1_NITWN      FEADVPAH--------VAVLRSKAPFRAFVSIARDFHGDALRPQSWFD-NTAVAASAVIH
LPXD_BRADU       FEAQVPAH--------VAVLRAAQPFRAFVRIAREWHGDALRPQSWVG-NDGIAPSAIID
LPXD_RHOP2       YETRVPPH--------VAVLRVKSPVQAFVAYARHIHEDAMRPMSGFG-GTGIAPSAVIH
LPXD_RHOPS       HESRVPSH--------VAVLRVKSPVRAFVTYARHIHEDAMRPMSGFR-SVGIAPSAVIH
LPXD1_RHOPB      FEASVPPH--------VAVLRAKSPFRAFVAYARLIHQDAMRPQSGFD-LTGIAASAVIH
LPXD_RHOPA       FEGRVPSH--------VAVLRARRPFHAFVAYARHLYSDALRPHTGVG-APGIAPTAVIH
LPXD2_RHOPB      FAHLAPES--------VAVLRIAKPYEAFVAVARRLYPSALRPTSLFG-TLGVAPGAVVH
LPXD2_NITWN      FKELVPGG--------TFSFVTPHPYAIYAQVLALLYPEATIPASNFG-TNGISSKANIH
LPXD_RHIEC       LADVVPPH--------LPVILSSNPHAAFAMAGGLFYPAALRPVAISG-ESEIAPSAVID
LPXD_RHIL3       LADLVPQH--------LPVMLSSNPHAAFAMAGGLFYPAALRPVAFSG-ESEIAPSAVID
LPXD_AGRFC       LKSLIPSH--------IPALISKTPHTLFAQVGALLHPSAMRPSLVARMEAEISPAAYVD
LPXD_RHIME       ISSLVPDT--------IPVLLTSKPHTAFALAGTLLHERAMRPSYNTS-ERGVAPEAFVD
LPXD_HYPNA       MKHFIPEG--------VGVLETAFPRNAHSAIASSLFRPRHL---------MGAGHELVS
LPXD_CAUVC       HQGFLPPT--------CAALVTGRPQAAWAAAANRLHAPRR----------HEAGAPSLH
LPXD_MARMM       ASEATRLG--------AAVLTHTAPRAAFASVLPALFQTRS-----------FATDSFID
LPXD2_LEGPH      YVKYAPDS--------MYLLVHPNPYKAFALIAQAFYPSEKP-------PGFIATSAMIE
LPXD2_LEGPL      YVKFAPDS--------MYLLVHPNPYKAFALIAQAFYPSEKP-------AGFIASSAAIE
LPXD2_LEGPA      YVKFAPDS--------MYLLVHPNPYKAFALIAQAFYPSEKS-------SSFIAPSAKIE
LPXD_RICCN       FTGEANPN--------TVLLHAQNPYFAYGKLIDFFYAPIKSY------PAKIMKSAIVA
LPXD_RICRI       FTGEANPN--------TVLLHAQNSYFAYGKLIDFFYAPIKSY------PTKIMKSAIVA
LPXD_RICFE       FTGEANPN--------TVLIHAENSYFAYGKLIDFFYTPIKSY------PAKIMKSAIVA
LPXD_RICPR       FTEEVNQN--------TVLIHAENSYFAYSKLIDFFYAPIKSY------STKIMKSAIIA
LPXD_RICTY       FTEESNQN--------TVLIHAENSYFAYSKLIDFFYAPIKSY------STKIMKSAIIA
LPXD_RICBR       FTGEVNPN--------TVLLRAENSYFAYGKLIDFFYAPVKSY------PAKIMKSAYVA
                                                                             

LPXD1_KORVE      PTAKVGANASIGPYVVIEDNVAIGANCVLRAHVVIYEGVTIGDNFFAHAHAVVREHCRIG
LPXD2_GLOVI      PTAVCGHNVRIGASSVIGEGVVLADGVTVYPNCTIYPGVRIGRNSTIHSNCVVREHVVIG
LPXD_THEEB       ADVVLGAEVTIGAYTVIGDRVRIGDRTVIDSHCTLYDDVVIGSDCRIYSHCALRERVQLG
LPXD_TRIV2       PTAKIGNDVYIGPHVVIQPGVEIGNGVIIHPNVVIYPGVKIGDRTILHANCTIEERSQIG
LPXD_NOSS1       PTAKIGNDVYIGPHVVIQPGVEIGNGVIIHPNVVIYPYVKIGDRSILHANCTIEERSQIG
LPXD_TRIEI       PTAKVGKNVYLGAHVVVEAGVKIGDNVCIYPNVVIYPNVEIGENTILNANCSIHERSQIG
LPXD_SYNP6       PSAQLGDRVSVGAHVVIGANCVIGNDVILHANVVLYPGVSLGDRCQIHANSTIHERSQIG
LPXD_SYNE7       PSAQLGDRVSVGAHVVIGANCVIGNDVILHANVVLYPGVSLGDRCQIHANSTIHERSQIG
LPXD_SYNY3       PSVHCGEDVSIGPHVVIYPNVTLGDRVCIHGNVVIYPGVTIGNDSVLHGNCTIHERTQIG
LPXD3_GLOVI      ANVQLGENVHLGAYVVIGDDVTIGPEAVIYPNCTIYNDVRIGVRTVVHANCVLHERTKIG
LPXD_SYNJA       PSVELGEGVAIGPHVVVMEGVKIGDYTQIHPNVTIYPHVRVGSRCQLFANCVIHERTEIG
LPXD_SYNJB       PSVELGEGVAIGPHAVVMEGVKIGDHTQIHPNVTIYPHVRIGSRCQLFANCVIHERTEIG
LPXD_PROM9       KTAIIGADCHIGPNVYIGENTVIGNNNDILTGSSILGNVRIGDNNIIHPNCVVYENTTLK
LPXD_PROMP       SSAKVGKNCYVGPNVYIGENSIIGDNNKIFPGTTILGNVRLGNNNVIHPNCVIYENTSIE
LPXD_PROMA       NNVKIGKNIYIGANVCIDSNTRIGDNSIIHSGVVIYENVVIGKNNELHANCVIHQYSNLG
LPXD_PROMT       QNVKIGLGVSIGANAYIGDNTEIGAGTIIHAGVVLYRNVRIGSKNLIHANSVIHSGSKLG
LPXD_SYNPX       ERAVVGPGTAVAARVCIGAGSRVGADCIVHPGVVIYDDVVIADGCELHANAVLHPGSRLG
LPXD_SYNSC       ERAVVGPGTAVGPRVCIGEGSRLGADCIVHPGVVIYDDVVVGDGCELHANAVLHPGSRLG
LPXD_SYNS9       ERAVVGPGTFIAPRVCIGASSRIGANCIVHPGVVIYDDVEVGEGCELHANAVLHPGSRLG
LPXD_PROMM       DQVHLGQGISIGAHVVIGDGSRIGAYSVVHPGVVIYEDVVVGEANELHANAVLQPGSRLG
LPXD_DESAG       PEAEIGGGCTIYPHVYIGARARIGEGTTLFPGCYVGEDCAVGENCLLYPNVTLMAATTVG
LPXD_DESVH       PEAVVGEGCAVYPHVYIGPRARIGAGTVLFPGCYIGEDCVVGGGCTLYPNVVLMAGVEIG
LPXD_LAWIP       PTAQVSKTATIYPFVFIGSHTVIEENTTLFPGVYIGEHCHIGKNCTIYPNTVLMANTSIG
LPXD_NITOC       DDVQIAENCSIGAYCVIEDGVTIKAHTVLFPFCYVGAKTILGEHCLLYPRVTLLERVRIG
LPXD_ANADE       PTARVHPSAQVMPLACVGPDAQVGARTILFPGVHVADGARVGEDCVLYHNVVVRERCAVG
LPXD_MYXXD       PEATVHPEAVLLPGASVDRGGRVGARTVLYPGAYVGEQAEVGEDCVLYPNVTVRERCIVG
LPXD_SYNAS       EGAEISPSATVYPGVYISSGAGIGAGVVLYPGVFVGRDAVIGENSILYPNVCVYRRCLIG
LPXD_GEOMG       HNVAMGSDVTIYPGAFVGDGVTLGDRVTIFPGVVIYEGVTLGSDVTLHSNVVVYQGCRIG
LPXD_GEOSL       RNVKLGSEITIHPGAVVGDNVTIGDRVTLHPGVVLYEGVTVGDDVTLHANVTVYQGCRIG
LPXD_PELCD       PSAELGADVTVHPGCVVGKNVRVGRGTILYPGVVLYDDVQVGEDCLVHAGVLVREQCRLG
LPXD1_GLOVI      PSAVVHPSASVAALVYVGPRAAVGANTHLFPGVYVGAEAVVGSECLIYPNVVLMDGIRLG
LPXD_DESPS       EGCQISSEVTIKALVSIGNRVVIGPRTRIESGVAIGDDVTIGEDCLLKANVTIADGSQLG
LPXD_PSE14       DDAQVDPAASIGAFVVIESGARIAAGVTIGAHSFIGARCEIGEGGWLAPRVTLYHDVRIG
LPXD_PSESM       EDAQVDPAASIGAFAVIESGARIAANVTIGAHCFIGARSEIGEGGWLAPRVTLYHDVRIG
LPXD_PSEU2       ADALIDPAASIGAFAVIESGVRIAAGVTIGAHCFIGARCEIGEGGWLAPRVTLYHDVRIG
LPXD_PSEF5       ADAQVDPAASIGPFAVIESGARIAAGVTIGAHCFIGARCEIGEGGWLAPRVTLYHDVRIG
LPXD_PSEPF       EDAVVDPSASVGPFVVIEAGARIGADVTLGAHCVVGARSEIGEGGWLAPRVTLYHDVRIG
LPXD_PSEPK       EDAQVDASASIGPFAVIESGARIGANVSIGAHCFIGARCVVGEGGWLAPRVTLYHDVTIG
LPXD_PSEAE       ADAEVDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLYHDVTIG
LPXD_HAHCH       ESAKLGAGVTIGANVVIEEDAEIGEGAVIGPGCYIGAGSIIGAKTQLRPNVTVYHGVNIG
LPXD_CHRSD       ESARIGEHVSVGPQCVIEAGAVIGDGCVIGAGSIVGADSEIGADSRLHANVTVYHGVSVG
LPXD_ALCBS       ATAQIHTSASIGPNAVVEAGVIVGEGAVIMANSVVGAGCHIGDQCRIWPNVTIYHGVTLG
LPXD_XANC5       PTAQVSPGAHVGPFVSIGARSRVGDGCVIGTGSIIGEDCVVDEGSELLARVTLVTRVRLG
LPXD_XANAC       PTAQVSATAHVGPFVSIGARSRVGDGCVIGTGSIIGEDCVVDAGSELLARVTLVTRVRLG
LPXD_XANOM       PTAQVSPGAHVGPFVSIGARSRVGDGCVIGTGSLIGADCVVDDGSELLARVTLVTRVRLG
LPXD_XANOR       PTAQVSPGAHVGPFVSIGARSRVGDGCVIGTGSLIGADCVVDDGSELLARVTLVTRVRLG
LPXD_XANC8       PTATVSPTAHVGPFVSIGAGSRVGDGCVIGAGSIIGEDCVVDDGCELIARVTLVTRVRLG
LPXD_XANCP       PTATVSPTAHVGPFVSIGAGSRVGDGCVIGAGSIIGEDCVVDDGCELIARVTLVTRVRLG
LPXD_XYLFA       PSAHVSPTAHVGAFVSIGARSSIGASCIIGTGSIIGDDCTIDDGSELIARVTLISKVRLG
LPXD_XYLFT       PSAHVSPTAHVGAFVSIGARSSIGASCIIGTGSIIGDDCTIDDGSELIARVTLISRVRLG
LPXD_BLOPB       SDAILGQRVGIGANAVIESEVILGDDVIIGPGSFVGKKTRIGTGTRLWANVTIYHEVEIG
LPXD_BLOFL       SNSILGKDVGIGYNVIIESGVIISDNVKIESGCIIGKNVKIGIGTYLWSNVTVYHGVEIG
LPXD_ECOL5       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_SHIBS       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_SHISS       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_ECOL6       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_ECO57       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_SHIFL       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_SHIDS       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_ECOLI       ATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_ECOUT       ETAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG
LPXD_SALTI       ATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHDIQIG
LPXD_SALTY       ATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHDIQIG
LPXD_SALPA       ATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHDIQIG
LPXD_SALCH       ATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHDIQIG
LPXD_PECAS       SDATLGQQVSIGANAVIESGAQLGDGVVIGPGCFVGKNARIGAGTRLWANVTIYHRVELG
LPXD_SODGM       PDATLGQRVAVGANAVIESGVVLGDDVIIGPGCFVGKNTRIGAGTRLWANVTVYHDISIG
LPXD_YERPA       PQATLGEGVSVGANAVIESGVVLGDNVVIGAGCFIGKNTHIGAGSRLWANVSIYHEVVIG
LPXD_YERPN       PQATLGEGVSVGANAVIESGVVLGDNVVIGAGCFIGKNTHIGAGSRLWANVSIYHEVVIG
LPXD_YERPE       PQATLGEGVSVGANAVIESGVVLGDNVVIGAGCFIGKNTHIGAGSRLWANVSIYHEVVIG
LPXD_YERPS       PQATLGEGVSVGANAVIESGVVLGDNVVIGAGCFIGKNTHIGAGSRLWANVSIYHEVVIG
LPXD_YEREN       PQATLGENVSIGANAVIESGVVLGDNVVIGAGCFIGKNTHIGAGSRLWANVSVYHEVVIG
LPXD_PHOLL       PQATLGKNVAVGANAVIESGVVLGDNVVIGAGCFIGKNTRIGAGSRLWANVSVYHNVEMG
LPXD_WIGBR       KKAILGKNIYIGHNTVIESKVKLENNIIIGSGCFIGENTIIGSNTHLWDNTTIHHGTIIG
LPXD_HAEI8       DGVLLGENVSIGANAVIEEGVVLGDNVIIGANCFVGKNTKIGSGTQLWANVTVYHNVEIG
LPXD_HAEIN       DGVLLGENVSIGANAVIEEGVVLGDNVIIGANCFVGKNTKIGSGTQLWANVTVYHNVEIG
LPXD_PASMU       ASAVIGKNVSIGANAVIEDGVTLGDHVVIGANCFVGKNSKIGAYTQLWANVSVYHEVEIG
LPXD_HAES1       DTATLGQHVSIGANAVIEDGVILGDNVVIGAGCFIGKHVQIGENTQLWANVNIYHDVKIG
LPXD_MANSM       SSAKLGTNVSIGANAVIEDGVELGDNVVIGAGCFIGKNTKIGANTQLWANVSIYHEVQIG
LPXD_HAEDU       ATAKLGKNVSIGANVVIESGVELADDITIGAGCFIGKNTKIGARSHLWANISVYHNVEIG
LPXD_ALIF1       DDAIIGEGVAIGHNAVIESKAVIADGAMIGAGCFIGKEAKIGKNTKLWANVSVYHRVEIG
LPXD_PHOPR       DDAIIGEGAAIGHNAVIESGAQIGANVQIGAGCFIGQNAVIGAGSKVWANVSIYHSVTLG
LPXD_VIBVU       SDAILGQNVSIGANAVIETGVTLGDNVVIGAGCFIGKNAAIGQNTKLWANVTIYHQVQIG
LPXD_VIBVY       SDAILGQNVSIGANAVIETGVSLGDNVVIGAGCFIGKNATIGQNTKLWANVTIYHQVQIG
LPXD_VIBPA       SDVKMGENVAIGANAVIETGVELGDNVVIGAGCFIGKNAKLGNNTKLWANVTIYHEVSLG
LPXD_VIBCH       EDAKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIG
LPXD_COLP3       DDVLIGENVSVGANTVIESGVQLADNVSIGAGCFIGHGAKIGESTILWANITIYHRVEIG
LPXD_PSEA6       DDVELGDNVSIGAHAVIESGVKLADNVQIGPGCFIGKEVSVGANTKLWANVTLYHRVVLG
LPXD_PSET1       PNATVSKSAAIGANTVIESNAIINDNVQIGPNSFIGEGVKIGSGTKLWSNVTIYHNVEIG
LPXD_IDILO       PSATIGQNVSIGEYTVIDEGVIIGDNTSIGPHCYIGPETQIGAGCTLWSGVKIYHRCVIG
LPXD_SHESM       PSALLGEGVAIGANAVIGANVILGENVQIGAGTVIGQDCIIGSNTRLWANVTLYHNVHLG
LPXD_SHESR       PSALLGEGVAIGANAVIGANVILGENVQIGAGTVIGQDCIIGSNTRLWANVTLYHNVHLG
LPXD_SHEON       PSAQLGDGVAIGANAVIGANVILGENVQIGAGTVIGQDSIIGSNTRLWANVTLYHNVHLG
LPXD_SHEFN       TSAILGDGAAIGANAVIGANVILGENVQIGPGCVVGESSIIGSNTRLWANVSVYHNVHIG
LPXD_SHEDO       ASAQIGQGAAIGANAVIGAGVIIGEHCQIGPGCVIGEHSILGSNTRLWANVTLYHDVHLG
LPXD_SACD2       ADATVAADAYIGPNCVIEAGAVIGGGTQLGAGCFVGADTKLGNNCLLHANVTLYAGVELG
LPXD_ALKEH       EGVTLGEAVSVGPHAVVEAGARLGARTIVGPGCHVGTGVEIGEDSHLMGRVTVADRCVVG
LPXD_AROAE       --SPVPASVTIAAGASIDVDVELGEHVVIGPGCRIGRGARIGAGSRLNANVTIYHDCVLG
LPXD_DECAR       --SPVPDSVAIAPNVYIGKDVTLGENVVINAGCVIGDGVSIGAGTVLYANVTVYYGCSIG
LPXD_METFK       PSAQVPASCTIMAKAVVGANVVLGEHVVVHPGCVIGEGVEIGAHSVLHANVTIYHHCMIG
LPXD_THIDA       ADAEVAADASIAAGAVIGSGARIGARSVIGANSVVGDGARVGEDCLLHANVSLYHGCQVG
LPXD_BORBR       PSAEIDADARVGAQCVIEAGARIGRGARLGPGCVIGAGSTVGADSLLHPRVTLYAGVHVG
LPXD_BORPA       PSAEIDADARVGAQCVIEAGARIGRGARLGPGCVIGAGSTVGADSLLHPRVTLYAGVHVG
LPXD_BORPE       PSAEIDADVRVGAQCVIEAGARIGRGARLGPGCVIGAGSTVGADSLLHPRVTLYAGVHVG
LPXD_BORA1       PDAVIEEGASVGPQCVVDSGARIGRGASLGPGCIVGQGSTVGANSRLHARVTLYDGVHVG
LPXD_POLSJ       PAATLAPGVSVGAFACISAGTVIGAGARIAEHCVIGRDAHVGAESRLSARVTVADGCYIG
LPXD_RHOFT       PEAFVHPRACIGAL------------------CVIESGASVGADTVLKSRVTVGENCVIG
LPXD_BURCA       PAAKVAATAVIGPHVTIEAGAVIEDGVQLDANVFVGRGTTIGAGSHFYPNASVYHGCKVG
LPXD_BURL3       PAAQVAASAVIGPHVTVEAGAVIEDGVQLDANVFVGRGTTIGAGSHLYPNASVYHGCKVG
LPXD_BURP1       PAAQVAASAVIGPHVTVEAGAVIGERAQLDANVFVGRGTRIGDDSHLYPNVAIYHGCTLG
LPXD_BURPS       PAAQVAASAVIGPHVTVEAGAVIGERAQLDANVFVGRGTRIGDDSHLYPNVAIYHGCTLG
LPXD_BURMA       PAAQVAASAVIGPHVTVEAGAVIGERAQLDANVFVGRGTRIGDDSHLYPNVAIYHGCTLG
LPXD_BURTA       PAAQVAASAVIGPHVSVEAGAVIGERVQLDANVFVGRGTRIGDDSHLYPNVTIYHGCTLG
LPXD_PARXL       PSAQIAASAVIGPHVTVEAGAVIGENVRLDANVVIGRGTRIGADSHLYPNVAVYYGCKLG
LPXD_CUPPJ       ADVTVPASCFIGPNVVIESGARIGERVRIVANSFVGAHAEIGDDSLLYANVSVYHHCVVG
LPXD_CUPMC       PDAVVPASCFIGPNVVIESGARLGERVRILANAFIGASAEIGEDTLIYANVSVYHRCVIG
LPXD_RALSO       EGAVVPASCSIGPNVTIEAGAVLGERVRIAGNSFIGADAQVGDDTLLYANVSIYHGCVVG
LPXD2_FRAT1      ASAIIGENVTIGANAVVGENVVIGDNVYIGACATIDNGTKIGNDTLIKSNVSIAHDVVIG
LPXD2_FRATH      ASAIIGENVTIGANAVVGENVVIGDNVYIGACATIDNGTKIGNDTLIKSNVSIAHDVVIG
LPXD2_FRATO      ASAIIGENVTIGANAVVGENVVIGDNVYIGACATIDNGTKIGNDTLIKSNVSIAHDVVIG
LPXD2_FRATT      ASAIIGENVTIGANAVVGENVVIGDNVYIGACATIDNGTKIGNDTLIKSNVSIAHDVVIG
LPXD_COXBU       ANCQIDPSAHIGAHVVIEEDVVIGPRTLIGAGASIGRGSQIGSDCCLHSRVTLYSQTRIG
LPXD_NEIG1       PGATVPASCEIGANAYIGANTVLGEGCRILANAVVQHDCKLGDEVVLHPNAVVYYGCTLG
LPXD_NEIMA       ESATVPASCEIGANAYIGANTVLGEGCRILANAVVQHDCRLGDEVVLHPNAVVYYGCTLG
LPXD_NEIMB       PGATVPTSCEIGANVYIGANTVLGEGCRILANAVVQHDCKLGDEVVLHPNAVVYYGCTLG
LPXD_CHRVO       VGCRIGESSEIAANATIGDNVVIGERCRLMPGVVVGDGCEIGDDVTLYPNVTIYHDCVIG
LPXD_PSYA2       DSAVIGNQVTIGAFCVIGEQVQIGDRSALQAHVVVEDNTAIGTDCVIKPQVVIGHDCIIG
LPXD_PSYCK       DSAVIGNKVTIGAFCVIGEQVQIGDRSVLEAHVVIEDNTTIGTDGVIKSQVVIGHDCIIG
LPXD_ACIAD       PSAMIADNAYIGHYVIIGAECVVGENTVILAHSFLGDNVEIGRDGFVESNVSLLQGTKIK
LPXD_HYDCU       DSAKIAESAWIGENVVIGKRVTIGDNCYIGPGSVVLDDSVIGQKTRLVANVTVMHNCIIG
LPXD_BACFN       ETAKIGKDVYIAPFACIGDHAEVGDNTVIHPHATVGGGAKIGSNCILYANSTVYHDCRVG
LPXD_BACFR       ETAKIGKDVYIAPFACIGDHAEIGDNTVIHPHATVGGGAKIGSNCILYANSTVYHDCRVG
LPXD_BACTN       PSAKIGENVYIGAFAYIGENAVIGDNTQIYPHTFVGDGVKIGNGCLLYSNVNVYHDCRIG
LPXD_PORGI       PSVILPDDCYVGAFAYVSEGASLGTGCSLYPHVYVGSGVSVGEGTILYPHVTVYDGCSIG
LPXD_CYTH3       KNAVIGSNHYIGAFAYIGSNCKIGNNVKIYPQAYIGDNVTIGDNTTIYAGVKIYANCELG
LPXD_CHLCH       SNVTIGENVSIGEYAVIGEHCSIGNNTVIAAHSVLLDHVTIGSDVVLFPHVTCYDGTRIG
LPXD_PELLD       GGVSLGEGVAVGEHAVIGDRCSIGAGTVIAPNAVIMHDVKIGEGCTIFPQVTIYDGTLIG
LPXD_CHLTE       ASVRLGENVSLGEHVVIGENCVIGDGTVIGPGTVLMDGVTVGSGCTIFPLVTIYDGTVIG
LPXD2_KORVE      PTVVFGAEVVVGAYVVLGEHVHIGDRVCIGAGVCIGSDVKIGTDCEIHSRVTIYHGTHIG
LPXD_METCA       ASVEVPADAIIGPGVVIGADVVLGRGVVLMANVVIERGARIGAETVLHPGVTVCIDCEIG
LPXD_CHLAB       PTASIGKDVCIEPYAVICQHACIGDSTYIGTGSVIGAYSTLGEHCLVHPKVVVRERVEIG
LPXD_CHLFF       PTAHIGKDVFLEPYAVICQHAQIGDSSHIGAGSVIGAFSTLGEHCYVHPKVVIRERVVIG
LPXD_CHLCV       PTAHIGKDVCIEPYAVIGQHAHIGDSSYIGAGSIVGAYSILGENCLIHPKVVIRERVEIG
LPXD_CHLPN       PTARIEKNVTIEPYVVISQHAHIGSDTYIGAGSVIGAHSVLGANCLIHPKVVIRERVLMG
LPXD_CHLTA       PTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIG
LPXD_CHLTR       PTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIG
LPXD_CHLMU       PTAIIEEHVCIEPYVVICQHARIGAACHIGTGSVIGAHSSIGEHSYIYPRVVVRERVSIG
LPXD_PARUW       PTAEIGNKVTICPQAVIDEGVKIGSGSFIGAGVYIGSYSEIGEDCTIHPRVVIREKCYLG
LPXD1_FRAT1      PTAKIGKNVSIGPSAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVIIRDRTIIG
LPXD1_FRATT      PTAKIGKNVSIGPSAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVIIRDRTIIG
LPXD1_FRATH      PTAKIGKNVSIGPGAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVTIRDRTIID
LPXD1_FRATO      PTAKIGKNVSIGPGAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVTIRDRTIID
LPXD_FUSNN       DSAKIGENVDIAPNVYIGHDVVIGNNVKIFPNVTIGEGSIIGDGTVIYSNVSIREFVEIG
LPXD_AQUAE       KELEIGMGSFIGDFVVIGKNVKIGRNVKIYPFTYVGDNTVIGDNTVIFSGVHIYRNTVIG
LPXD1_LEGPA      AEVQLGDEVYVGPFVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTIYDNCRIG
LPXD1_LEGPH      AEVQLGDEVYVGPFVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTIYDNCRIG
LPXD1_LEGPL      AEVQLGDEVYVGPFVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTIYDNCRIG
LPXD_RHOBA       PTAKVDPTCQVHPSANIGANVEIGPGCTIAPGVNIGAGCQIGADCTLHPNVTLYAYCQLG
LPXD_CAMJR       KVQNIAKSARIMPNVYIGDNVNIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIG
LPXD_CAMJE       KVQNIAKSARIMPNVYIGDNVNIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIG
LPXD1_SULDN      E-PKIGEGTTISPRAEIARGAIIGKGCTIMAHVYIGTNAVIGDNTIIYPSVTVYRDCRVG
LPXD2_SULDN      S-ATIGEGSMIDSMVRVENGTCIGSNVIVMAGAYIGANCVIGDDTTIYPNVTIYRDTIIG
LPXD_HELPH       SEPKHFKKVTIMPNVMIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILE
LPXD_HELPY       NEPKHFERVTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVTLYQNTILE
LPXD_HELPJ       NEPKHFEKVTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILE
LPXD_HELHP       QNP-RTNNIQIGANVVIGDNVSIGEHSIIMPNVVIGDNVSIGEHCKIYPNVVIYRDSIIG
LPXD_WOLSU       QEPQIAPSAQIAPSATIGKGAVIGERTIVMAGAVIGEGVCLGEDCLIYPNVVIYRDTQIG
LPXD_GRABC       ETACIDPSAQIGPLAVIEAGVEIGPDCRIAAHAVIGAGVKMGRSCRIGSHASL-SHAILG
LPXD_MAGSA       ASAAVGEGCRIEPGAVIGAGARIGARCRIGANVVIGQGVVLGDDCTIGANATV-SHALVG
LPXD_CHESB       EGAVVEDGAIIEAGAVIGVGASVGRGTIVGPNTVIGARCSIGRDGYVGPNVML-QYAVIG
LPXD_RHILO       PTAHVEAGAIIEAGVVIGPGVSIGSGTVIAPNAVIGQSCQIGRDGYVGPGASI-QYALIG
LPXD_BARHE       PSAKLAGDVCIEAGAVIGRNVEIGSGSLIASTAVIGENCRIGCDCYIAPKVTV-QYSLIG
LPXD_BARQU       PSAKFGHDVCIEAGAVIGKNVEIGSGSLISSTAVIGENCRIGRDCYIAPKVTV-QYSLIG
LPXD_BRUAB       PTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSV-QCAFIG
LPXD_BRUA2       PTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSV-QCAFIG
LPXD_BRUME       PTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSV-QCAFIG
LPXD_BRUSU       PTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSV-QCAFIG
LPXD_NITHX       PSAHLEDAVVVDPLAVIGPGVEIGTGSVIGSGAVIGPGVRIGRNCNVGAGTTI-QVALIG
LPXD1_NITWN      PSAYLEDEVVIDPLAVIGPDVQIGRGSVIGSGAVIGPGVRIGRDCNVGAGTTI-QATLIG
LPXD_BRADU       PTARLEDGVIVDPLAVIGADVEIGSGTVVGVGAVIGPGVKIGRDCNVGARTAI-QCALIG
LPXD_RHOP2       PSARLEDGVIVDPLAVIGPDVEIGAGSVIGAGAVIASGVKIGRDCNVGANTTI-QFSLIG
LPXD_RHOPS       ATARLEDGVIVDPLAVIGPEVEIGAGSVIGAGSVIASGVKIGRDCNVGANTTI-QFALIG
LPXD1_RHOPB      PTARLEDGVTVDPLAVIGPQVEIGAGSVIGSGAVLSPGVRIGRDCNVGAGTVI-QFALIG
LPXD_RHOPA       ETAKLEDEVTVEPLAVIGPDVEIGSGTVIGAGAVIAAGVKIGRDCDIGAGSHL-QHALIG
LPXD2_RHOPB      PSAKLAAGVTVDPGAVIGPRAEIGKGSLIGANAVIGPHVKIGADCAIGAGCTV-THSEIG
LPXD2_NITWN      ASAIVGHGVTIDPGASVGPNARIGGFTCIGSNAVIGPSVRIGRNCYIGANVTV-AYAVVG
LPXD_RHIEC       PSAKLEKGVIVEPLAVIGPHAEIGEGTRIGANSVIGPDVKIGRDCSIAAGASI-LCALIG
LPXD_RHIL3       PSARLEKGVIVEPMAVIGAHAEIGEGTRIGAHSIIGPNVKIGRDCSIAAGASI-ICALLG
LPXD_AGRFC       PSAKLEPGVIVEPMAVIGAGVHIGAGTRIGPGVVIGSDVQIGRDCTIAGGASI-LAALLG
LPXD_RHIME       PTARLEAGVEVEPMAVIGAGAEIGSGTRIAAGAMIGQGVRIGRDCTISAGASI-LCALIG
LPXD_HYPNA       ALAQIHANAIVQPGAVIGPGAAVGEGAVIGANAVIGPGVQIGRNTSIGANASI-HCALVG
LPXD_CAUVC       PDAALEDGVALAPNVTIGQGASIGRGTRIGPGVVIGPGVVIGRYCRIGANAVI-GFAMLG
LPXD_MARMM       PSAKIGAGTRLGAGVVIGEGAEIGTDCVIGPHCVIGPGCRIGDRSRLSPHVSL-QCSDIG
LPXD2_LEGPH      SSAIIGVDCFIAHGAYIGNQVKIGNRCKIGVNTYIGDTVTIGDDCLIEDNVSI-RHAVIG
LPXD2_LEGPL      TSAVIGSNCYIAHGVYIGNNAKIGSGCQIGVNTYIGDGVTIGDDCLIEDNVSI-RHAVIG
LPXD2_LEGPA      STALIGSDCSIAHGAYVGNHARIGKRCKIGVNTYIGDGVTIGDNCIIEDNVSI-RHAVIG
LPXD_RICCN       DSATIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVNIGRNARIEQHVSI-NYAIIG
LPXD_RICRI       DSATIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVNIGRNARIEQHVSI-NYAIIG
LPXD_RICFE       DSATIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVTIGRNARIEQHVSI-NYTIIG
LPXD_RICPR       DSATIGKNCYIGHNVVIEDDVIIGDNSIIDAGTFIGRGVNIGKNARIEQHVSI-NYAIIG
LPXD_RICTY       DSAAIGKNCYIGHNVVIEDDVIIGDNSIIDAGTFIGRGVNIGKNARIEQHVSI-NYAIIG
LPXD_RICBR       ESATIGKNCYVGHNAVIEDNVVIGDDSIIEAGSFIGTGVVIGRNARIESNVSI-NYSVIG
                           :                       :     :                 : 

LPXD1_KORVE      NNVILQNGVVIGADGYGFARDTDG--------WYKIAQSGTTILDDNVEVQANSTVDRAS
LPXD2_GLOVI      EDCIVQNGAVIGADGFGYAKQADGT-------WYKIVQSGSVVLENRVEIGACTTVDRAT
LPXD_THEEB       DRVILQNSVVLGSDGFGYVPLPDGR-------HYKIPQVGTVVIGNDVEIGAGTTIDRAT
LPXD_TRIV2       ADCVIHSGAVIGGEGFGFVPTRTG--------WYKMEQSGYVVLEDRVDIGCNTTIDRPS
LPXD_NOSS1       ADCIIHSGAVIGGEGFGFVPTRTG--------WYKMEQSGYVVLEDRVDIGCNTTIDRPS
LPXD_TRIEI       KGCVIHSGAVIGGEGFGFVPTPEG--------WFKMEQSGKVILEDGVEVGGNTTIDRPA
LPXD_SYNP6       QDCVIHSGAVIGAEGFGFVPTASG--------WFKMEQSGIVVLEDGVEVGCNSAIDRPA
LPXD_SYNE7       QDCVIHSGAVIGAEGFGFVPTASG--------WFKMEQSGIVVLEDGVEVGCNSAIDRPA
LPXD_SYNY3       QGCVIHSGAAIGAEGFGFVPTPEG--------WFKMEQSGQVVLEDGVEIGCNSAVDRPA
LPXD3_GLOVI      DECIVQSGAVVGGEGFGFVPTPEGT-------WHKMPQSGYVRVEDQVEIGSNAAIDRPS
LPXD_SYNJA       DDCLIHSGAVIGDDGFGHIPLPDGS-------WRRMLQAGRVVLEDGVEVGSNTTIDRAA
LPXD_SYNJB       DDCLIHSGAVIGDDGFGHIPLADGS-------WRRMLQAGRVVLEDNVEVGSNTTIDRAA
LPXD_PROM9       NNCVINSNSVIGSEGFGFIPKDDK--------WVKMPQKGGVKIMSFVEIGTNCCIDRPA
LPXD_PROMP       NNCVINSNTVIGSEGFGFIPQDGK--------WIKMPQKGCVIIKSFVEIGTNCCIDRPS
LPXD_PROMA       DNCIINSNAVIGSEGFGFIPTKRG--------WRKMPQTGKVILGDNVEIGSCSTVDRPA
LPXD_PROMT       DKCVINANAVIGGEGFGFVPTSNG--------WKKMPQVGIVILKNKVEVGSGSTIDRPS
LPXD_SYNPX       RRCVVNSNAVVGSEGFGFVPTAKG--------WRKMPQTGQVVLEDGVEVGCGSTIDRPS
LPXD_SYNSC       RGCVVNSNAVVGSEGFGFVPTAKG--------WRKMPQTGQVVLEDGVEVGCGTTIDRPS
LPXD_SYNS9       RGCVVNSNAVIGSEGFGFVPTPRG--------WRKMPQTGQVVLEDGVEVGCGSTIDRPS
LPXD_PROMM       LNCVVHSNAVVGSEGFGFVPTANG--------WRKMPQTGLVVLEDGVEVGCGSTIDRPS
LPXD_DESAG       DDCVLHSGVVLGADGFGFARTEY-G-------IQKIPQIGRVHVGNDVEIGANTAIDRAV
LPXD_DESVH       DDCILHAGVVLGADGFGFARTEF-G-------IQKIPQVGTVRIGSDVEIGANTTIDRSV
LPXD_LAWIP       NDCIIHAGVVLGSDGFGFALTE--E-------KQKIPQVGNVIIKDKVEIGANTTVDRGT
LPXD_NITOC       HRVILHPGVVIGGDGFGFAPDPPQG-------YFKVPQVGWVEIADDVEVQCNTAIDRGA
LPXD_ANADE       NRVILQPGCVVGSDGFGFAFDPDGEG--KGPRHYKVPQVGNVVIEDDVEVGANTCVDRAT
LPXD_MYXXD       ARVILHASSVVGADGFGFAFNPEGE---AGPEHFKIPQVGIVRIEDDVEVGACTCIDRAT
LPXD_SYNAS       KRVILHAGAVVGSDGFGFAN--------PGRDNIKIPQIGIVQIDDDVEIGANTTIDRAT
LPXD_GEOMG       NRVTIHAGTIIGSDGFGYAP--------DGDGFYKIPQLGIVVIEDDVEVGANTTIDRAA
LPXD_GEOSL       NRVTIHGGTIIGSDGFGYAP--------DGDGWYKIPQLGNVVIEDDVEIGANAAIDRAA
LPXD_PELCD       NRVVVQPGAVIGSDGFGFAP--------DGKSYYKIPQVGIVAIEDDVEVGANVCIDRAA
LPXD1_GLOVI      DRVVIHAGSVLGSDGYGFVP--------TGERHLKVPQVGTVVIGDDVEVGANVAVDRAT
LPXD_DESPS       NGVTIHSGTVIGSDGYGYATD-------KMGFHYKRPQVGTVRVDDNVEIGANSCVDRAT
LPXD_PSE14       KHVVIQSGAVLGGEGFGFANEKG--------VWQKIAQIGGVTLGDDVEVGVNTAIDRGA
LPXD_PSESM       KRVVIQSGAVLGGEGFGFVNDKG--------VWQKFAQIGGVTLGDDVEIGVNTAIDRGA
LPXD_PSEU2       KRVVIQSGAVLGGEGFGFAQDKG--------IYHKVAQIGGVTLGDDVEVGVNTAIDRGA
LPXD_PSEF5       KRVVIQSGAVLGGEGFGFANEKG--------VWQKIAQIGGVTIGDDVEIGVNTAIDRGA
LPXD_PSEPF       KRVVIQSGAVLGGEGFGFANEKG--------VWQKIAQIGGVTIGDDVEIGVNTAIDRGA
LPXD_PSEPK       KRVVIQSGAVIGGEGFGFANEKG--------IWRKIAQIGGVTIGDDVEIGVNTAVDRGA
LPXD_PSEAE       ARVSIQSGAVIGGEGFGFANEKG--------VWQKIAQIGGVTIGDDVEIGANTTIDRGA
LPXD_HAHCH       ARALIHSGAVIGSDGFGFAPNKG--------DWAKIAQLGGVVIGDDVEIGANTTIDRGA
LPXD_CHRSD       RRAILHSGCVIGADGFGFAHDGQ--------GWHKIAQLGGVIVGDDVEIGSCSSIDRGA
LPXD_ALCBS       PRTTIHANCVIGGDGFGFAFNGA--------GWTKLHQVGGVTIGADVEIGAGTTVDRGA
LPXD_XANC5       KRVRIHPGAVIGADGFGLAMDAG--------HWIKVPQLGGVVIGDDCEIGANTCIDRGA
LPXD_XANAC       KRVRIHPGAVIGADGFGLAMDAG--------HWIKVPQLGGVVIGDDCEIGANTCIDRGA
LPXD_XANOM       KRVRIHPGAVIGADGFGLAMDAG--------HWIKVPQLGGVVIGDDCEIGANTCIDRGA
LPXD_XANOR       KRVRIHPGAVIGADGFGLAMDAG--------HWIKVPQLGGVVIGDDCEIGANTCIDRGA
LPXD_XANC8       KRVRVHPGAVLGADGFGLAMDAG--------HWIKVPQLGGVVIGDDCEIGANTCIDRGA
LPXD_XANCP       KRVRVHPGAVLGADGFGLAMDAG--------HWIKVPQLGGVVIGDDCEIGANTCIDRGA
LPXD_XYLFA       KRVRIHPGAVLGGEGFGLAMENG--------HWIKIPQLGGVVIGDDCEIGANSCIDRGA
LPXD_XYLFT       KRVRIHPGAVLGGEGFGLAMESG--------HWIKIPQLGGVVIGDDCEIGANSCIDRGA
LPXD_BLOPB       ECCLIQSGAIIGSDGFGYINDHG--------VWIKIPHLGTVKIGNNVEIGACTTIDRGT
LPXD_BLOFL       EYCIIQSGSIIGSDGFGYIKNDG--------VWIKIPQLGKVSIGNNVEIGSCTTIDRGT
LPXD_ECOL5       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_SHIBS       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_SHISS       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_ECOL6       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_ECO57       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_SHIFL       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_SHIDS       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_ECOLI       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_ECOUT       QNCLIQSGTVVGADGFGYANDRG--------NWVKIPQIGRVIIGDRVEIGACTTIDRGA
LPXD_SALTI       ENCLIQSSTVIGADGFGYANDRG--------NWVKIPQLGRVIIGDRVEIGACTTIDRGA
LPXD_SALTY       ENCLIQSSTVIGADGFGYANDRG--------NWVKIPQLGRVIIGDRVEIGACTTIDRGA
LPXD_SALPA       ENCLIQSSTVIGADGFGYANDRG--------NWVKIPQLGRVIIGDRVEIGACTTIDRGA
LPXD_SALCH       ENCLIQSSTVIGADGFGYANDRG--------NWVKIPQLGRVIIGDRVEIGACTTIDRGA
LPXD_PECAS       EHCLIQSGTVIGSDGFGYANDRG--------NWVKIPQLGTVRIGDQVEIGASTTIDRGA
LPXD_SODGM       ERCLIQSGTVIGADGFGYANDRG--------NWIKIPQLGRVIIGDRVEIGACTTIDRGA
LPXD_YERPA       QNCLIQSGTVIGADGFGYANDRG--------NWVKIPQLGSVHIGDRVEIGACTTIDRGA
LPXD_YERPN       QNCLIQSGTVIGADGFGYANDRG--------NWVKIPQLGSVHIGDRVEIGACTTIDRGA
LPXD_YERPE       QNCLIQSGTVIGADGFGYANDRG--------NWVKIPQLGSVHIGDRVEIGACTTIDRGA
LPXD_YERPS       QNCLIQSGTVIGADGFGYANDRG--------NWVKIPQLGSVHIGDRVEIGACTTIDRGA
LPXD_YEREN       QNCLIQSGTVIGADGFGYANDRG--------NWIKIPQLGSVHIGDRVEIGACTTIDRGA
LPXD_PHOLL       EQCLIQSGAVIGSDGFGYANDRG--------KWVKIPQLGSVIIGDRVEIGACTTIDRGA
LPXD_WIGBR       NNCSIQSGSVIGSDGFGYANKNG--------SWIKIPHLGKVVIGNNVEIGSSTTIDRGS
LPXD_HAEI8       ANCLIQSGTVIGSDGFGYANDRG--------RWIKIPQVGQVIIGNNVEIGANTCIDRGA
LPXD_HAEIN       ANCLIQSGTVIGSDGFGYANDRG--------RWIKIPQVGQVIIGNNVEIGANTCIDRGA
LPXD_PASMU       QHCLIQSGAVIGSDGFGYANDRG--------RWIKIPQVGQVIIGNHVEIGACTCIDRGA
LPXD_HAES1       SDCLIQSGAVIGSDGFGYANDRG--------RWIKIPQTGTVIIGNHVEIGACTCIDRGA
LPXD_MANSM       SDCLIQSGAVIGGDGFGYANERG--------QWIKIPQTGSVIIGNHVEIGACTCIDRGA
LPXD_HAEDU       SDCLIQSSAVIGSDGFGYANDKG--------RWIKIPQTGGVIIGNRVEIGACTCIDRGA
LPXD_ALIF1       EACLVQSGTVIGSDGFGYANDRG--------TWVKIPQLGSVIIGDNVEIGANTTIDRGA
LPXD_PHOPR       SDCLVQSGAVIGSDGFGYANDRG--------KWVKIPQLGSVHVGNNVEIGACTTIDRGA
LPXD_VIBVU       ADCLIQAGTVIGSDGFGYANDRG--------EWIKIPQLGSVRIGNRVEIGACTTIDRGA
LPXD_VIBVY       ADCLIQAGTVIGSDGFGYANDRG--------EWIKIPQLGSVRIGNRVEIGACTTIDRGA
LPXD_VIBPA       DDCLVQSGTVIGSDGFGYANDRG--------EWIKIPQLGSVRIGNRVEIGACTTIDRGA
LPXD_VIBCH       SDCLIQSGTVIGADGFGYANERG--------EWIKIPQLGSVRIGDRVEIGACTTIDRGA
LPXD_COLP3       HHCLIQASTVIGSDGFGYAPVKGQ------YKWHKIPQLGSVIIGDHVEIGASTTIDRGA
LPXD_PSEA6       QDCLIQSATVIGADGFGYANDKG--------RWVKIPQLGTVILGDRVEVGASSTIDRGA
LPXD_PSET1       SDCLLQANSVIGSDGFGYANERG--------QWIKIPQLGSVIIGDKVEIGASTTIDRGA
LPXD_IDILO       DDCLFHSGSIIGADGFGWAPDNG--------KWLKIPQLGRVVIKDNVEIGASTTVDRGA
LPXD_SHESM       QDCIIHSGAIIGSDGFGYANERG--------QWIKIPQTGGVRIGDRVEIGASSTIDRGA
LPXD_SHESR       QDCIIHSGAIIGSDGFGYANERG--------QWIKIPQTGGVRIGDRVEIGASSTIDRGA
LPXD_SHEON       QDCIIHSGAIIGSDGFGYANERG--------QWIKIPQTGGVRIGDRVEIGANSTIDRGA
LPXD_SHEFN       HDCIVHSGTVIGSDGFGYANERG--------NWVKIPQTGGVRIGNHVEIGACTSIDRGA
LPXD_SHEDO       QNCIIHSGAVLGSDGFGYANERG--------TWVKIPQTGGVRIGDNVEIGANTAVDRGA
LPXD_SACD2       NKVLIHSGTVIGSDGFGFAPSAE--------GWVKIHQLGGVVIGNNVEIGSNTSIDRGA
LPXD_ALKEH       CRVILHPGVVVGADGFGFAKGPGK------AGWRKVPQLGRVILGDDVDLGANTTVDRGA
LPXD_AROAE       RDCIVHAGAVIGADGFGFARERDG-------SWVKIPQVGRVVIGDDVEIGANTTIDRGA
LPXD_DECAR       QQCIIHSGAVIGSDGFGFAPEGQ--------SWIKIPQIGRVVIGNDVEIGANTTIDRGA
LPXD_METFK       ERCNIFSGSVIGGDGFGYAPEEG--------RWVKIPQVGRVVIEHDVDIGANTTIDRGA
LPXD_THIDA       DRVILHAGCVIGADGFGFAPNEG--------RWEKIPQIGRVLIGDDVEVGACTTIDRGA
LPXD_BORBR       ERAIIHSGAVLGADGFGFAPDP----TLGRGAWGKIPQLGGVRVGNDVEIGANTTIDRGA
LPXD_BORPA       ERAIIHSGAVLGADGFGFAPDP----TLGRGAWGKIPQLGGVRVGNDVEIGANTTIDRGA
LPXD_BORPE       ERAIIHSGAVLGADGFGFAPDP----TLGRGAWGKIPQLGEVRVGNDVEIGANTTIDRGA
LPXD_BORA1       ARAIIHSGAVLGADGFGFAPDP----TLGKGAWGKIPQLGGVTVGNDVEIGANTTIDRGA
LPXD_POLSJ       ERCIVHPGAVIGADGFGFAPH--------QGQWIKIEQLGAVKIGNDVEIGANTCIDRGA
LPXD_RHOFT       ERCLLHSGVVIGADGFGFAPH--------AGAWEKIEQLGAVRIGNDVEIGANTCIDRGA
LPXD_BURCA       PRAIVHAGAVIGSDGFGFAPDFVGDGDARTGSWVKIPQVGGVTIGPDVEIGANTTIDRGA
LPXD_BURL3       PRAIIHAGAVIGSDGFGFAPDFVGDGDARTGSWVKIPQVGGVTIGPDVEIGANTTIDRGA
LPXD_BURP1       PRAIVHSGAVIGSDGFGFAPDFVGEGDARTGAWVKIPQVGGVKVGPDVEIGANTTIDRGA
LPXD_BURPS       PRAIVHSGAVIGSDGFGFAPDFVGEGDARTGAWVKIPQVGGVKVGPDVEIGANTTIDRGA
LPXD_BURMA       PRAIVHSGAVIGSDGFGFAPDFVGEGDARTGAWVKIPQVGGVKVGPDVEIGANTTIDRGA
LPXD_BURTA       PRAIVHSGAVIGSDGFGFAPDFVGEGDARTGAWVKIPQVGGVKVGPDVEIGANTTIDRGA
LPXD_PARXL       ERVIVHAGAVIGSDGFGFAPDFVGEGDARTGSWVKIPQVGGVSIAADVEIGANTTIDRGA
LPXD_CUPPJ       ARAILHSGVVIGADGFGFAPDIGPTG----VEYVKIPQTGRAVLGNDVEVGANTAIDRGA
LPXD_CUPMC       ARNILHSGAVIGADGFGFAPDIGPTG----VEYVKIPQVGRAVLGNDVEIGANTAVDRGA
LPXD_RALSO       ARCILHSGVVIGADGFGFAPDFGPQG----GEWVKIPQTGRAIVGDDVEIGANTAIDRGA
LPXD2_FRAT1      TGCIIHQNAVIGCDGFGNARDEDG-------SWTKIPQLGRVIIEDDVEIGSGTTVDRGA
LPXD2_FRATH      TGCIIHQNAVIGCDGFGNARDEDG-------SWTKIPQLGRVIIEDDVEIGSGTTVDRGA
LPXD2_FRATO      TGCIIHQNAVIGCDGFGNARDEDG-------SWTKIPQLGRVIIEDDVEIGSGTTVDRGA
LPXD2_FRATT      TGCIIHQNAVIGCDGFGNARDEDG-------SWTKIPQLGRVIIEDDVEIGSGTTVDRGA
LPXD_COXBU       DRSIIHSGAVIGADGFGLIQDEKG-------EWVKIPQVGRVIIGDDVEIGANATIDRGA
LPXD_NEIG1       RHVEIHSGAVIGADGFGLAFAGD--------SWFKIPQTGAVTLGDDVEIGSNTNIDRGA
LPXD_NEIMA       RRVEIHSGAVIGADGFGLAFAGD--------SWFKIPQTGAVTLGDDVEIGSNTNIDRGA
LPXD_NEIMB       RRVEIHSGAVIGADGFGLAFADD--------SWFKIPQTGAVTLGDDVEIGSNTNIDRGA
LPXD_CHRVO       NRVGVHSGSVIGGDGFGLAWDKD--------HWFKIPQTGRVVLEDDVEIGANTTVDRGA
LPXD_PSYA2       NHVRLHAGVSIGSEGFGFAPTRNPS----VTGWERIAQLGRVLIGNHVRIGSQTCIDRGA
LPXD_PSYCK       SHVRLHAGVTIGSEGFGFAPTANPS----VTGWERIAQLGRVLIGDHVRIGSQTCIDRGA
LPXD_ACIAD       DRVRIHANTVIGSEGFGFAPYQGK--------WHRIVQLGTVQIGHDVRIGSNCSIDRGA
LPXD_HYDCU       EEGYLDPGCVIGGQGFGFANEQGE--------WHKIPQIGRVVIGDRVFVGVNANIHRGA
LPXD_BACFN       NNCILHAGCVIGADGFGFAPTPQG--------YEKIPQIGIVILEDNVEVGANTCIDRAT
LPXD_BACFR       NNCILHAGCVIGADGFGFAPTPQG--------YEKIPQIGIVILEDNVEVGANTCIDRAT
LPXD_BACTN       NECILHSGAVIGADGFGFAPTPNG--------YDKIPQIGIVILEDKVDIGANTCVDRAT
LPXD_PORGI       SRCVIHSGAVIGADGFGFAPNAEG--------YSKIPQLGNVIIEDDVEIGANTCIDRAV
LPXD_CYTH3       NQVTIHSGCVIGSDGFGFAPQADGT-------YKTIPQIGNVVIGNHVDIGANTVIDCAT
LPXD_CHLCH       NRVVIHSGAVIGADGFGFAPQQDGS-------YIKIPQIGIVEIGDDVEIGANTTIDRAT
LPXD_PELLD       DRVVIHAGSVIGADGFGFAPQPDGS-------YVKIPQMGVVEIGDDAEIGANATIDRAT
LPXD_CHLTE       DRVTIHSGTVVGADGFGFAPQKDGS-------YIKIPQMGTVEIGDDVEIGANTTIDRAT
LPXD2_KORVE      NHVIIHAGAVLGSDGFGYVRDKLTG------RYHQMPQIGHLIVGDHVDIGANVTIDRGG
LPXD_METCA       AGCILKPGCVIGSEGFGFAQDAQR-------RNYRIPHTGKVIIEDRVVIGANTTIDRAT
LPXD_CHLAB       KRVIIQPGAVIGSCGFGYITNAFG-------RHKHLKHLGKVIIEDDVEIGANTTIDRGR
LPXD_CHLFF       KRVIVQPGAIIGACGFGYITNAFG-------RHKHLKHLGQVIIEDDVEIGANTTIDRGR
LPXD_CHLCV       KRVIVQPGAVIGSCGFGYITNAFG-------RHKHLKHLGKVIIEDDVEIGANTTIDRGR
LPXD_CHLPN       NRVVVQPGAVLGSCGFGYITNAFG-------HHKPLKHLGYVIVGDDVEIGANTTIDRGR
LPXD_CHLTA       KRVIIQPGAVIGSCGFGYVTSAFG-------QHKHLKHLGKVIIEDDVEIGANTTIDRGR
LPXD_CHLTR       KRVIIQPGAVIGSCGFGYVTSAFG-------QHKHLKHLGKVIIEDDVEIGANTTIDRGR
LPXD_CHLMU       KRVIIQPGAIIGSCGFGYVTSAFG-------QHKHLKHLGTVIIEDDVEIGANTTIDRGR
LPXD_PARUW       NRVILQPGVVIGSCGFGYTTNQQG-------QHIKLNQVGNVWVENDVEIGANTTIDRAR
LPXD1_FRAT1      HFCRLCSNCSIGSDGFGYRPSEDGR------TIVRIPHIGNVVIGSFVDIGSNTCINNAK
LPXD1_FRATT      HFCRLCSNCSIGSDGFGYRPSEDGR------TIVRIPHIGNVVIGSFVDIGSNTCINNAK
LPXD1_FRATH      HFCRLYSNCSIGSDGFGYRPSEDGR------TIVRIPHIGNVVIGSFVDIGSNTCINNAK
LPXD1_FRATO      HFCRLYSNCSIGSDGFGYRPSEDGR------TIVRIPHIGNVVIGSFVDIGSNTCINNAK
LPXD_FUSNN       KNCVIQPGAVIGSDGFGFVKVNGN--------NTKIDQIGTVIVEDEVEIGANTTIDRGA
LPXD_AQUAE       RNVRIHSGAVIGADGFGYHITQEG--------IKKIPHIGGVIIEDNVEIGANTTIDRAL
LPXD1_LEGPA      SNVTIHASTVIGSDGFGYTFVDGQ--------HLKVPHSGYVVIENNVEIGANTAIDKAT
LPXD1_LEGPH      SNVTIHASTVIGSDGFGYTFVDGQ--------HLKVPHSGYVVIENNVEIGANTAIDKAT
LPXD1_LEGPL      SNVTIHASTVIGSDGFGYTFVDGQ--------HLKVPHSGYVVIENNVEIGANTAIDKAT
LPXD_RHOBA       ERVTLHAGTVVGAHGFGYKMVDGR--------HIPTAQLGYVVIENDVEVGASSTIDRGT
LPXD_CAMJR       KKCHLLANCVIGSDGFGYAHNKNG-------EHYKIYHNGNVVLEDFVEVGACTTIDRAV
LPXD_CAMJE       KKCHLLANCVIGSDGFGYAHNKNG-------EHYKIYHNGNVVLEDFVEVGACTTIDRAV
LPXD1_SULDN      SECIIHANTTIGSDGFGFATNKQG-------EHRKIYQNGNVEIEDNVEIGSSTTIDRAV
LPXD2_SULDN      KECIIHAGVVIGADGFGFSHTKEG-------EHIKIYQNGNVIIEDCVEIGANCAIDRAV
LPXD_HELPH       DNVTIHAGSVIGGDGFGYAHTALG-------EHVKIEHVGIVRIQKNVEIGANTAIDRAV
LPXD_HELPY       DNVTIHAGSVIGGDGFGYAHTALG-------EHVKIEHVGIVRIQKNVEIGANTAIDRAV
LPXD_HELPJ       DNVIIHAGSVIGGDGFGYAHTALG-------EHVKIEHVGIVRIQKNVEIGANTAIDRAV
LPXD_HELHP       NRVNIHAGSIIGCDGFGYAHTAEG-------KHIKIEHNGRVVIEDDVEIGANNTIDRAV
LPXD_WOLSU       NRVFIHAGSVIGSDGFGYAHTERG-------EHIKIHHNGIVVIEDDVELGANNCIDRAV
LPXD_GRABC       DRVYVYPGVRIGQDGFGFAPSSE--------GFVTVPQLGRVVLENDVEVGANSTIDRGS
LPXD_MAGSA       SRVNIYPGARIGQDGFGFAMGPQ--------GHLKVPQLGRVLIGNNVEIGANTTIDRGA
LPXD_CHESB       DRVIIHPGAQIGQDGFGFLPGPN--------GFEKNPQIGRVIIQDDVEIGANTTIDRGA
LPXD_RHILO       NRVIIHGGARIGQDGFGFVGGAK--------GPERVPQIGRVVIQDDVEIGSNSTVDRGA
LPXD_BARHE       DKVHLYPGACIGQDGFGYIGGAS--------GIEKVPQLGRVIIEDGVEIGANTTIDRGT
LPXD_BARQU       DRVYLYPGTCIGQDGFGYVGGAS--------GIEKVPQLGRVIIKDGVEIGANTTIDRGT
LPXD_BRUAB       NNVSLHPGVRIGQDGFGYVPGAA--------GLDKVPQLGRVIIQDNVEIGANTTVDRGS
LPXD_BRUA2       NNVSLHPGVRIGQDGFGYVPGAA--------GLDKVPQLGRVIIQDNVEIGANTTVDRGS
LPXD_BRUME       NNVSLHPGVRIGQDGFGYVPGAA--------GLDKVPQLGRVIIQDNVEIGANTTVDRGS
LPXD_BRUSU       NNVSLHPGVRIGQDGFGYVPGAA--------GLDKVPQLGRVIIQDNVEIGANTTVDRGS
LPXD_NITHX       NNVLIHPGCHIGQDGYGFIFFGSE-------GHVKVPQTGRVLIQNDVEIGAGTTIDRGS
LPXD1_NITWN      NNVLIHPGCHIGQDGYGFIFFGSE-------GHVKVPQTGRVLIQNDVEIGAGTTIDRGS
LPXD_BRADU       NDVLIHPGCSIGQDGYGFIFFGPE-------GHLKVPQTGRVLIQNNVEVGAGTTIDRGS
LPXD_RHOP2       NNVLIHPGCHIGQDGFRFIFART---------HQKVPQVGRVIIQNDVEIGSGTTVDRGG
LPXD_RHOPS       NNVLIHPGCHIGQDGFRFIFAQT---------HQKVPQVGRVIIQNDVEIGSGTTVDRGG
LPXD1_RHOPB      NNVLIHPGCQIGQDGYGFIFAET---------HQKVPQTGRVIIQNDVEIGAGTTIDRGS
LPXD_RHOPA       NNVLMHPGCHIGQDGFGFIFAGQ---------HTKVPQTGRVIIQHDVELGAGTTIDRGS
LPXD2_RHOPB      DRVIVHPGSQIGQDGFGYISSAN--------GHTKVPQIGRVVIHDDVEIGAGSNIDRGG
LPXD2_NITWN      DRVIIHPGTSIGQDGFGFTFLGG--------KWVKVPQVGGVIIQDDVEVGANTTIDRGS
LPXD_RHIEC       NGVVIHNGVRIGQDGFGYAPGPRG--------MIKIVQIGRVIIQDNVEIGANTTIDRGA
LPXD_RHIL3       NGVIIHNGARIGQDGFGYAPGPRG--------MIKIVQIGRVIIQDNVEIGANTTIDRGA
LPXD_AGRFC       NNVIIHNGARIGQDGFGYAPGPRG--------MLKIVQIGRVIIQDHVEVGANTTIDRGT
LPXD_RHIME       NNVIIHPGARIGQDGFGYAPGPKG-------GMIKIVQVGRVIIQDHVEIGANTTIDRGT
LPXD_HYPNA       DQVTILAGARIGETGFGVLVGPQ--------GAEDSPHFGRVIIQDHVTIGANSCIDRGV
LPXD_CAUVC       DNVAISAGAVIGEAGFGAALGPR--------GMVDLPQLGRVVIQDNVTLGANSCVDRGA
LPXD_MARMM       ADCNILAGAVIGEDGFGIAVSNG--------NTVGILHLGSVLIGDHVTIGANCTIDRGL
LPXD2_LEGPH      NNVVIYSGARIGQDGFGFASDAN--------GHYKIPHAGGVIIGNDVEIGANTCIDRGS
LPXD2_LEGPL      KHVVIYPGARIGQDGFGFASDAS--------GHYKIPHAGGVIIGNHVEIGANTCIDRGS
LPXD2_LEGPA      SNVVVYPGARIGQDGFGFASDAE--------GHYKIPHAGGVIIGNDVEIGANTCIDRGS
LPXD_RICCN       DDVVILAGAKIGQDGFGFSTEKG--------VHHKISHIGIVKIGNNVEIGANTTIDRGS
LPXD_RICRI       DDVVILAGAKIGQDGFGFSTEKG--------VHHKIFHIGIVKIGNNVEIGANTTIDRGS
LPXD_RICFE       DEVVILAGAKIGQDGFGFSTEKG--------VHHKIFHIGIVKIGNNVEIGSNITIDRGS
LPXD_RICPR       DDVVILVGAKIGQDGFGFSTEKG--------VHHKIFHIGIVKIGNNVEIGSNTTIDRGA
LPXD_RICTY       DDVVILVGAKIGQDGFGFATEKG--------VHNKIFHIGIVKIGNNVEIGSNTTIDRGA
LPXD_RICBR       DDVVILSGAKIGQDGFGFSTEKG--------MHHKIFHTGIVKIGNNVEIGANTTIDRGS
                     .     :*  *:                     : *   :     :     :.   

LPXD1_KORVE      IGETHIYADAKIDNLVMIGHGSSVGEHSLLCSQVGLAGSSHVGKNVILAGQVGVAGHLHI
LPXD2_GLOVI      IGETRIKSGSKLDNLVMIGHGSSVGENTLLCGQVGLAGSSTVGRNVMLAGQVGVAGHLHI
LPXD_THEEB       LGETTVANGTKIDNLTMVAHNCTIGENAILCAQVGLAGSTHIGNHVVLAGQVGAAGHLTI
LPXD_TRIV2       VGETRVGYDTKIDNLVQIAHGCQIGAGCAIAAQTGMAGGVKLGNRVILAGQVGIANQAKM
LPXD_NOSS1       VGETRVGYDTKIDNLVQIAHGCQIGAGCAIAAQTGMAGGVKLGKRVILAGQVGIANQAKM
LPXD_TRIEI       VGETRIGKNTKLDNLVQIGHGCKIGKNCALAAQVGLAGGVKLGDNVILAGQVGVANQAKI
LPXD_SYNP6       VGETRIGAQTKLDNLVHIGHGCQIGKACAMAAQVGLAGGVEVGDRVILAGQVGVANRVKI
LPXD_SYNE7       VGETRIGAQTKLDNLVHIGHGCQIGKACAMAAQVGLAGGVEVGDRVILAGQVGVANRVKI
LPXD_SYNY3       VGETRIGKNTKLDNMVHVAHGCRIGEACALAGQVGLAGGVTIGNRVILAGQVGVADKSEI
LPXD3_GLOVI      VGFTHIGRGTKIDNLVMVGHGCEIGEHCLLVGQVGLAGGVKLGRNVVLAGQVGVAGHAAI
LPXD_SYNJA       VGETRIGRGTKIDNLVQIGHGVKTGSHCLIVAQVGIAGSTQLGHHVILAGQCGLAGHLHI
LPXD_SYNJB       VGETRIGRGTKIDNLVQIGHGVRTGSHCLIVAQVGIAGSTQLGHHVILAGQCGLAGHLHI
LPXD_PROM9       VGITFIDEGTKLDNLVQIGHGVKIGKNCAFAAQVGIAGGAKIGDRVILAGQVGVNNRVKV
LPXD_PROMP       VGNTFIDEGTKMDNLVQIGHGVKIGKNCAFAAQVGIAGGAVIGNSVILAGQVGVNNRVKV
LPXD_PROMA       VGDTVIGSGTKIDNLVQVGHGVQIGNHCAMASQVGIAGGAKIGDGVILAGQVGVGNRVKV
LPXD_PROMT       VGETIIGEDTKIDNLVQIGHGVTTGKGCAMAAQVGIAGGAQIGDGVILAGQVGISNRVKI
LPXD_SYNPX       VGETRIGAGTKIDNLVQIGHGVSTGRGCAFAAQVGIAGGARIGHGVILAGQVGVANRAVV
LPXD_SYNSC       VGETRIGAGTKIDNLVQIGHGVTTGRGCAFASQVGIAGGARIGHGVILAGQVGVANRAVV
LPXD_SYNS9       VGETRIGAGSKIDNLVQIGHGVTTGRGCALASQVGIAGGAKLGHGVILAGQVGVANRAVV
LPXD_PROMM       VGETRIGAGTKIDNLVQIGHGVVTGQGCALASQVGIAGGARLGEGVILAGQVGVANRAVI
LPXD_DESAG       LGVTTIGDGTKMDNLVQVGHNVTIGNDCLIVAQVGISGSTHVGDRVTMAGQVGVAGHLTI
LPXD_DESVH       LGVTTVGDGTKIDNLVMLGHNVEMGRNCLIVSQVGISGSTKVGDDVTMAGQVGVAGHLSI
LPXD_LAWIP       LGTTTINENTKIDNLVQIGHGVTVGKNTVIVSQVGISGSTSIGDNCILAGQAGISGHLTI
LPXD_NITOC       LGPTRIGQGSKIDNLVQVGHNVEIGEHSIIVSQVGISGSSKIGNWVTLAGQVGLVGHIRI
LPXD_ANADE       LGSTRIGRGAKIDNLVQIAHNVQVGPLSLLVSQVGVAGSTKLGMGVVAGGQAGIVGHLEI
LPXD_MYXXD       VGETVVGRGAKLDNLVQIAHNVRVGPLSLICAQAGVSGSAEVGTGVVLAGQVGVVGHIRV
LPXD_SYNAS       LGRTWIQRGVKIDNLVQIAHNVVIGEKSIIVSQVGISGSTRLGRSVILGGQAGLVGHLQI
LPXD_GEOMG       LAATRIGRGTKIDNLVMIAHNCVIGENCTIVSQVGISGSTKLGRRVTLAGQVGVAGHLEI
LPXD_GEOSL       LASTVIGKGTKVDNLVMIAHNCVIGENCMIVSQVGISGSTKLGRRVTLGGQVGVAGHLEI
LPXD_PELCD       MGVTLIKRGTKIDNLVQIAHNVSIGEDTILVAQVGIAGSSKVGDHCTLGGQVGVSGHLKI
LPXD1_GLOVI      MGQTEIQAGTKIDNLVHIGHNDRIGRHCLIVSQVGLAGSVKVGDRTVIAGQAGVANQTTV
LPXD_DESPS       YGLTWIKSGAKIDNLVQIAHNVVVGENSLIVSQVGISGSTSLGRNVVMGGKAAAVGHLQI
LPXD_PSE14       LADTRIGNGVKLDNQIQIAHNVQVGDHTAMAACVGISGSTKIGKHCMLAGGVGLVGHIDI
LPXD_PSESM       LSDTRIGNGVKLDNQIHIAHNVQIGDHTAMAACVGISGSAKIGKHCMLAGGVGLVGHIDI
LPXD_PSEU2       LADTRIGNGVKLDNQIQIAHNVQIGDHTAMAACVGISGSTKIGKHCMLAGGVGLVGHIEI
LPXD_PSEF5       LADTVIGNGVKLDNQIQIAHNVQVGDHTAMAACVGISGSTKIGKHCMLAGGVGLVGHIDI
LPXD_PSEPF       LADTVIGNGVKLDNQIQIAHNVQVGDHTAMAACVGISGSTKIGKHCMLAGGVGLVGHIDI
LPXD_PSEPK       LSDTRIGDGVKLDNQIQIAHNVQIGDHTAMAACVGISGSTRIGKHCMLAGGVGLVGHIDI
LPXD_PSEAE       LSDTLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEI
LPXD_HAHCH       LDDTVIETGAKLDNQIQIAHNVKVGAYTVIAACVGVSGSSSIGKHCMIGGGVGIAGHLEI
LPXD_CHRSD       LGDTVIGNDVKIDSQVQIAHNVQIGDHSALAGCVGIAGSTRVGSHCMLGGGVGLSGHLTL
LPXD_ALCBS       IEDTIIGDGVILDNQIQVAHNVVIGDHTAIAGKAGIAGSAKIGSFCLIGGAAGIAGHIEV
LPXD_XANC5       LEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLEI
LPXD_XANAC       LEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLEI
LPXD_XANOM       LEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAGCSGIAGSAKIGRYCLLGGHVGVVGHLEI
LPXD_XANOR       LEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAGCSGIAGSAKIGRYCLLGGHVGVVGHLEI
LPXD_XANC8       LEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLEI
LPXD_XANCP       LEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLEI
LPXD_XYLFA       LDDTVLEEDVHIDNLVQIAHNCRIGAHTAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLQI
LPXD_XYLFT       LDDTVLEEDVHIDNLVQIAHNCRIGAHTAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLQI
LPXD_BLOPB       LDDTKIENGVIIDNQCQIAHNVIIGARTAIAGGVIMAGSLTIGRDCMIGGASVINGHINI
LPXD_BLOFL       LDDTCIGDGVIIDNQCQIAHNVAIGSHTAIAGGVIIAGSVVIGKSCMIGGASVINGHIRI
LPXD_ECOL5       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SHIBS       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SHISS       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_ECOL6       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_ECO57       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SHIFL       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SHIDS       LDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_ECOLI       LDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_ECOUT       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SALTI       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SALTY       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SALPA       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SALCH       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_PECAS       LDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEI
LPXD_SODGM       LDDTRIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLTIGRYCMIGGASVINGHMAI
LPXD_YERPA       LDNTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKVGRYCMIGGASVINGHMEI
LPXD_YERPN       LDNTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKVGRYCMIGGASVINGHMEI
LPXD_YERPE       LDNTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKVGRYCMIGGASVINGHMEI
LPXD_YERPS       LDNTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKVGRYCMIGGASVINGHMEI
LPXD_YEREN       LDNTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKVGRYCMIGGASVINGHMEI
LPXD_PHOLL       LDNTIIGNGVIIDNQCQIAHNVIIGDNTAVAGGVIMAGSLKIGCYCMIGGASVINGHMEI
LPXD_WIGBR       IDNTVIGNGVIIDNQCQIAHNVIIGENTAIAGGVVMAGSLIIGSNCIIGGASVINGHIII
LPXD_HAEI8       LDATIIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLTVGRYCLIGGASVINGHMEI
LPXD_HAEIN       LDATIIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLTVGRYCLIGGASVINGHMEI
LPXD_PASMU       LDPTVIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLTVGRYCLIGGASVINGHMEI
LPXD_HAES1       LDATVIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLKVGRYCLIGGASVINGHMEI
LPXD_MANSM       LDSTVIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLTVGRYCQIGGASVINGHMEI
LPXD_HAEDU       LDPTIIEDNVIIDNLCQIAHNVHIGFGTAIAGGVILAGSLKIGRFCQIGGASVINGHMEI
LPXD_ALIF1       IDDTVIESNVIIDNQIQIAHNVQIGSGSAMAGGTIVAGSTKIGKHCIIGGGSVINGHIEI
LPXD_PHOPR       LDDTVIADGVIIDNHCQIAHNVSIGENTAIAGATTMAGSLKIGKHCFIGGATVINGHIEI
LPXD_VIBVU       LDDTIIEDNVVLDNQLQIAHNVHIGYGTVMPGGTVVAGSTTIGKYCAIGGASVINGHITI
LPXD_VIBVY       LDDTIIEDNVVLDNQLQIAHNVHIGYGTVMPGGTIVAGSTTIGKYCAIGGASVINGHITI
LPXD_VIBPA       LEDTIIEDNVILDNQLQIAHNVQIGYGTVMPGGTIVAGSTKIGKYCQIGGASVLNGHITI
LPXD_VIBCH       LDDTVIEDNVIIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEI
LPXD_COLP3       LDNTEIRDGVILDNQIQIAHNVIVGENTAIAGCTVIAGSTVIGKNCTIAGLVGVNGHITI
LPXD_PSEA6       LDDTIIGNGVIIDNQCQVAHNVIIGENTAIAGCTVVAGSVTIGRNCTIGGMVAINGHMEI
LPXD_PSET1       LDDTIIHSNVIIDNQCQIAHNVEVNSGTAIAGCTVLAGSVTIGKNCQIGGMTAINGHMSV
LPXD_IDILO       LDDTVISSGCIIDNQCQIAHNVFIDEDTAIAGCTVLAGSCRIGKRCMIGGASAINGHISV
LPXD_SHESM       LGHTEIHNGVIIDNQVQVAHNDIIGENTAIAGSTTLAGSVTIGKHCIIGGNCAIAGHLTI
LPXD_SHESR       LGHTEIHNGVIIDNQVQVAHNDIIGENTAIAGSTTLAGSVTIGKHCIIGGNCAIAGHLTI
LPXD_SHEON       LGHTEIHNGVIIDNQVQVAHNDIIGENTAIAGSTTIAGSVTIGKHCIIGGNCAIAGHLTI
LPXD_SHEFN       LSHTEIHDGVIIDNQVQIAHNVVIGQNTAMAGGSIIAGSSTIGKYCIIGGGSAVAGHLSV
LPXD_SHEDO       LGHTEIGDGVILDNQVQIAHNAIIGKHTAIAGGSIIAGSTKLGQYCIVGGNSAIAGHLKI
LPXD_SACD2       LDDTIIEDGVIIDNLVHIAHNVKIGAGSAIAGCVGIAGSAVIGKNCTVAGMVAINGHITI
LPXD_ALKEH       IDDTVLEEGVKLDNQVHIGHNVRVGARTIIAGNTVVAGSTTIGCDCMIGGSSAITGHISI
LPXD_AROAE       LDDTVISGGVKLDNQIQIGHNVRIGAHTAIAGCVGIAGSTTIGARCMIGGQAGIIGHLEI
LPXD_DECAR       LEDTVIGDGCKLDNLVHIGHNCKIGNNSVLAGCTGVAGSTVFGEHCVVGGAGMISGHLNI
LPXD_METFK       IDDTIIHEGCKIDNLVQIGHNCRIGAHSVIAGCVGIAGSAVLGKHCRIGGAAMILGHLEI
LPXD_THIDA       LEDTVIEEGVKLDNLIQVAHNVVIGAHSAIAACTGIAGSAKIGRHCTIGGAAMIFGHIEI
LPXD_BORBR       LDDTIVGDGVKLDNQIMVAHNVRIGAHTAIAACVGIAGSTTIGERCTIGGASMLSGHLAI
LPXD_BORPA       LDDTIVGDGVKLDNQIMVAHNVRIGAHTAIAACVGIAGSTTIGERCTIGGASMLSGHLAI
LPXD_BORPE       LDDTIVGDGVKLDNQIMVAHNVRIGAHTAIAACVGIAGSTTIGERCTIGGASMLSGHLAI
LPXD_BORA1       IENTIIGDGVKLDNLIMIAHNVRIGAHTAVAACVGIAGSTVIGERCIVGGAAMFSGHLSI
LPXD_POLSJ       LQDTVLEDGVKLDNLVQIGHNVRIGKHTAMAGCAGVAGSATIGAHCTVGGGAIVLGHLSL
LPXD_RHOFT       LQDTVIEDGVKLDNLIQIGHNVHVGKHTAMAGCAGVAGSATIGAHCTLGGGAIVLGHLTL
LPXD_BURCA       MADTVIEECVKIDNQVQIGHNCRIGAYTVIAGSAGIAGSTTIGRHCMIGGAAGIAGHVTL
LPXD_BURL3       MADTVIEECVKIDNQVQIGHNCRIGAYTVIAGSAGIAGSTTIGRHCMIGGAAGIAGHVTL
LPXD_BURP1       MADTVIDECVKIDNLVQIGHNCRIGAYTVIAGCAGIAGSTTIGKHCMIGGAVGIAGHVTL
LPXD_BURPS       MADTVIDECVKIDNLVQIGHNCRIGAYTVIAGCAGIAGSTTIGKHCMIGGAVGIAGHVTL
LPXD_BURMA       MADTVIDECVKIDNLVQIGHNCRIGAYTVIAGCAGIAGSTTIGKHCMIGGAVGIAGHVTL
LPXD_BURTA       MADTVIDECVKIDNLVQIGHNCRIGAYTVIAGCAGIAGSTTIGKHCMIGGAVGVAGHVTL
LPXD_PARXL       MADTIIEECVKIDNLVQIGHNCKVGAYTVIAGCAGIAGSTTIGRHCMIGGAVGIAGHVTL
LPXD_CUPPJ       MADTVIEDGCKIDNQVQIAHNVRVGAHTVIAGCAAVSGSTHIGRFCVIGGAANFSGHLKI
LPXD_CUPMC       MADTVIEDGCKIDNQVQIAHNVHVGAHTVIAGTAAVSGSTKIGRFCVIGGAANFSGHLNI
LPXD_RALSO       MADTVVEQGCKIDNQVQIAHNVHVGAYTVIAGCAAISGSTKIGRYCIIGGAANFAGHLTI
LPXD2_FRAT1      IDDTIIKKGARIDNLVQIAHNVVIGRNTALAGVTAVAGSTTIGDNCLIGGQSAITGHISI
LPXD2_FRATH      IDDTIIKKGARIDNLVQIAHNVVIGRNTALAGVTAVAGSTTIGDNCLIGGQSAITGHISI
LPXD2_FRATO      IDDTIIKKGARIDNLVQIAHNVVIGRNTALAGVTAVAGSTTIGDNCLIGGQSAITGHISI
LPXD2_FRATT      IDDTIIKKGARIDNLVQIAHNVVIGRNTALAGVTAVAGSTTIGDNCLIGGQSAITGHISI
LPXD_COXBU       LDDTVIGNGVKIDDLVMIAHNVRIGDHTVIAGCAGVAGSTTVGRHCMIGASAGLNGHIEI
LPXD_NEIG1       MSDTTVGNGTKIDNQVQIGHNCKIGSHTVIAAKTGISGSVTIGSYCIIGGGVGTVGHIEI
LPXD_NEIMA       MSDTTVGNGTKIDNQVQIGHNCKIGSHTVIAAKTGISGSVTIGSYCIIGGGVGTVGHIEI
LPXD_NEIMB       MSDTTVGNGTKIDNQVQIGHNCKIGSHTVIAAKTGISGSVTIGSYCIIGGGVGTVGHIEI
LPXD_CHRVO       LVDTVIRKGAKIDNLVQIAHNVEIGEHTAIAGCVGIAGSTKIGARCTVGGAAMFVGHIEV
LPXD_PSYA2       IDDTVIGNHVIIDNLVQVAHNVRIGDGTAIAAHTGIAGSTSIGKRCIIGGAVGITGHIDI
LPXD_PSYCK       IDDTVIGNHVIIDNLVQVAHNVRIGDGTAIAAHTGIAGSTTIGKRCIIGGAVGITGHIDI
LPXD_ACIAD       LDDTIIEDGVIIDNLVQIAHNVRIGSNTAIAAKCGIAGSTVIGKNCILAGACGVVGHITI
LPXD_HYDCU       INDTVIESNCIIDSLVHIAHNVSIGYGSAIASQVGFAGSTAVGKYCVFAGQAGINGHISI
LPXD_BACFN       MGATVIHSGVKLDNLVQIAHNDEIGSHTVMAAQVGIAGSTKVGEWCMFGGQVGIAGHLKI
LPXD_BACFR       MGATVIHSGVKLDNLVQIAHNDEIGSHTVMAAQVGIAGSTKVGEWCMFGGQVGIAGHLKI
LPXD_BACTN       MGATIIHSGAKIDNLVQIAHNDEIGSHTVMAAQVGIAGSAKIGEWCMFGGQVGIAGHITI
LPXD_PORGI       MDSTIIHRGVKLDNLVQIAHNCSVGSHTVFAAQVGMAGSSHVGEWCQFGGQVGLSGHIKV
LPXD_CYTH3       MGSTIIYDGVKIDNLIQIAHNVKIGKNTVIAAQAGISGSTTIGENCIIAGQVGIIGHIKI
LPXD_CHLCH       LGSTVIESGVKLDNLVQVAHNCRIGAHTVIAAQAGVSGSTTLGNHCIVGGQVGFAGHIEV
LPXD_PELLD       MGSTVIAKGVKVDNLVQVAHNCRIGEHTVIAAQAGISGSTIMGRGCMIGGQAGFAGHLEL
LPXD_CHLTE       MGATVIEKGAKIDNLVQIAHNCRIGGDTVIASQAGISGSVKIGRQCLIGGQAGFAGHLEL
LPXD2_KORVE      LEDTVIGAGTKLDNLVHIGHNVRIGENVVIAAQTGISGSCTIGAGSIIGGQVGMGDHATL
LPXD_METCA       YGATVVRSGTIIDALVHLGHNVEIGEDCILCAHTGLSGSTRFGKRVIATGQTGTIDHITV
LPXD_CHLAB       FKNSVIREGTKIDNQVQIAHHVEVGKHSMIVAQAGIAGSTKIGNHVIIGGQTGITGHISI
LPXD_CHLFF       FKNSVIREGTKIDNQVQIAHHVEVGKHSMIVAQAGIAGSTKIGNHVIIGGQTGITGHISI
LPXD_CHLCV       FKNSVICEGTKIDNQVQIAHHVEIGKHSMIVAQAGIAGSTKIGNHVIIGGQTGITGHISI
LPXD_CHLPN       FKNTVIHEGTKIDNQVQVAHHVEIGKHSIIVAQAGIAGSTKIGEHVIIGGQTGITGHISI
LPXD_CHLTA       FKHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICI
LPXD_CHLTR       FKHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICI
LPXD_CHLMU       FKHSIVREGSKIDNLVQIAHQVEVGQHSMVVAQAGIAGSTKIGNHVIIGGQAGVTGHICI
LPXD_PARUW       FKSTRIGQGTKIDNLVQIAHGVTIGSYNIIVSQTGIAGSTTTGKYVVIAGQAAIAGHLHL
LPXD1_FRAT1      YGSTIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNI
LPXD1_FRATT      YGSTIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNI
LPXD1_FRATH      YGSTIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNI
LPXD1_FRATO      YGSTIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNI
LPXD_FUSNN       IGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVGIAGSTTIGNNVTLAGQVGVAGHLEI
LPXD_AQUAE       IENTLIGKNTKIDNLVMVAHNCKVGENNILVSQVGLSGSVKTGKNVILAGQVGVADHVEI
LPXD1_LEGPA      LGATVIGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVHI
LPXD1_LEGPH      LGATVIGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVHI
LPXD1_LEGPL      LGATVVGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVHI
LPXD_RHOBA       YGATRIGEGTKIDNQVMIAHNCQIGRHNLLCSQVGIAGSCTTGDYVVLAGQVGLKDHIAL
LPXD_CAMJR       FDSTIIKAGTKVDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKI
LPXD_CAMJE       FDSTIIKAGTKVDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKI
LPXD1_SULDN      FGTTLIKYGVRIDNLVQVGHNCVIGEHSVLVAQAGISGSTTMGRNVVMGGQSATAGHLSI
LPXD2_SULDN      FNSTIIRRGTKLDNFIHIAHNCDIGEHSIFVAQTGVGGSTKLGRNCVVSGQSAFSDHLNI
LPXD_HELPH       FGETLIKEGVKIDNLVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHV
LPXD_HELPY       FGETLIKEGVKIDNLVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHV
LPXD_HELPJ       FGETLIKEGVKIDNLVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHV
LPXD_HELHP       FGQTLIKQGAKIDNLVQIGHNCVVGEHTLLVSQVGLAGSTTTGRNVIMGGQAGTGGHIHI
LPXD_WOLSU       FGETRIKRGTKIDNLVQIAHNCVLGEHSIVVSQVGLAGSTTTGRNVIFGGQSATSGHLHV
LPXD_GRABC       MHDTVIGAGSRLDNLVMIAHNVRMGRACVIVSQVGISGSTTLGDHVVLAGQAGLIGHLKI
LPXD_MAGSA       GPDTVIGDGSMIDNLVQIGHNVQLGRGCVIVAQVGISGSTRMGDFVAAGGQAGITGHLKI
LPXD_CHESB       LSDTIIGEGTKIDNLVQIGHNVHIGRRCVIAGLCGLSGSVKLGDYVMLGGQVGIADHITI
LPXD_RHILO       MSDTIIGQGTKIDNLVQIAHNVRIGRNCIVAGLSGISGSVVVGDNVTMGGGVGLADHLTI
LPXD_BARHE       FEDTIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGSVGVADHIVI
LPXD_BARQU       FEDTIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGSVGVADHIVI
LPXD_BRUAB       LDDTVIGEGTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLII
LPXD_BRUA2       LDDTVIGEGTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLII
LPXD_BRUME       LDDTVIGEGTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLII
LPXD_BRUSU       LDDTVIGEGTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLII
LPXD_NITHX       LRDTVIGEGTKIDNQVQIGHNVTIGRRCLLAAQIGLAGSLTIGDNVALGAKVGINNHLHI
LPXD1_NITWN      LRDTVIGEGTKIDNQVQIGHNVTIGRRCLLAAQIGLAGSLTIGDNVALGAKVGINNHLHI
LPXD_BRADU       LRDTVIGEGTKIDNQVQIGHNVTIGRNCLLAAQIGLAGSLTIGDNVALGAKVGINNHLKI
LPXD_RHOP2       LRDTVIGEGTKIDNQVQVGHNVTIGRHCVIAAQCGLAGSLTLGDNVALGAKVGINNHVMI
LPXD_RHOPS       LRDTVIGEGTKIDNQVQVGHNVTIGRHCVIAAQCGLAGSLTLGDNVALGAKVGVNNHVTI
LPXD1_RHOPB      LRDTVIGEGSKIDNQVQIGHNVTIGRHCLIAAQCGLAGSLTLGDNVALGAKVGINNHLHI
LPXD_RHOPA       LRDTVIGEGTKIDNQVQIGHNVTIGRHCVIAAKCGLAGSLTLGDNVALGAMVGINNHVVI
LPXD2_RHOPB      MRDTVIGQGTKIDNLCQIGHNCVIGRHCIIVAQSGLSGSVTVEDFAVLGARTGVIPHITI
LPXD2_NITWN      MRATVIGEGTKLDNLVQVAHNVTIGAHCVIAAQVGIAGSTTIGDFVAIGGHAGIAPHLTI
LPXD_RHIEC       MDDTVIGEGTKIDNQVQIGHNVQIGRHCAIVSQVGIAGSTKIGNGVQIGGQVGIKGHVTI
LPXD_RHIL3       MDDTVIGEGTKIDNQVQIGHNVQIGRHCAIVALVGIAGSAKIGNGVQIGGQVGIKGHVTI
LPXD_AGRFC       MDDTVIGEGTKIDNQVQIGHNVRIGRHCGIVSGVGIAGSTRIGDGVMIGGATGVNGHITI
LPXD_RHIME       MDDTVIGEGTKIDNLVQIGHNVRIGRYCGIVSQVGIAGSTQIGDGVMIGGGVGVNGHITI
LPXD_HYPNA       FEDTIIGERTKIDNLCQIAHNVVLGRGVIVAAFGGISGSVRVGDGSMLGGRVGIADHVKV
LPXD_CAUVC       FGDTTIGENTKIDNLVHVAHNVRIGRNCVLAAYTGVSGSTVVGDGVAFGGKAGVADHLNI
LPXD_MARMM       FGATRIGASSKIDNLCHIAHNADIGENVIMAGYSGLAGSAVIADNAMLGGRVGVYDHVTI
LPXD2_LEGPH      LDNTVIEDWCRLDNLVQIGHNVKIGKGSVLVAQVGIAGSTELGEHVTLAGQVGVIGHLKI
LPXD2_LEGPL      LDNTVIEDWCRLDNLVQVGHNVKIGKGSIIVAQVGIAGSTELGEYVTLAGQAGVIGHLKI
LPXD2_LEGPA      LGNTVIEDWCRLDNLVQIGHNVKIGKGSIIVAQVGIAGSTELGEHVTLAGQVGVIGHLKI
LPXD_RICCN       LQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAGSSTIGKYCTLGGQVGIAGHLNI
LPXD_RICRI       LQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAGSSTIGKYCALGGQVGIAGHLNI
LPXD_RICFE       LQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAGSSTIGKYCALGGQVGIAGHLNI
LPXD_RICPR       LQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAGSSAIGKYCALGGQVGIAGHLNI
LPXD_RICTY       LQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAGSSAIGKYCALGGQVGIAGHLNI
LPXD_RICBR       LQDTIIEDLCRIDNLVQIGHSVKIGKGSIIVAQAGIAGSSVIGKYCALGGQVGVAGHLYI
                    : :     :*    :.*    .    . .   ..*.          .      :  :

LPXD1_KORVE      GDGVIAAGQTGVQ-NDIEPGK-RIGGS-PSYDHKQWIRSWQIQTRLPEIVKELRNLAS--
LPXD2_GLOVI      GDNVVATVKSCIW-KSVEANQ-VLYGNIPASDSHTWLKASAVFRQLPHMQKSVQQMQK--
LPXD_THEEB       GDRTVVSAKSGIS-SSVPPDS-RMGGI-PAMDQTLYLKVSAAVKQLPDLLKRVRKLEA--
LPXD_TRIV2       GDGSTASAQTGIL-HDVKPGE-VVSGT-PAIPHKMYLKIAALYSRLPDMYQAFRQSQR--
LPXD_NOSS1       GDGSTASAQTGIL-HDVKPGE-VVSGT-PAIPHKIYLKIGAIYSRLPEMYQAFRQLQR--
LPXD_TRIEI       GDRAIATAQAGVH-NDVAAGE-IVSSS-PAVPNKIYLKASAIYKRLPEIYQFVKQMKR--
LPXD_SYNP6       GDRAIASSKSGIH-GEIEAGA-IVSGY-PAIPNRQWLKTSAVYNRLPELYRSLRNLIR--
LPXD_SYNE7       GDRAIASSKSGIH-GEIEAGA-IVSGY-PAIPNRQWLKTSAVYNRLPELYRSLRNLIR--
LPXD_SYNY3       GDGAIASAQTGIH-GKVGPKE-VVCGS-PHMPHKLYLKASAIYKRLPEMYDTLKKLKK--
LPXD3_GLOVI      GDRTVVSAQSGIP-SDVEPGT-VVSGS-PALPHALWLRTSALIRRLPELFQNLRDLQR--
LPXD_SYNJA       GDGVRVAAQTGVT-SDVPAGQ-TVAGY-PHQPIAEWRRSMAVQRHLPELQRALRKLEA--
LPXD_SYNJB       GDGVRVAAQTGVT-SDVPAGQ-TVAGY-PHQPIAEWRKSMAVQRHLPELQRTLRKLEA--
LPXD_PROM9       GNNVIASSKCGIH-CDIEDGK-VISGF-PAMENKSWLRSSSIFKKLPELAKKLRQLDK--
LPXD_PROMP       GNNVIASSKCGIH-CDIEDGE-VVSGF-PAMKNKSWLRSSSVFKKLPELAKKLRQLDK--
LPXD_PROMA       GSNVIASSKCGIH-TDIEPEQ-VVSGF-PAIPNKLWLRCAANFKKLPELAKVIKKLNG--
LPXD_PROMT       GDGVIASSKTGIV-SNIEAGT-VVSGF-PAIPNKLWLRCSANFKKLPEIAKAIRQLDR--
LPXD_SYNPX       GDRVMASSKAGIH-NDVDAGA-VVSGY-PAIPHRLWLRCSAAFSKLPELARTVRELKR--
LPXD_SYNSC       GDRAIASSKSGIH-GDVAPGE-VVSGF-PAIPNRLWLRCANTFSKLPEMAKTLRELKR--
LPXD_SYNS9       GDGAIASSKSGIH-GEVAPGE-VVSGY-PAIPNRLWLRCSAAFSKLPEMAKTLRELKR--
LPXD_PROMM       GDRAIASSKSGIH-GEVEAGE-VVSGY-PAIPNRLWLRCSATFSKLPEMAKMLRKLTR--
LPXD_DESAG       GDDVTVGPKSGIA-RSIEPGK-TMGGQ-PAVERDVYMRTLTVMPKLPDMYKRLRKLEK--
LPXD_DESVH       GSGVTIGPKSGVA-KDIPAGE-TVGGA-PAVDKSTYMRTLTVMPKLPDMYKRLGKLEK--
LPXD_LAWIP       GNNVTIGPQSGIG-KNIPDNQ-ILGGS-PAVDRQTFLKTSVLMPRFPELFKRIKKLEK--
LPXD_NITOC       GDGAVITAQSGVA-KDVPPKA-IMTGS-PVQPMMENRRALAELNRLRELRKKVRELER--
LPXD_ANADE       GDGVRIGAQSGVM-ADVEAGE-TVSGS-PAVPHGNWLKAMASLDHLHDMRKELRELRR--
LPXD_MYXXD       GDLAKVGAQSGVA-HDVPDGQ-VVSGS-PAVPHREWLRASAAAGQMADLLKEVRALRR--
LPXD_SYNAS       GDFAMVGAQSGVH-EDVPANS-VVSGS-PCQPHRNWLRSMSCLPRLPDMRHLLNDLRK--
LPXD_GEOMG       GDNSMVGAKSGIP-GNIPAGS-MVSGI-PAFNHRDWLRASAVVPKLPELRKTIAELEK--
LPXD_GEOSL       GDNAMIGAKSGVP-GNVPSGT-IMSGI-PAFDHREWLRASAVVPKLPEMKRTVAALEK--
LPXD_PELCD       GDNTMVGAQSGII-SDLPAGQ-VFSGT-PTMPHREWLKASASMRSLPAMRKTVSNLQK--
LPXD1_GLOVI      GADCLVLARSGVT-KDLPDHS-KVSGF-PAQDHLLELKQQAARSRLPQIVEQMRQMQR--
LPXD_DESPS       GDGVMIAGGSGVL-SNLSAGA-VVGGI-PARPIKQWRKSVVLTTKLPEMQKDIRALKK--
LPXD_PSE14       CDGVYITGMTMVT-HSITEPG-SYSSGTAMQPAAEWRKSAARLRKIDDMARRLQKLEKAV
LPXD_PSESM       CDGVYITGMTMVT-HSITEPG-SYSSGTAMQPSAEWRKSAARLRKIDDMARRLQKLEKAV
LPXD_PSEU2       CDGVFITGMTMVT-HSITEPG-SYSSGTAMQPAAEWRKSAARLRKIDDMARRLQKLEKAI
LPXD_PSEF5       CDNVFLTGMTMVT-HSITEPG-AYSSGTAMQPAAEWRKSAARIRQLDDLARRLRQLEKRV
LPXD_PSEPF       CDNVFLTGMTMVT-HSITEPG-AYSSGTAMQPAAEWRKSAARIRQLDDIARRLKQLEKRS
LPXD_PSEPK       CDNVFVSGMTMVT-RSITEPG-SYSSGTAMQPLADWRKSAARIRHLDDMAKRLQQLEKRV
LPXD_PSEAE       CDNVFVTGMTMVT-RSITEPG-SYSSGTAMQPAAEWKKSAARIRQLDDMARRLQQLEKRL
LPXD_HAHCH       TDQVQITGMTLVT-HNIKEPG-VYSSGTAVEPNASWRKNVARFRQLDQLARRVRVLEQ--
LPXD_CHRSD       CDGVQVTGMSLVT-NSIHEPG-VYSSGTGAMPNGLWRKNAVRFKQLDELAKRLSRLER--
LPXD_ALCBS       CDKVQILAMSLVS-SSIKEPG-TYGSALPVDSQSRYRRNVARFRNLDDLARRVRKLER--
LPXD_XANC5       CDKVVITGKSVVR-NSIHEPG-EYSSGTPLTDNRTWRKNAARFKQLDVLARRILAVGK--
LPXD_XANAC       CDKVVITGKSVVR-NSIHEPG-EYSSGTPLTDNRTWRKNAARFKQLDVLARRILAVGK--
LPXD_XANOM       CDKVVITGKSVVR-NSINEPG-EYSSGTPLTDNRTWRKNAARFKQLDVLARRILAVGK--
LPXD_XANOR       CDKVVITGKSVVR-NSIHEPG-EYSSGTPLTDNRTWRKNAARFKQLDVLARRILAVGK--
LPXD_XANC8       CDKVVITGKSVVR-NSIHEPG-EYSSGTPLTDNRTWRKNAARFKQLDALARRILAVGK--
LPXD_XANCP       CDKVVITGKSVVR-NSIHEPG-EYSSGTPLTDNRTWRKNAARFKQLDALARRILAVGK--
LPXD_XYLFA       CDNVVITGKSVVR-NSIHTPG-EYSSGTPLTDNRTWRKNAVRFKQLDMLVRRMMAVSK--
LPXD_XYLFT       CDNVVITGKSVVR-NSIHTPG-EYSSGTPLTDNRTWRKNAVRFKQLDMLVRRMMAVSK--
LPXD_BLOPB       CDKVTITGMGMVI-KAITQPG-IYSSGIPVQLNTVWWKTAALIMRISNMNKRIKTIEE--
LPXD_BLOFL       CDKVTITGMSMVM-KSITTSG-IYSSGIPVQPNFAWRRTAALVMRIHSIDKRIKDIEQ--
LPXD_ECOL5       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_SHIBS       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_SHISS       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_ECOL6       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_ECO57       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_SHIFL       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_SHIDS       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_ECOLI       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_ECOUT       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLER--
LPXD_SALTI       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIER--
LPXD_SALTY       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIER--
LPXD_SALPA       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIER--
LPXD_SALCH       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIER--
LPXD_PECAS       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKVWRKTAALVMNIDEISKRLKAVER--
LPXD_SODGM       CDKVTVTGMGMVM-RPITEPG-VYSSGIPLQPNKEWRKTAALVMNISDMSKRMKAIER--
LPXD_YERPA       CDKVTITGMGMVM-RPITEPG-LYSSGIPLQPNKMWRKTAALVMNIDGINKRLKAVER--
LPXD_YERPN       CDKVTITGMGMVM-RPITEPG-LYSSGIPLQPNKMWRKTAALVMNIDGINKRLKAVER--
LPXD_YERPE       CDKVTITGMGMVM-RPITEPG-LYSSGIPLQPNKMWRKTAALVMNIDGINKRLKAVER--
LPXD_YERPS       CDKVTITGMGMVM-RPITEPG-LYSSGIPLQPNKMWRKTAALVMNIDGINKRLKAVER--
LPXD_YEREN       CDKVTITGMGMVM-RPITEPG-LYPSGIPLQPNKVWRKTAALVMNIDGINKRLKAIER--
LPXD_PHOLL       CDKVTVTGMSMVM-RPITEPG-VYSSGIPAQPNKVWRKTAALVMNINEMNKRLKSMES--
LPXD_WIGBR       CDRVKITGMSMVM-RSIKTPG-IYSSGVPAQLNKKWKKNTALIMNINKIKKQIKEILK--
LPXD_HAEI8       CDKVTITGMGMVM-RPITEPG-VYSSGIPLQTNKEWRKTAALTLGIDGINKRLKALEK--
LPXD_HAEIN       CDKVTITGMGMVM-RPITEPG-VYSSGIPLQTNKEWRKTAALTLGIDGINKRLKALEK--
LPXD_PASMU       CDKVTITGMGMVM-RPITEPG-VYSSGIPLQTNKEWRKTAALTLGIDAMNKRLKALEK--
LPXD_HAES1       CDKVTITGMGMVM-RPITEPG-IYSSGIPLQPNKVWRKTAALTLDIDKINKRLKAVEK--
LPXD_MANSM       CDQAIVTGMSMIL-RPITEPG-IYSSGIPAQTNKEWRKTAALTLDIDKMNKRLKALEK--
LPXD_HAEDU       CDGAIITGMSMIM-KPITEKG-VYSSGIPAQTNKEWRKTAALTMNIADMNKRLKAIEK--
LPXD_ALIF1       TDGVTITGMGMVM-RAIDEKG-MYSSGIPLQTNKEWRKTAARVHKIDEMNKRLKAVEK--
LPXD_PHOPR       TDGVTITGMGMVM-RPISEPG-VYSSGIPLQTNREWRKTAARVMKIEEMNKRLKSVEK--
LPXD_VIBVU       ADGVNITGMGMVM-RSIEEKG-VYSSGIPLQTNKEWRKTAARVHRIEEMNKRLKAIEK--
LPXD_VIBVY       ADGVNITGMGMVM-RSIEEKG-VYSSGIPLQTNKQWRKTAARVHRIEEMNKRLKAVEK--
LPXD_VIBPA       ADGVAITGMGMVM-RSIEEKG-LYSSGIPLQTNREWRKTATRVHRIDEMNKRLKAVEK--
LPXD_VIBCH       ADGVTITGMGMVM-RSIEEKG-MYSSGIPLQTNKEWRKTAARVHRIDDMHKRLKALEK--
LPXD_COLP3       ADNCVFTGMSMVT-KNISQAG-VYSSGMPVVQNKEWNKTNARVKRLDSLTKRVKELEK--
LPXD_PSEA6       CDNVYITGMSMVT-KAIDKPG-VYSSGMPAIENREWRKNAVALRNLSTLNQRVKTLEK--
LPXD_PSET1       CDGVIITGMSMVT-KSITEPG-IYSSGIPHTTNKEWRKSIAHLRNLSEMKSRIKALEQ--
LPXD_IDILO       CDDVQIMGFAMVI-KEITEPG-VYASGIPASGHREWRRNGARFRQLDDLFKRVKELEK--
LPXD_SHESM       ADGVHLSGATNVT-GNMREPG-LYSSATVAMENKVWRKNTVRFRQLDELFQRVKTLEK--
LPXD_SHESR       ADGVHLSGATNVT-GNMREPG-LYSSATVAMENKVWRKNTVRFRQLDELFQRVKTLEK--
LPXD_SHEON       ADGVHLSGATNVT-GNMREPG-LYSSATVAMDNNLWRKNTVRFRQLDELFQRVKAIEK--
LPXD_SHEFN       ADGVHISGGTNVT-SVIREKG-VYSSATIAMENKLWRRNTVRFRQLDELFSRVKTLEK--
LPXD_SHEDO       ADGVHVSGGTNVT-SEIREPG-TYSSATVAVENKLWRRNTVRFRQLDDLFNRVKLLEK--
LPXD_SACD2       ADNTHFHGGTIVT-KGVKESG-AYASAPPMQEVSKWRRNAVRYGQLDEWVEKIKALQK--
LPXD_ALKEH       ADGVILMGMTGVT-GSIKQPG-AYASPLPAKPVREWRRNSVRFTQLDDLFRRVKRLEAAQ
LPXD_AROAE       VDDVVVSAGTLVT-KSIRRPG-VYTANLPVQGHAEWVKNFAHLRHLDALVDRIRALEE--
LPXD_DECAR       AAGTTISGGTTVM-KSILNPG-VYTSVFPLDTHEEWLRNASHIRRLSKLAERVSELEK--
LPXD_METFK       ADGVTVSPGSMIT-RSLMKAG-TYTALMPFQSHDEWLRTAAGIRRLGELAERVKQLEK--
LPXD_THIDA       ADGTRISTNTLIT-KSLPKRG-TYTSALPFSEHEVWQKNAVHMRNLDKLVTRVKQLEK--
LPXD_BORBR       ADDVNISGGTAVT-SNIAKAG-RYTGVYPYAEHSEWQRNAAVIQQLALLRRRLRALER--
LPXD_BORPA       ADDVNISGGTAVT-SNIAKAG-RYTGVYPYAEHSEWQRNAAVIQQLALLRRRLRALER--
LPXD_BORPE       ADDVNISGGTAVT-SNIAKAG-RYTGVYPYAEHSEWQRNAAVIQQLALLRRRLRALER--
LPXD_BORA1       CDDVTISGGTPVT-SSITKPG-RYTGVYPYSEHGEWQRNAAVIQQLALLRRRVRALEK--
LPXD_POLSJ       ADHVHISAASVVT-RSILKPG-HYTGLFPIDDNTAWEKNAATLKQLHVLRERLKQAEK--
LPXD_RHOFT       ADGVNISAATVVT-RSLRKPG-HYTGMFPIDDNAAWEKNAASLKQLHSLRDRIRALED--
LPXD_BURCA       GDYVIITAKSGVS-KSLPKAG-IYTSAFPAVDHGEWNKSAALVRNLDKLRERIKALEA--
LPXD_BURL3       GDYVIITAKSGVS-KSLPKAG-IYTSAFPAVDHGEWNKSAALVRNLDKLRERIKALEA--
LPXD_BURP1       GDYVIVTAKSGVS-KSLPKAG-IYTSAFPAVEHGDWNRSAALVRNLDKLRDRIKALET--
LPXD_BURPS       GDYVIVTAKSGVS-KSLPKAG-IYTSAFPAVEHGDWNRSAALVRNLDKLRDRIKALET--
LPXD_BURMA       GDYVIVTAKSGVS-KSLPKAG-IYTSAFPAVEHGDWNRSAALVRNLDKLRDRIKALET--
LPXD_BURTA       GDYVIVTAKSGVS-KSLPKAG-IYTSAFPAVEHGDWNKSAALVRNLDKLRDRIKALET--
LPXD_PARXL       ADYVIVTAKSGVS-KSLLKPG-MYTSAFPAVNHADWNKSAALLRNIDKLRDRIKALEN--
LPXD_CUPPJ       ADRTTVSGGTSIT-KSITKPGGHFTSVFPFLPHGEWERNAAIVRGLTKLRERVMQLER--
LPXD_CUPMC       ADRTTVSGGTSIT-KSITKPGGHYTSVFPFTSHGEWERNAAIVRGLSKLRERVVQLER--
LPXD_RALSO       ADRVTVSGGTSIT-KSIPKPG-HFTSVFPFMPHADWERNAAILRGLTRMRERLQQLEQ--
LPXD2_FRAT1      CDNTIIGGASNIG-KSITKPG-MYYAAFEAKPRIQWGRFVAKLAKIDTLITKVKQLEE--
LPXD2_FRATH      CDNTIIGGASNIG-KSITKPG-MYYAAFEAKPRIQWGRFVAKLAKIDTLITKVKQLEE--
LPXD2_FRATO      CDNTIIGGASNIG-KSITKPG-MYYAAFEAKPRIQWGRFVAKLAKIDTLITKVKQLEE--
LPXD2_FRATT      CDNTIIGGASNIG-KSITKPG-MYYAAFEAKPRIQWGRFVAKLAKIDTLITKVKQLEE--
LPXD_COXBU       CDNVIITGMGMIQ-KSITKPG-IYSSGTGMQTNREWRKSVIRFWQLDELAKRLKRLEK--
LPXD_NEIG1       ADKTTIGGGTSVT-HSITESGKHLAGIFPMSEHKEWARNAVYIHRLSEMNKRLKTLEQ--
LPXD_NEIMA       ADKTTIGGGTSVT-HSITESGKHLAGIFPMSTHKEWARNAVYIHRLSEMNKRLKTLEQ--
LPXD_NEIMB       ADKTTIGGGTSVT-HSITESGKHLAGIFPMSTHKEWARNAVYIHRLSEMNKRLKTLEQ--
LPXD_CHRVO       ADRTHIGGGTLVS-KSIKEAG-NYASSYPLQSMKDWLSNAVHVRHLDDFAKRVKQLER--
LPXD_PSYA2       TDDVTLSGMTMVT-KSITTAG-SYSSGTAAMPTTNWRRAAVRFRQLGRD-----------
LPXD_PSYCK       TDDVTLSGMTMVT-KSITTAG-SYSSGTAAMPTANWRRAAVRFRQLGRD-----------
LPXD_ACIAD       TDNVTLTGMSMVT-KSISEAG-TYSSGTALMENNQWKRTIVRFRQLADVPLTQIMKRLDH
LPXD_HYDCU       ADKSYFAAKSGVT-HTIKESG-SYS-GFPAIPTPEWQKNMVRSKGLNKMAQKIKHLEKEL
LPXD_BACFN       GNQVNLGAQSGVP-GNIKS-G-SQLIGTPPMELKQFFKASIVQKSLPEMQIELRNLRKEI
LPXD_BACFR       GNQVNLGAQSGVP-GNIKS-G-SQLIGTPPMELKQFFKASIVQKSLPEMQIELRNLRKEI
LPXD_BACTN       GDRVNLGAQSGIP-SSIKA-D-SVLIGTPPMEPKAYFKAAVVTKNLPDMQKEIRNLRKEV
LPXD_PORGI       GDRVSLGGQTGLL-SNVKS-G-STLLGSPGMPLRDMLRASVIFPKLPDMSLRIEQLEKEI
LPXD_CYTH3       ANKTTIAAQAGIG-RTISEEG-LTLLGSPAIEKLDFLKSFAIYRKLPTLQKRIEELEEKT
LPXD_CHLCH       SDHIQVAAKAGVS-KSFMQSG-IALRGYPAQPMREQLKYEAQLRTVGDLHAKLKALEQEL
LPXD_PELLD       ADRTHVAAQAGVS-KSFLEPG-TALRGYPAQPMREQLRHEAMLRHLGSMKEKIDRIDREL
LPXD_CHLTE       ADRTSVAAKAGIS-KSFLEPG-LAIRGVPAQPMRDQLRQEAQVRGLGEMKSKLEALEAKL
LPXD2_KORVE      EEGTILGGQSGIL-SEKIFREKGPCFGTPAKPLKQYLREQAALSRLSRRSE---------
LPXD_METCA       ADDSVLLHRAGLN-TSIKQ--PGMYAGGPAQPLQQYLKNMAVMPRLHEIWSRLKKLEK--
LPXD_CHLAB       TDHVIMMAQTGVT-KSISSP--GIYGGAPARPYQEIHRQVAKIRSLPKLEERLGMLEE--
LPXD_CHLFF       TDHVIMMAQTGVT-KSISSP--GIYGGAPARPYQEIHRQVAKIRGLPKLEERLGMLEE--
LPXD_CHLCV       TDHVIMMAQTGVT-KSISSP--GIYGGAPARPYQEIHRQVAKIRGLPKLEERLGMLEE--
LPXD_CHLPN       ADHVIMIAQTGVT-KSITSP--GIYGGAPARPYQETHRLIAKIRNLPKTEERLSKLEK--
LPXD_CHLTA       ADHVIMMAQTGVT-KSITSP--GIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEK--
LPXD_CHLTR       ADHVIMMAQTGVT-KSITSP--GIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEK--
LPXD_CHLMU       ADHVIMMAQTGVT-KSITSP--GIYGGAPARPYQEVHRQVAKIRNLPRLEERIASLEK--
LPXD_PARUW       KDHVVVAGKSGVT-KSLNT---GKYSGIPAMPIKDYNRNQVFLRKIEIYINQIKNLEK--
LPXD1_FRAT1      GSDARIGGKAGV--MWDVPAGESHMGY-PAYKDSELAKQWIAIRKLPETMKKLKAIAKSL
LPXD1_FRATT      GSDARIGGKAGV--MWDVPAGESHMGY-PAYKDSELAKQWIAIRKLPETMKKLKAIAKSL
LPXD1_FRATH      GSDARIGGKAGV--MWDVPAGESHMGY-PAYKDSELAKQWIAIRKLPETMKKLKAIAKSL
LPXD1_FRATO      GSDARIGGKAGV--MWDVPAGESHMGY-PAYKDSELAKQWIAIRKLPETMKKLKAIAKSL
LPXD_FUSNN       GDNTMIGAQSGV--PGNVEANKILSGH-PLVDHREDMKIRVAMKKLPELLKRVKALEEKK
LPXD_AQUAE       GDNVIVTAKSGV--ANNLAPNKTYGANLPAIEWSRWKRIYVYLLRLPELFKKITT-----
LPXD1_LEGPA      EDEVILGARTGVPPHKHLKKGTVYLGN-PAKPKDVAIKHELSVNRIPLIRKNIKSLTEQV
LPXD1_LEGPH      EDEVILGARTGVPPHKHLKKGTVYLGN-PAKPKDVAIKHELSVNRIPLIRKNIKSLTEQV
LPXD1_LEGPL      EDEVILGARTGVPPHKHLKKGTVYLGN-PAKPKDVAIKHELSVNRIPLIRKNIKSLTEQV
LPXD_RHOBA       ADGVIVGAQAGV--MDDLAPNQVYLGS-PATPQRDQMQIMAVQRKLPEMRRELKRLTQRI
LPXD_CAMJR       GDFSTIAARGGVS--KNLE-GGRVYGGFPIMLQKDWLKLQAKIAINFKEKSQD-------
LPXD_CAMJE       GDFSTIAARGGVS--KNLE-GGRVYGGFPIMLQKDWLKLQAKIAINFKEKSQD-------
LPXD1_SULDN      APFTTMAARSGVT--KSIDKSGLTFAGFPLLEHRLWLKLQAKIARLIKQN----------
LPXD2_SULDN      APFSTFSARSGVT--KSIEKSGGVYSGFPLMNHKEWKRLQVKIARLND------------
LPXD_HELPH       GEFTQIGGKSAVG--KDLPPNTNFAGAIPAMEIHEWHHFLAHLRTNFRKQQKTSLLQKAK
LPXD_HELPY       GEFTQIGGKSAVG--KDLPPNTNFAGAIPAMEIHEWHHFLAHLRTNFRKQQKTSLLQKAK
LPXD_HELPJ       GEFTQIGGKSAVG--KDLPPNTNFAGAIPAMEIHEWHHFLAHLRTNFRKQQKTSLLQKAK
LPXD_HELHP       GDFVQVAGRGAVG--KNLPPHTKWGGH-PLMELNEWMKFYVSLRRLIKKDSKKL------
LPXD_WOLSU       GDFATIAARGGVS--KSIEGKKTYAGF-PLMEHKEWLKLQASLKHQLKKSQ---------
LPXD_GRABC       GSGARIGAQAGVM--ADVP-AGAEIVGSPAQPAKDFFRQIATLRRLARR-----------
LPXD_MAGSA       GAGAKIAAQAGVM--RDIA-PGETVGGAPAVPMADWLRQSAILGKMARK-----------
LPXD_CHESB       GNRAQLAASSGVM--DDVP-EGERWAGVPAKPMRQAFREIAALRSLVQD-----------
LPXD_RHILO       GSGAKLAARSGFM--SNVP-AGEIWGGYPAQPMAEAMREIAMLRTMARA-----------
LPXD_BARHE       GKYVQIAAGSGVM--NDIP-DGEKWGGSPARPFKQWFREVAALRSIGKV-----------
LPXD_BARQU       GKCVQIAAGSGVM--NDIP-DGEKWGGSPARPFKQWFREVAALRNIGKV-----------
LPXD_BRUAB       GSRVQVAAASGVM--NDIP-DGERWGGIPARPIKQWFRDIANIRSIGQS-----------
LPXD_BRUA2       GSRVQVAAASGVM--NDIP-DGERWGGIPARPIKQWFRDIANIRSIGQS-----------
LPXD_BRUME       GSRVQVAAASGVM--NDIP-DGERWGGIPARPIKQWFRDIANIRSIGQS-----------
LPXD_BRUSU       GSRVQVAAASGVM--NDIP-DGERWGGIPARPIKQWFRDIANIRSIGQS-----------
LPXD_NITHX       GDGAQVVAMSGVK--DDIP-PNGRWGGYFAKPTRQWYRELFAVERLARD-------GAPN
LPXD1_NITWN      GDGAQVTAMSGVK--DDIP-ANGRWGGYFAKPTRQWFRELLAVERLVRD-------GAPD
LPXD_BRADU       GDGAQVTAMSGVK--DDIP-PNGRWGGFFAKPTKQWFKEIIAVERLVRD-----------
LPXD_RHOP2       GDGAQITAMSAVK--DSVP-AGERWGGYFAKPTKQWFREIIAVERLMR--------GGAG
LPXD_RHOPS       GDGAQITAMSAVK--DSVP-AGERWGGFFAKPTKQWFREIIAVERLLR--------SGAG
LPXD1_RHOPB      GDGAQVTAMSAVK--DDVP-ANGRWGGYFAKPTKQWFREILAVERLPK--------SGAP
LPXD_RHOPA       GDGAQVAAMSGVK--DSIP-AGERWGGIFARPTRTWFREMLAVRRLAEG-------SGAE
LPXD2_RHOPB      GKGAMLASRSTVY--SNVP-AGAVWGGFPAQSKRQWMREVVALRQLAARDHDGRTAASAE
LPXD2_NITWN      GEKAQIGGASGVM--CDIP-AGERWVGLPARPSRAFFRQFAALKRLAKKK----------
LPXD_RHIEC       GDGVQIAAKSGIM--TDLA-AGGQYGGIPARPLKDYLREAAQQVSKSKL-----------
LPXD_RHIL3       GDGVQIAAQSGIM--TDLA-AGGQYGGTPGRPLNDYLRDVAQQMSKTKL-----------
LPXD_AGRFC       GDGVQIAAMSGVV--SDVP-AGTRYGGIPARPMKHFLRDMADILARAEE-----------
LPXD_RHIME       GDGAQIAAMSGVA--SDVP-AGERYGGIPARPMRDFLRDVAEMALRSSE-----------
LPXD_HYPNA       GDRVSLAASAGLF--RDVD-SGETWGGTPAKPIRQWMREVAWLQKQANP-----------
LPXD_CAUVC       GSGASIGAAASVF--KDVP-DGETWTGFPARPLKRWLRETAWLSRMAGG-----------
LPXD_MARMM       GEGARVGANSAAS--RDVP-AGEFWVGNPAQPMRQHMRELAELRRLARP-----------
LPXD2_LEGPH      GKGATVLASAKVY--KNVK-SGDRVGGHPAVSISDWQKQIRFLKTAIKSK----------
LPXD2_LEGPL      GKGATVLASGKVY--KNVK-SGDRVGGHPAVSISDWQKQIRFLKTAIKPK----------
LPXD2_LEGPA      GKGATVLTCSKVL--RNVQ-PGDRVIGYPAISISDWQKQIRFLKTAIKSK----------
LPXD_RICCN       GDGAQVAAQGGVA--QNIE-AGKIVGGSPAIPIMDWHRQSIIMKQLLKTS----------
LPXD_RICRI       GDGAQVAAQGGVA--QNIE-AGKIVGGSPAIPIMDWHRQSIIMKQLLKTS----------
LPXD_RICFE       GDGTQVAAQGGVA--QNIE-AGKIVGGSPAVPIMDWHRQSIIMKQLVKTS----------
LPXD_RICPR       GDGTQVAAQGGVA--QNIE-EGKIVGGSPAVPIMDWHRQSIIMKQLVKTS----------
LPXD_RICTY       GDRTQVAAQGGVA--QNIE-EGKIVGGSPAVPIMDWHRQSIIMKQLVKTS----------
LPXD_RICBR       GDGAQVAAQGGVA--QNIE-AGKIVGGSPAVPIMDWHRQSIIMKQLINK-----------
                                                                             

LPXD1_KORVE      --------KKSE----------------------------------
LPXD2_GLOVI      --------RIAVLEEPFKTNGKSGQADAPPKVALECHGTTGDAPQG
LPXD_THEEB       --------KVGE----------------------------------
LPXD_TRIV2       --------QLEEEGKR------------------------------
LPXD_NOSS1       --------QSDKESKR------------------------------
LPXD_TRIEI       --------KL------------------------------------
LPXD_SYNP6       --------RVEVLEQDRPSS--------------------------
LPXD_SYNE7       --------RVEVLEQDRPSS--------------------------
LPXD_SYNY3       --------V-------------------------------------
LPXD3_GLOVI      --------KVALLQQRLDSGHH------------------------
LPXD_SYNJA       --------RVAKLEQNGGR---------------------------
LPXD_SYNJB       --------RVAKLEQNSTDRAPNAKMLEVGVDPETTCSS-------
LPXD_PROM9       --------Q-------------------------------------
LPXD_PROMP       --------K-------------------------------------
LPXD_PROMA       --------SV------------------------------------
LPXD_PROMT       --------KKSR----------------------------------
LPXD_SYNPX       --------NTPQ----------------------------------
LPXD_SYNSC       --------DTPQ----------------------------------
LPXD_SYNS9       --------DISQ----------------------------------
LPXD_PROMM       --------DTPQ----------------------------------
LPXD_DESAG       --------ELEALKGESGRDS-------------------------
LPXD_DESVH       --------ELAELKKSLSEEQ-------------------------
LPXD_LAWIP       --------ILEKKKEHNI----------------------------
LPXD_NITOC       --------RLTVLEQVESC---------------------------
LPXD_ANADE       --------EVERLRADAGEDEP------------------------
LPXD_MYXXD       --------RVETLEKEKGP---------------------------
LPXD_SYNAS       --------RIETLEKLSEMKKEVEKEKESSREKEETK---------
LPXD_GEOMG       --------RVRELEEKQGA---------------------------
LPXD_GEOSL       --------RLRELEEKLESAV-------------------------
LPXD_PELCD       --------RIEELEKLIKER--------------------------
LPXD1_GLOVI      --------RIEQLEVQLLGRL-------------------------
LPXD_DESPS       --------SVEELAGKN-----------------------------
LPXD_PSE14       ETVTCADNRSSDG---------------------------------
LPXD_PSESM       ETVTCADNRSSDG---------------------------------
LPXD_PSEU2       ETVTCADNRSSDG---------------------------------
LPXD_PSEF5       GDVTPGGNASSDG---------------------------------
LPXD_PSEPF       GEVTPDGNASSEG---------------------------------
LPXD_PSEPK       DTVTSGGLPTSEG---------------------------------
LPXD_PSEAE       AAVTSSGDASSDA---------------------------------
LPXD_HAHCH       -----GGRRKSDAD--------------------------------
LPXD_CHRSD       --------GASDTP--------------------------------
LPXD_ALCBS       ---------LSD----------------------------------
LPXD_XANC5       ---------EKE----------------------------------
LPXD_XANAC       ---------EKE----------------------------------
LPXD_XANOM       ---------EKE----------------------------------
LPXD_XANOR       ---------EKE----------------------------------
LPXD_XANC8       ---------ENQ----------------------------------
LPXD_XANCP       ---------ENQ----------------------------------
LPXD_XYLFA       ---------EKA----------------------------------
LPXD_XYLFT       ---------EKA----------------------------------
LPXD_BLOPB       --------KLKKLLFL------------------------------
LPXD_BLOFL       --------KVNCFFYIVIVGFFIVLGLTGLFPLIYFFVKQG-----
LPXD_ECOL5       --------KVNQQD--------------------------------
LPXD_SHIBS       --------KVNQQD--------------------------------
LPXD_SHISS       --------KVNQQD--------------------------------
LPXD_ECOL6       --------KVNQQD--------------------------------
LPXD_ECO57       --------KVNQQD--------------------------------
LPXD_SHIFL       --------KVNQQD--------------------------------
LPXD_SHIDS       --------KVNQQD--------------------------------
LPXD_ECOLI       --------KVNQQD--------------------------------
LPXD_ECOUT       --------KVNQQD--------------------------------
LPXD_SALTI       --------KVNQQD--------------------------------
LPXD_SALTY       --------KVNQQD--------------------------------
LPXD_SALPA       --------KVNQQD--------------------------------
LPXD_SALCH       --------TVNQQD--------------------------------
LPXD_PECAS       --------KVDNV---------------------------------
LPXD_SODGM       --------KLAKN---------------------------------
LPXD_YERPA       --------KIDKE---------------------------------
LPXD_YERPN       --------KIDKE---------------------------------
LPXD_YERPE       --------KIDKE---------------------------------
LPXD_YERPS       --------KIDKE---------------------------------
LPXD_YEREN       --------KIDKE---------------------------------
LPXD_PHOLL       --------KLEDENE-------------------------------
LPXD_WIGBR       --------KYKKK---------------------------------
LPXD_HAEI8       --------KIS-----------------------------------
LPXD_HAEIN       --------KIS-----------------------------------
LPXD_PASMU       --------KFEKK---------------------------------
LPXD_HAES1       --------KLAE----------------------------------
LPXD_MANSM       --------KLAD----------------------------------
LPXD_HAEDU       --------QLTE----------------------------------
LPXD_ALIF1       --------KLVD----------------------------------
LPXD_PHOPR       --------KLNESN--------------------------------
LPXD_VIBVU       --------IVEQKKED------------------------------
LPXD_VIBVY       --------IVEQKKED------------------------------
LPXD_VIBPA       --------QLEQKEES------------------------------
LPXD_VIBCH       --------LLEQSDTVQPDNSQAE----------------------
LPXD_COLP3       --------LLAKN---------------------------------
LPXD_PSEA6       --------SHLK----------------------------------
LPXD_PSET1       --------LNKP----------------------------------
LPXD_IDILO       --------QADDNN--------------------------------
LPXD_SHESM       --------NSNTPE--------------------------------
LPXD_SHESR       --------NSNTPE--------------------------------
LPXD_SHEON       --------NLNTPE--------------------------------
LPXD_SHEFN       --------SAKGSE--------------------------------
LPXD_SHEDO       --------QQKTQD--------------------------------
LPXD_SACD2       --------AQKD----------------------------------
LPXD_ALKEH       STG--EGDGGDDGD--------------------------------
LPXD_AROAE       --------RKAR----------------------------------
LPXD_DECAR       --------KLKEKDIEG-----------------------------
LPXD_METFK       --------QLAPQQVSGIQRDK------------------------
LPXD_THIDA       --------RLNELENKT-----------------------------
LPXD_BORBR       --------E-------------------------------------
LPXD_BORPA       --------E-------------------------------------
LPXD_BORPE       --------E-------------------------------------
LPXD_BORA1       --------A-------------------------------------
LPXD_POLSJ       --------SLSNIQEKS-----------------------------
LPXD_RHOFT       --------KLMTLRDRP-----------------------------
LPXD_BURCA       --------ALAAQ-GGTDA---------------------------
LPXD_BURL3       --------ALAAQ-GGTDA---------------------------
LPXD_BURP1       --------ALAAR-EGDAGGA-------------------------
LPXD_BURPS       --------ALAAR-EGDAGGA-------------------------
LPXD_BURMA       --------ALVAR-EGDAGGA-------------------------
LPXD_BURTA       --------ALAAR-EGDAGGA-------------------------
LPXD_PARXL       --------AAAGRQDGPAANAASSSAGDKA----------------
LPXD_CUPPJ       --------RLRGQS-AGTQTSQD-----------------------
LPXD_CUPMC       --------RQRGENNAPAQNKQDEEKSS------------------
LPXD_RALSO       --------QVKHLQ----QSS-------------------------
LPXD2_FRAT1      --------KIK-----------------------------------
LPXD2_FRATH      --------KIK-----------------------------------
LPXD2_FRATO      --------KIK-----------------------------------
LPXD2_FRATT      --------KIK-----------------------------------
LPXD_COXBU       --------LIR-----------------------------------
LPXD_NEIG1       --------QLSDS-KDTQ----------------------------
LPXD_NEIMA       --------QLSDG-KDTQ----------------------------
LPXD_NEIMB       --------QLSDAGQDSK----------------------------
LPXD_CHRVO       --------ELETLKKSKEEPHE------------------------
LPXD_PSYA2       ----------------------------------------------
LPXD_PSYCK       ----------------------------------------------
LPXD_ACIAD       IQTQIESLESTFKLRK------------------------------
LPXD_HYDCU       QELKSKLEND------------------------------------
LPXD_BACFN       E-------ELKQQLNK------------------------------
LPXD_BACFR       E-------ELKQQLNK------------------------------
LPXD_BACTN       E-------ELKQLLNK------------------------------
LPXD_PORGI       S-------ELKEICKNNKH---------------------------
LPXD_CYTH3       L-------NLSGIKES------------------------------
LPXD_CHLCH       K-------ALRGSEMPLQNTL-------------------------
LPXD_PELLD       K-------EQGASRD-------------------------------
LPXD_CHLTE       L-------ALQQQLGE------------------------------
LPXD2_KORVE      ----------------------------------------------
LPXD_METCA       --------AVAQLGSAE-----------------------------
LPXD_CHLAB       --------KVKGLSAQSTELQITP----------------------
LPXD_CHLFF       --------KVKGLSAQSEEAQITP----------------------
LPXD_CHLCV       --------KIKGLSVRSEEAQVTP----------------------
LPXD_CHLPN       --------QVRDLSTPSLAEIPSEI---------------------
LPXD_CHLTA       --------LVQKLEALSEQH--------------------------
LPXD_CHLTR       --------LVQKLEALSEQH--------------------------
LPXD_CHLMU       --------LVQKLEALSEQH--------------------------
LPXD_PARUW       --------RVLELESQN-----------------------------
LPXD1_FRAT1      NIDL------------------------------------------
LPXD1_FRATT      NIDL------------------------------------------
LPXD1_FRATH      NIDL------------------------------------------
LPXD1_FRATO      NIDL------------------------------------------
LPXD_FUSNN       ----------------------------------------------
LPXD_AQUAE       ----------------------------------------------
LPXD1_LEGPA      AVINKKLDIKAKEVE-------------------------------
LPXD1_LEGPH      AVINKKLDIKAKEVE-------------------------------
LPXD1_LEGPL      AVINKKLDIKAKEVE-------------------------------
LPXD_RHOBA       GRLSEALEEQSADIDQRKAA--------------------------
LPXD_CAMJR       ----------------------------------------------
LPXD_CAMJE       ----------------------------------------------
LPXD1_SULDN      ----------------------------------------------
LPXD2_SULDN      ----------------------------------------------
LPXD_HELPH       GFFKS-----------------------------------------
LPXD_HELPY       GFFKS-----------------------------------------
LPXD_HELPJ       GFFKS-----------------------------------------
LPXD_HELHP       ----------------------------------------------
LPXD_WOLSU       ----------------------------------------------
LPXD_GRABC       ----------------------------------------------
LPXD_MAGSA       ----KS----------------------------------------
LPXD_CHESB       ----MRKGSKG-----------------------------------
LPXD_RHILO       ----RKQGKDNG----------------------------------
LPXD_BARHE       ----KKEKR-------------------------------------
LPXD_BARQU       ----KKEKR-------------------------------------
LPXD_BRUAB       ----RKDASSDE----------------------------------
LPXD_BRUA2       ----RKDASSDE----------------------------------
LPXD_BRUME       ----RKDASSDE----------------------------------
LPXD_BRUSU       ----RKDASSDE----------------------------------
LPXD_NITHX       AGSATPDPTDRGA---------------------------------
LPXD1_NITWN      AGSPKAAPKDRVIE--------------------------------
LPXD_BRADU       ---SRADPKDEGRE--------------------------------
LPXD_RHOP2       AAPKADDGKDEDRG--------------------------------
LPXD_RHOPS       AAPKSDDGKDGERG--------------------------------
LPXD1_RHOPB      GAD-SKDAKGERQG--------------------------------
LPXD_RHOPA       TAARPDDDRDEGRG--------------------------------
LPXD2_RHOPB      AAAPSSDATGVDQPDQAAS---------------------------
LPXD2_NITWN      ----------------------------------------------
LPXD_RHIEC       ----RGRNPGGKQND-------------------------------
LPXD_RHIL3       ----RGKKPGGEQND-------------------------------
LPXD_AGRFC       ----RDKKTGEKNNG-------------------------------
LPXD_RHIME       ----RQKKKGGKDE--------------------------------
LPXD_HYPNA       ----KKSN--------------------------------------
LPXD_CAUVC       ----RGTRG-------------------------------------
LPXD_MARMM       ----KNKTPKKG----------------------------------
LPXD2_LEGPH      ----KSPKS-------------------------------------
LPXD2_LEGPL      ----KSPKS-------------------------------------
LPXD2_LEGPA      ----NPLKS-------------------------------------
LPXD_RICCN       ----NSKLKK------------------------------------
LPXD_RICRI       ----NSKLKK------------------------------------
LPXD_RICFE       ----NSKLKK------------------------------------
LPXD_RICPR       ----NSKLKK------------------------------------
LPXD_RICTY       ----NNKLKK------------------------------------
LPXD_RICBR       ----RSK---------------------------------------