CLUSTAL format seed alignment for MF_00530

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ATPE_CLOAB      ---MANNIKLSILTPQKTFYVGD-VKEIITRTVEGEIGILPNHTDLVAFL-TPTETILVE
ATPE_RUMA7      ----MAVFKLRVLTPEKIFFEGD-AEQLIAKTTSGYVGILKGHAPYVASI-VPSEMKIRS
ATPE_HELPY      ----MALLKISVVVPEGEVYTGE-VKSVVLPGVEGEFGVLYGHSNMITLL-QAGVIEIE-
ATPE_HELPJ      ----MALLKISVVVPEGEVYTGE-VKSVVLPGVEGEFGVLYGHSNMITLL-QAGVVEIE-
ATPE_CAMJE      ---MNDLINFEIVTPLGVIYQGE-VKSVTLPGSEGEFGVLKGHAALVSSL-KSGVIDIE-
ATPE_RICCN      ---MNATILVKIITPLSIALEKQ-AKMVTMSGEEGMFGVLPSHVPMIVSL-KAGLVQVY-
ATPE_RICPR      ---MHETIRVKIITPSSIAFEKQ-SKMVTMPGEDGMFGVLPHHVPMIVNL-KAGLVQIY-
ATPE_NOSS1      -----MTLTVRVISPDKTVWDAE-ADEVILPSTTGQLGILSGHAPLLTAL-DTGVLRVR-
ATPE_SYNE7      -----MSLTVRVIAPDRTVWDAP-AQEVILPSTTGQLGILPGHAPLLSAL-DTGVLRVR-
ATPE_SYNP1      -----MVMTVRVIAPDKTVWDAP-AEEVILPSTTGQLGILSNHAPLLTAL-ETGVMRVR-
ATPE_PRODI      -----MTLTLRVITPDKTVWDDS-VEEIVLPSTTGQVGVLTGHAPLLTAL-DTGVMRVR-
ATPE_SYNY3      -----MTLTVRVITPDKVVWDEE-VQELILPSTTGQLGILSNHAPLLTAL-EIGVMRVR-
ATPE_GUITH      -----MSIHISIIAPDRTVWDAN-AEEVILPSSTGQLGILKGHAPLLTAL-DIGVMRVR-
ATPE_PORPU      -----MTLNIRIIAPDRTVWDAE-AQEIILPSSTGQLGILTGHAPLLTAL-DIGVMRVR-
ATPE_GALSU      -----MGLNIRVIAPDRIVWNAK-AEEVILPTSTGQLGILSGHAPLLTAL-DIGVMRVR-
ATPE_CYACA      -----MALTVKVITPDRVVWKKT-VEEIILPSSTGQLGILMNHAPLLTAL-DIGVMRAR-
ATPE_CYAPA      -----MSLDVRVIAPNKVIWAKN-AEEVILPSQSGMLGILTSHAPLYTAL-NTGVMKIR-
ATPE_TRICV      -----MVMNVRVLTPTRVICSTT-ADEVILPGLTGLVGILDGHAALITAL-DTGLLRIK-
ATPE_PYLLI      -----MSLNIRVIAPDGLIWDTT-AEGVVLPSLTGQLGILTGHAPLITSL-EIGILRIK-
ATPE_ANTAG      -----MTLNLRVMAPNRIVWNSE-VEEIVLSTNSGQIGVLPNHAPLLTAL-DIGIIKIR-
ATPE_MARPO      ------MLNLRIMAPNRIVWNSD-IQEIILSTNSGQIGILPNHASVLTAL-DIGIVKIR-
ATPE_PICAB      -----MTLNLRVLSPNRVIWDSE-VKEIILSTNSGQIGVLPNHASLVAAV-DIGVMKIR-
ATPE_PINTH      -----MTLNLRVLSPNRVIWDSE-VKEIILSTNSGQIGVLPNHASLVAAV-DIGVMKIR-
ATPE_ARATH      -----MTLNLCVLTPNRIVWDSE-VKEIILSTNSGQIGVLANHAPIATAV-DIGILKIR-
ATPE_OENEH      -----MTLNLCVLTPNRIVWDSE-VKEIILSTNSGQIGVLPNHAPIATAV-DIGILRIR-
ATPE_IPOBA      -----MTLKLCVLTPNRIVWDSE-VKEIILSTNSGQIGILPNHAPIATAV-DIGILRIR-
ATPE_TOBAC      -----MTLNLSVLTPNRIVWDSE-VEEIVLSTNSGQIGILPNHAPIATAV-DIGILRIR-
ATPE_SPIOL      -----MTLNLCVLTPNRSIWNSE-VKEIILSTNSGQIGVLPNHAPTATAV-DIGILRIR-
ATPE_LOTJA      -----MTLNLCVLTPNRIVWDSD-VKEIILSTNSGQVGILPNHAPLAMAL-DIGILRIR-
ATPE_CUSRE      -----MTLKLCVLTPNRIFWDSE-VEEIILSTNSGQIGILPTHTPIATSV-DIGILRIR-
ATPE_MEDSA      -----MTLNLCVLTPNRTVWDSE-VKEIILSTNSGQIGVLKNHAPIATAL-DIGILKIR-
ATPE_PEA        -----MTFNLCVLTPNRIVWDSE-VKEIILSTNSGQIGVLQNHAPIATAL-DIGILRIR-
ATPE_MAIZE      -----MKLNLYVLTPKRIIWDCE-VKEIILSTNSGQIGVLPNHAPINTAV-DMGPLRIR-
ATPE_ORYSA      -----MKLNLYVLTPKRIIWDCE-VKEIILSTNSGQIGVLPNHAPINTAV-DMGPLRIR-
ATPE_WHEAT      -----MKLNLYVLTPKRIIWDCE-VKEIILSTNSGQIGVLPNHAPINTAV-DMGPLRIR-
ATPE_MESVI      -----MSFQVRIIAPNGIIWDSE-AEEIILSTNTGKIGVLTNHTSLLTGL-DIGTIRIR-
ATPE_CHLVU      -----MTLQVCIMTPDRIFWNDQ-ADEIILPTNTGQMGVLTNHAPLITAL-DIGVTLIR-
ATPE_PROWI      -----MILKILIMIPDGIFWNNK-AEEIILPTNTGQIGILKNHAPLITAL-DIGVILIR-
ATPE_CHLRE      -----MSLQISILTPERPFWNGQ-ADEIILPTETGEMGVLKNHAPIITGL-NVGAMLIRG
ATPE_NEPOL      -----MSLQVRILTPEQVFLNVS-ADEIILPTNTGQMGVLTNHTPLITAI-DIGPMLVR-
ATPE_EUGGR      -----MTLDVSIIIPERVFWEKR-VEEIILPTLSGQMGVLKDHIPILTGL-DIGIILVR-
ATPE_BACP3      ----MKTIHVSVVTPDGPVYEDD-VEMVSVKAKSGELGILPGHIPLVAPL-EISAARLKK
ATPE_GEOSE      ----MKTIHVSVVTPDGPVYEDD-VEMVSVKAKSGELGILPGHIPLVAPL-EISAARLKK
ATPE_BACCA      ----MKTIHVSVVTPDGPVYEDD-VEMVSVKAKSGELGILPGHIRLVAPL-EISAARLKK
ATPE_BACMQ      ----MKTIHVSVVTPDGPVYESE-VEMVSTRAQSGELGILHGHIPMVAPL-QIGAVRLKK
ATPE_BACSU      ----MKTVKVNIVTPDGPVYDAD-IEMVSVRAESGDLGILPGHIPTVAPL-KIGAVRLKK
ATPE_BACPE      ----MSTIRVNVVTPDGKVYDGD-VDMVVVRTVEGELGILPKHIPLVAPL-TVGAVRLKK
ATPE_BACHD      ----MPTLHVNVVTPDGKVYEGD-VDMVSVKTVEGELGILPRHIPLVAPL-TVGAVRLKK
ATPE_LISIN      ----MGSLNVSIVTPDGPVYEGV-AQMVIARTKAGELGILPGHVPLVAPL-KIDIVRLKV
ATPE_STAAM      ----MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAAL-KTGFVKVKF
ATPE_LACLA      --MSENVMTLQVITPAGMIYDHH-ANYITARTTNGEIGILPNMISTIAGL-EIDELKVRR
ATPE_LACLM      --MSENVMTLQVITPAGVVYDHH-ANYITARTTNGEIGILPNMISTITGL-EIDELKVSR
ATPE_STREI      ----MTFMTVQVVTPDGIRYDHH-ANFISVKTPDGEMGILPEHINLIAPL-TVHEMKIHR
ATPE_STRP1      ----MTQMTVQVVTPDGIKYDHH-AKFISVTTPDGEMGILPNHINLIAPL-QVHEMKIRR
ATPE_STRMU      ----MAEMTVQIVTPDGLKYDHH-AKFILVKTPNGELGVLANHENLIAPL-EVHEMKIKR
ATPE_STRPN      ----MAQLTVQIVTPDGLVYDHH-ASYVSVRTLDGEMGILPRHENMIAVL-AVDEVKVKR
ATPE_STRSA      ----MAQMTVQIVTPDGLIYDHH-AAFVSVKTIDGELGILPRHINTIAVL-EVDQVKVRR
ATPE_ENTHA      ---MDQYLTVNVVTPDGLVYDHH-AAIVVARTTAGEIGILPKHAPIIVPL-TIDEVRVKR
ATPE_LACAC      MADPEKLFKVIVVTPNGMIYSHR-GSIVDVRAIDGERSILYNHIPILTPL-AISEVKVKR
ATPE_DESVM      ---MEKSLHLEIVTPDRLVLSEK-VDYVGAPGYEGEFGILPNHIPFLSAL-NIGSLYYKA
ATPE_MOOTA      ----MASLNLEIITPERVVLQAE-AASVIAPGIQGYLGVLPEHAPLITPL-QAGVVTCRR
ATPE_PROMO      ----MATFKLEVVTPLKKVLDRD-AEMVIMRTIEGDMGVMADHAPFVAEL-AVGEMKIKS
ATPE_THEMA      -------MKVKIVTPYGIVYDRE-SDFISFRTVEGSMGILPRRAPIVTQL-SVCDVKIKS
ATPE_MYCLE      ----MDELNIEIVAVDRKIWSGK-GTFLFTRTTAGEIGILPRHIPMVAQLVDDNMVRIER
ATPE_MYCTU      ----MAELNVEIVAVDRNIWSGT-AKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVER
ATPE_CORGL      ----MAEITVELVSVERMLWAGQ-ASIVTAQTTEGEIGVLPDHEPLLGQLVENGVVTIQP
ATPE_STRCO      ---MAAELHVALVAADREVWSGE-ATLVVARTTSGDIGVMPGHQPLLGVL-ESGPVTIRT
ATPE_BUCAI      -----MNFYLDVVSLTKTIFSGF-VEKIRVSGSEGELGIYPGHAQLLSIL-KPGMVYIFH
ATPE_BUCAP      -----MDFYLDIVSVEKRIFSGL-VDRIQVSGSEGEMGIYPGHTQLLSII-KPGVIYIFH
ATPE_ECOLI      ---MAMTYHLDVVSAEQQMFSGL-VEKIQVTGSEGELGIYPGHAPLLTAI-KPGMIRIVK
ATPE_SALTY      ---MAMTYHLDVVSAEQQMFSGL-VEKIQVTGSEGELGIYPGHAPLLTAI-KPGMIRIVK
ATPE_VIBAL      --MAAITFHLDVVSAEKKIFSGR-VETFQVTGSEGELGIFHGHTPLLTAI-KPGMVRIVK
ATPE_VIBCH      --MAAITFHLDVVSAEKKLFSGL-VETFQVTGSEGELGIFHGHTPLLTAI-KPGMVRIVK
ATPE_HAEIN      ----MATFNLTIVSAEQKIFEGE-VKQIQVTGVEGELGILPGHTPLLTAI-KPGIVKFTL
ATPE_PASMU      ----MSVFNLTVVSAEQQIFSGQ-VESIQATGIEGELGILAGHTPLLTAI-KPGIVKLTL
ATPE_NEIMA      ----MSIMQVEVVSSEQKIYSGE-ATFIVVPTVQGELGIYPRHEPIMSLV-RLGALRLTV
ATPE_NEIMB      ----MSIMQVEVVSSEQKIYSGE-ATFIVVPTVQGELGIYPRHEPIMSLV-RPGALRLTV
ATPE_PSEAE      ---MAITVHCDIVSAEAEIFSGL-VEMVIAHGALGDLGIAPGHAPLITDL-KPGPIRLVK
ATPE_XYLFA      ----MSTIRCDIVSAEQEIFHGE-ATLVVATGELGELGIVPKHAPLITRL-KPGKVIITT
ATPE_ACIFR      ---MAMTIDVRVVSAEGSIYAGV-ADMVVAPGEMGELGILPRHAPLLTGL-RPGELRIIH
ATPE_RHILO      ---MAEAFKFELVSPERLLVSEQ-VESVVIPGAEGEMTVMAHHAPVMTTI-KPGVVTVKT
ATPE_RHIME      ---MAESFNFELVSPERLLVSEK-VTEVVIPATEGEMTVMANHAPTMTTI-KPGVVAVKT
ATPE_RHOBL      ---MAATLQFDLVSPERRLASVQ-ATEVQIPGAAGDMTAMQGHAPTITTL-RPGILRAVS
ATPE_RHOCA      ---MADTMQFDLVSPERRLASVA-ASEVRLPGVEGDLTAMPGHAPVILSL-RPGILTVVS
ATPE_RHORU      ---MAETTEFELVSPERLLFSEP-VEMVVVPGTDGDFGAMPRHAPLLSTV-RPGVISTYN
ATPE_MYCGE      ----MKLLRFLVLSPSGIKLDKT-IISAQVKTTEGYIGLNFNRAPLIAAI-QSHLCKIIF
ATPE_MYCPN      ----MQPLRFLVLSPSGIKLDQA-IISAQVKTTNGYLGLNYNRAPLIAAV-QSHFCKILF
ATPE_MYCGA      ------MVKLKVLSPNGTLFDEK-IEMVIVKGAEGYAGFMRNTQPSIFAI-NNSVGYITY
ATPE_ACEWD      ---MAETFRLKIIAPTGVFFDDD-IERVVIRGIEGELAILAEHTPLTTNV-AIGTFNIIF
ATPE_DICDH      -----MSINIRIVTPTGFLWETK-AEEILLPSTTAPLIVLPGHINILTGL-SPGLLRVKV
ATPE_AQUAE      ------MIQVEIVSPQGMVYSGE-VESVNVPTVEGEVGILENHMYLMTLL-KPGLVYFNG
ATPE_MYCPU      -----MQLQLIITTPNGIFFNEK-VDIVTVVTAGGHIGIQYGHQPLISTI-EISELHINT
ATPE_UREPA      ---MANLTKLKIVTPYAQILEKD-VYSVELKTSEGRITVLPDHNPLMSTI-ENHVAYIRE
                           :                      .              :          

ATPE_CLOAB      E-------DGSRKKVFTSTGILNVGE---SEVSFMCDASEWPDEID-IQRAETAKERAEK
ATPE_RUMA7      --------DGSFRSAAISDGIVKVSED--SMVTVLTSAIEWSDEID-VARAERSKARAEK
ATPE_HELPY      ----TEN---QKEHIAINWGYAEVTN---ERVDILADGAVFIKKES-D-DRDDAISRAKK
ATPE_HELPJ      ----TEN---QKEHIAINWGYAEVTN---ERVDILADGAVFIKKGS-D-DRDDAISRAKK
ATPE_CAMJE      ----KADL--NHELIAIDAGHAKVDE---DKICVLAKGAVWVCGSD-ESEIEKNLAQAKD
ATPE_RICCN      ----IDDMHKSENTYLISGGVTEVTA---NYINIATETAINVTNLS-EVEIATKLLDLQK
ATPE_RICPR      ----IYNIHNYENTYLISGGVTEITS---HYINIVTEVAINVTNLS-ESEISTQRYELQK
ATPE_NOSS1      -----TSKSQNWQAIALLGGFAEVEE---DEVTILVNGGERGDTIN-LEEARTAYSQAQT
ATPE_SYNE7      -----ADK--EWLAIAVLGGFAEVEN---NEVTVLVNAAERGDKID-LEEARAAFSQADE
ATPE_SYNP1      -----QER--EWVAIALMGGFAEVEN---NEVTVLVNAAERGDTID-LETAKREFSEAQA
ATPE_PRODI      -----PGK--DWQAIALMGGFAEVEN---NEVKVLVNGAEVGDSID-KETARTEFQQAEQ
ATPE_SYNY3      -----PGK--DWQNIAVMGGFAEVEN---NEVKVLVNGAELGTTID-AESARQAYTAAQG
ATPE_GUITH      -----VDR--DWTPIVLLGGFAEIEN---DELTILVNGAEEASQID-RDQAQRDLEEMTV
ATPE_PORPU      -----VDK--EWMPIVLLGGFAEIEN---NQLTILVNGAEEASQID-LVEAEKNLDTATQ
ATPE_GALSU      -----ITN--TWTSIVLFGGFAEVEN---DEILILVNGAEEASVIN-LDKANKELIESSS
ATPE_CYACA      -----MVN--TWVPLVLLGGFAQIDN---NLVTIIVSDAEEVKAID-EEEANKLLAASLA
ATPE_CYAPA      -----NET--GWTSIVVMGGFVEVEK---NEVLVLVNAGEYVDEID-LSAAKKDVEKALE
ATPE_TRICV      -----LNE--KWTPIILCGGLAEIDR---NRVTVLVNDVEELVAVE-LNEATTELEKATL
ATPE_PYLLI      -----TNS--KWTPIIVLGGFAVIKD---DEVLVLISGVEEVIKED-YSKAKSILAKAKI
ATPE_ANTAG      ----LNGE---WSTMALMGGFAMIDN---NGMTILVNEAEKATEIN-PQEARENYKMAQK
ATPE_MARPO      ----LNDQ---WSTMALMGGFAMIDN---NNLTILVNDAEKASEID-YQEAQETFQKAKT
ATPE_PICAB      ----LNGQ---WSTMALMGGFAKIDN---DRITVLVNNAERDVDID-LKEAQETFKVAKA
ATPE_PINTH      ----LNGQ---WSTMAMMGGFAKIDS---DRITILVNNAERDVDID-PREAQENFRIAKA
ATPE_ARATH      ----LANQ---WLTMALMGGFARIGN---NEITILVNDAEKNSDID-PQEAQQTLEIAEA
ATPE_OENEH      ----QNGQ---WLTMALMGGFARIGN---NEITILVNDAEKGSDID-PQEAQETLGLAEA
ATPE_IPOBA      ----LNDQ---WVTMALMGGFARIGN---NEITVLVNDAEKGSDID-SLEAQQTLEIAEA
ATPE_TOBAC      ----LNDQ---WLTMALMGGFARIGN---NEITVLVNDAEKGSDID-PQEAQQTLELAEA
ATPE_SPIOL      ----LNDQ---WLTLALMGGFARIGN---NEITILVNDAERGSDID-PQEAQQTLEIAEA
ATPE_LOTJA      ----LNDQ---WLTMALMGGFARIGN---NEITVLVNDAEKGSDID-PQEAQQTLEIAEA
ATPE_CUSRE      ----LNGR---WLTMALMGGFARIGN---NEITVLVNDAERSSDID-PQEAQQTVEIAEA
ATPE_MEDSA      ----LTNQQ--WVTMALMGGFARIGN---NEITILVNDAEKSIDID-PQEAQQTLKIAEA
ATPE_PEA        ----LKDR---WLTMALMGGFARIGN---NEITILVTDAESASDIN-PQEAQQTLQIAEA
ATPE_MAIZE      ----LLNDQ--WLTAVLWSGFARIVN---NEIIILGNDAELGSDID-PEEAQQALEIAEA
ATPE_ORYSA      ----LLNDQ--WLTAVLWSGFARIVN---NEIIILGNDAELGSDID-PEEAQQALEIAEA
ATPE_WHEAT      ----LLNDQ--WLTAVLWSGFARIVN---NEIIILGNDAELGSDID-PEEAQKALEIAEA
ATPE_MESVI      ----ALNNQ--WNTLALMSGFAVIKD---NVATIIVSEAENGANIK-SEEAQTQLEEAKS
ATPE_CHLVU      -----SNSN--WNPVALMGGFALVKQ---NQVTILVNEAESAQTIG-VDEAEIAFQEAKT
ATPE_PROWI      -----TDKK--WVPFIIMGGFALIKQ---NKITILVNGAESAGTLK-LVQSEAAFQEATN
ATPE_CHLRE      GQASGSKDE--WNSYAIMGGFALVKQ---NQVTILANEAVSAENIN-PEEAKDAFETAKA
ATPE_NEPOL      -----SEST--WQSMALLGGLALVKD---NQVIILVNEAELGSDIN-AEEAETTFLAAKE
ATPE_EUGGR      ---QKSSSD--WTSLVVTGGFALINS---NNVTILVNEAEFGSEIN-VEQAQISYNSSKH
ATPE_BACP3      G--------GKTQYIAVSGGFLEVRP---DNVTILAQAAERAEDID-VLRAK-ARKSGRT
ATPE_GEOSE      G--------GKTQYIAFSGGFLEVRP---DNVTILAQAAERAEDID-VLRAK-ARKSGRT
ATPE_BACCA      G--------GKTQYIAVSGGFLEVRP---DKVTILAQAAERAEDID-VLRAK-ARKSGRT
ATPE_BACMQ      A--------SSTELVAVSGGFLEVRP---DKVTILAQAAETAEEID-VARAEEAKKRAEM
ATPE_BACSU      D--------GQTEMVAVSGGFVEVRP---DHVTILAQAAETAEGID-KERAEAARQRAQE
ATPE_BACPE      G--------NSEEQVAVSGGFVEVRP---DQVTILAEAAELPSAID-VDRARAAKERAES
ATPE_BACHD      G--------STVDLVAVSGGFVEVRP---DQVTILAEAAELPSDID-VERARSAKERAEK
ATPE_LISIN      E--------SGEEWVAVNGGFMEVNG---EEVNILADTAEREQDID-IDRAEKAKQRAEE
ATPE_STAAM      H--------DGTEYIAVSDGFVEVRK---DKVSIIVQTAETAREID-VERAKLAKARAES
ATPE_LACLA      P-----DDETHVDYIAVNGGIIEIKD---SLVTIVADSAERNRDID-VSRAERAKIRAEK
ATPE_LACLM      P-----DDETHVDYIAVNGGIIEIKD---SLVTIVADSAERNRDID-VSRAERAKIRAEK
ATPE_STREI      T-----DDPNHVDWVAINGGIIEIKD---NLVTIVADSAERERDID-VSRAERAKIRAER
ATPE_STRP1      G-----GEDEKVDWIAINGGIIEIKD---NVVTIVADSAERDRDID-VSRAERAKLRAER
ATPE_STRMU      I-----DDDSHVDWVAVNGGIIEIKD---NLVTIVADSAERERDID-LSRAERAKKRAEK
ATPE_STRPN      I-----DDKDHVNWIAVNGGVIEIAN---DMITIVADSAERARDID-ISRAERAKLRAER
ATPE_STRSA      V-----DDDKHIDWIAVNGGIIEIAD---NVITIVADSAERARDID-ISRAERAKRRAEL
ATPE_ENTHA      T-----DSDTHVDWIAVNGGIMEVRD---NVVSIVADSAERERDID-VSRAERAKQRAER
ATPE_LACAC      SR----EMGSRIDHIAISGGYIEFSN---NVATIVADSAERARNID-VSRAQAAKERAEK
ATPE_DESVM      G-------GKTH-WIFVSGGFAEVSD---NKVTVLAESAERAEDID-LERARKAKERAEQ
ATPE_MOOTA      R-------ERAEERVAVSGGFLEAGP---DQVIILADTAERSEEID-VEWARQARERAER
ATPE_PROMO      A--------NGEEAYFVSGGFLEISK---EKTMILADEAIDVKEID-VERAKREAEIAKE
ATPE_THEMA      G--------DDEYHLKVAGGFLLCDG---KDVIIITEEAG------------REEDISPD
ATPE_MYCLE      -------EGEKDLRVAVDGGFLSVTE---ERVSILAESAEFDSEID-ENAAKQDAES---
ATPE_MYCTU      -------EGEKDLRIAVDGGFLSVTE---EGVSILAESAEFESEID-EAAAKQDSES---
ATPE_CORGL      I------DGEK-LIAGVSDGFLSVSK---EKVTILADFAVWANEVD-TASAEADLNS---
ATPE_STRCO      S------DGGT-VVAAVHGGFISFAD---NKLSLLAEVAELSDEID-VHRAERKLEQAKT
ATPE_BUCAI      K------KDKKEECIYISGGILEVQP---SVVSILADVAIHAIDLD-RSRILKTKKNAEE
ATPE_BUCAP      K-------NKTEECLYISGGILEVQP---SVVSILADVAIRGIDLD-RKRVVKAKKQAEE
ATPE_ECOLI      Q-------HGHEEFIYLSGGILEVQP---GNVTVLADTAIRGQDLD-EARAMEAKRKAEE
ATPE_SALTY      Q-------HGHEEFIYLSGGILEVQP---GSVTVLADTAIRGQDLD-EARALEAKRKAEE
ATPE_VIBAL      Q-------HGHEEIIYVSGGMVEIQP---GTATVLADTAIRGEELD-AAKAEEAKRRAEE
ATPE_VIBCH      L-------HGHEEYIYVSGGIVEVQP---GTATVLADTAIRGEDLD-AAKAEEAKRRAEE
ATPE_HAEIN      K-------DGNEEVIYVSGGFLEVQP---NIVTVLADIAIRGSELD-ADRIHEAKRKAEE
ATPE_PASMU      E-------DGKEEVIYVSGGFLEVQP---NVVTVLADTAIRGDELD-GDRILAAKKRAEE
ATPE_NEIMA      L------GEDKEVLVAVSGGVLEVQP---DKVTVLADVAVRSAEMD-QARAEEAKKAAEA
ATPE_NEIMB      P------GEDKEVLVAVSGGVLEVQP---DKVTVLADVAVRSAEMD-RARAEEAKKAAEA
ATPE_PSEAE      Q------GGEQEVY-YISGGFLEVQP---NMVKVLADTVVRAGDLD-EAAAQEALKAAEK
ATPE_XYLFA      V------NGEQLDF-AISGGILEVQP---QVVTILADSAIRADTID-EVAVRKAKEEAER
ATPE_ACIFR      -------GAETEYL-FVNGGILEIQP---DMVTVLADSAERATDID-EAKALAAKQAAEA
ATPE_RHILO      -------ASGGEERYVVFGGFADIVP---AGCTLLAESAVAVKDVD-RADLARRIQEAKE
ATPE_RHIME      -------AAGKTERYAVFGGFADILP---SGCTLLAESAVHVDELD-PTVLENRIEAARA
ATPE_RHOBL      -------AEG-TKAYVVTGGFAEISA---TGVSVLAERAVPLDEMD-AKLMDQLVADASA
ATPE_RHOCA      -------AAG-TAEYAVTGGFAEVSG---EKVTVLAERGLTRAELT-AAVHAEMLAEAKK
ATPE_RHORU      -------GGKVQRRIFVAGGFAEVTE---DRCTVLADEAFDLASLS-EEAVRARLQAADD
ATPE_MYCGE      A-------DQTKREAIIGAGLMLIKK---TEAKIFTENFVFADEVD-INETLKRKTELER
ATPE_MYCPN      A-------NNTRRNAIIGAGLVLIKK---TEAKIFTENFVFEDEID-LEATLKRKAELER
ATPE_MYCGA      P-------DKTKKSVVIENATLYCNK---DLIKIFALDFVIADNLS-YDEIMKRKKDLES
ATPE_ACEWD      AD-------KKKKNGTLLGGIATINP---RETIILTDAAEWPEEID-IKRAQEAKERALK
ATPE_DICDH      D--------SRWKPILISSGAAQILTSDSTNVDVGIMEVEEIKQEN-FKEAELLLEKAND
ATPE_AQUAE      D---------DKNGIAVTYGVLDVTP---QKVLILAEEAYEVGKLPPASKLKEEFEEAVK
ATPE_MYCPU      E------GHKDYRICSINGGLLYVEK---DKANIITGAIEFKEDID-IEKARREHDYLVE
ATPE_UREPA      L------PNTPRKPLLLLDGIVYIEQ---HQVRVFSDYFKFLDEIQ-IDEINSSLNQLKH
                                   .             .                          

ATPE_CLOAB      RLKT----SNNIDVKRAELSLSRALARIKTKND-------
ATPE_RUMA7      QLKAE---TSRTEFDLAERQLKRAVNRISVANKK------
ATPE_HELPY      LLEDASS---------DRLAVSSVLAKIESL---------
ATPE_HELPJ      LLEDASS---------DRLAVSSVLAKIESL---------
ATPE_CAMJE      LIKSMSS---------DNAALAATFSKLDNARMH------
ATPE_RICCN      TLSDQH----------------------------------
ATPE_RICPR      LLSHQH----------------------------------
ATPE_NOSS1      KLNQVPA-GDRQAQIQANQAFKRARARFQAAGGLA-----
ATPE_SYNE7      RLKGVKE-DDRQGKFQATQAYRRARARLQAAGGLVSV---
ATPE_SYNP1      AVAKAAQSGSKQAQIQAAQAFRRARARLQAAGGVVEI---
ATPE_PRODI      NLARANQGDNRQELIQATQEFKKARARFQAAGGMT-----
ATPE_SYNY3      ALEEANRGEDKPNQLKASNNYKKARARLQAAGGAV-----
ATPE_GUITH      KFNEATT---NKERIEATQNLRKARARLQAVSA-------
ATPE_PORPU      LLNDASS---SKEKIEATQNIRKARARVQAATAASA----
ATPE_GALSU      LLNEAKT---NKEKFEATQKLRKAKARVQAANTLTNQSIY
ATPE_CYACA      NMEKAQS---NREKIESMQNLRRARARMQAILSLK-----
ATPE_CYAPA      TFNSAEA---PKEKEEAAEFLKYAQARLKAVVDK------
ATPE_TRICV      AVENAET---SKARLDASIELKKAVARLEGMNYLS-----
ATPE_PYLLI      DLDSAKT---TKEIIDASQELKIASAKVKAFKFI------
ATPE_ANTAG      DLAKAEGG--KQK-IEANLAFKRAKARLEAIDVISFPVSN
ATPE_MARPO      NLEEAEGN--KKKEIEALLVFKRAKARLEAINMASKL---
ATPE_PICAB      DLARAEG---KRQAIEADVALKRARTRLEAISASPPVSN-
ATPE_PINTH      DLARAEG---KRQAIEADLALKRARTRLEAINASPPVSN-
ATPE_ARATH      NLRKAEG---KRQTIEANLALRRARTRVEALNTI------
ATPE_OENEH      NFRKAEG---KRQTIEANLALRRARTRVEAINVIS-----
ATPE_IPOBA      NFRKAEG---KRQTIEANLALRRARTRVEAINAIS-----
ATPE_TOBAC      NVKKAEG---RRQKIEANLALRRARTRVEAINPIS-----
ATPE_SPIOL      NLRKAEG---KRQKIEANLALRRARTRVEASNTISS----
ATPE_LOTJA      NLKEAKG---KRQTIEANLALRRARTRVESINMIS-----
ATPE_CUSRE      NFRKAKG---KRQKIEANIALCRARTRVKAVSPISVGK--
ATPE_MEDSA      NLNKAEG---KRQTIEANLALRRARTRVETILESINRF--
ATPE_PEA        NLNKAEG---KRETIEANLSLRRAKTRVEAIVETIKRIS-
ATPE_MAIZE      NLSKAEG---TKELVEAKLALRRARIRVEAVNWIPPSN--
ATPE_ORYSA      NVSRAEG---TKELVEAKVALRRARIRVEAVNWIPPSN--
ATPE_WHEAT      NLSKAEG---TKDLVEAKLALRRARIRIEAVNWIPPSN--
ATPE_MESVI      YFNTAKG---TKNEVEANLAVKRAETRLKASQNL------
ATPE_CHLVU      KLEQSQG---EKQRVEATFVFKRARARYQVVKQLGV----
ATPE_PROWI      KLENAKS---KKQYVDALFLFKCAKARYQAAKQLVS----
ATPE_CHLRE      NLEKAEG---VKEKVEANFAYKRAKARYQVVKVLKKI---
ATPE_NEPOL      ALANSKT---RKDQIENNLAFKRARVRYQVATLVK-----
ATPE_EUGGR      ALEMNKD---IKRKFELTLNLKKARARFQVTQLKK-----
ATPE_BACP3      PLQSQ---QDDIDFKRAELALKRAMNRLSVAEMK------
ATPE_GEOSE      PLQSQ---QDDIDFKRAELALKRAMNRLSVAEMK------
ATPE_BACCA      PLQSQ---QDDIDFKRAELALKRAMNRLSVAEMK------
ATPE_BACMQ      RLDSK---QDDVDVKRAEIALKRAVNRLDISQRKF-----
ATPE_BACSU      RLNSQ---SDDTDIRRAELALQRALNRLDVAGK-------
ATPE_BACPE      RLNSTK--QDAVDFKRAELALKRAINRLDVTGK-------
ATPE_BACHD      RLQQAK--QENIDFKRAELSLRRATNRLDVAGR-------
ATPE_LISIN      ELSRAK--EQKVDEVMARLALQRAINRIHAKEHN------
ATPE_STAAM      HLEND---DDNTDIHRAERALERANNRLRVAELK------
ATPE_LACLA      ALEVAKAEKKSDEINRAEVALHRALNRLNVSSHR------
ATPE_LACLM      ALEVAKAEKKSDEIKRVEVALHRALNRLNVSSHN------
ATPE_STREI      KLEQAQSTHDIDEVRRAQVALRRALNRISVGNK-------
ATPE_STRP1      EIAQAETTHNIDEVRRAKVALRRALNRINVSKK-------
ATPE_STRMU      AIEEAKEQHRIDEVQRAQVALRRALNRINVGSK-------
ATPE_STRPN      AIEEAQDKHLIDQERRAKIALQRAINRINVGNRL------
ATPE_STRSA      EIEEAHDKHLIDQERRAKIALQRAINRINVGTRI------
ATPE_ENTHA      QIAEAKEKEDTNELKRATVALHRAINRIKVSKHS------
ATPE_LACAC      RLREAREKHDERNLERAQVALKRAMNRISVYNARGH----
ATPE_DESVM      RLAQA---KEKLDSARAQAALQRAMARMRVRGAA------
ATPE_MOOTA      RLRER---PPGLDVARAEAALRRAVARLKAAGAI------
ATPE_PROMO      TLVKL---KEDKDIAVTQKSLQEALTKVRIAEQYMHHL--
ATPE_THEMA      RFMEA---RER--VERVRRFFQSSL---------------
ATPE_MYCLE      -DDPRIAARGRARLRAVGAID-------------------
ATPE_MYCTU      -DDPRIAARGRARLRAVGAID-------------------
ATPE_CORGL      -DDELAKAHAEAGLRAVRRSSEGL----------------
ATPE_STRCO      EGDAHAERRADVRLRAAAGR--------------------
ATPE_BUCAI      SIKSNNTKINKDAILLQISKEIAKLRVLEVMDKFK-----
ATPE_BUCAP      YFKKETTNVKKDDVLLEISKAIAKLRVLEIMDKFKK----
ATPE_ECOLI      HISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM-----
ATPE_SALTY      HIKSSHGDVDYAQASAELAKAIAKLRVIELTKKAM-----
ATPE_VIBAL      QIQNQHGDMDFAQAASELAKAIAQLRVIELTKKRR-----
ATPE_VIBCH      RILNQHGDMDFAQAASELAKAIAQLRVIELTKKRR-----
ATPE_HAEIN      NIVSRGSDADHDLLVAKLSKELAKLRAYELTEKLLKTRR-
ATPE_PASMU      NIRTRHGDANYEMLASKLSKELAKLRAYELTEKLVKNKR-
ATPE_NEIMA      GISQAKDDKALAEAHKALAAAIAQLKTLDYIRSHKK----
ATPE_NEIMB      GISQAKDDKALAEAHKVLAAAIAQLKTLDYIRSHKK----
ATPE_PSEAE      ALQGKGAEFDYSAAAARLAEAAAQLRTVQQLRKK-FGG--
ATPE_XYLFA      ILANRGETIDVAKAQQQLVEAVVQMQALERLRRT-VKH--
ATPE_ACIFR      RMAGHTDQMEYAAAQAELLEQIARLKTVQRLREQGFVR--
ATPE_RHILO      DAADAKDDQARSKAEQFLSQLTTLEGAILPA---------
ATPE_RHIME      ELEGAGDE-KKTRLEQFIAELTKLGEIVIPA---------
ATPE_RHOBL      -ASSVGVDK--DTAEKAMSDLQAMKAAAGF----------
ATPE_RHOCA      -VADAAHPSVADAAAKMLADMEALGSHINL----------
ATPE_RHORU      RLKEATSEAEKAEAAQAKAIAEALLAARKG----------
ATPE_MYCGE      KIHHIKD---AKLNVKIEQNLMFELLKLSSKKK-------
ATPE_MYCPN      QMNHSKD---LKLNIKIEQNLMFELLKLSNKQR-------
ATPE_MYCGA      KIKDTTD---TKELIRLQHALDIELLKLKEAK--------
ATPE_ACEWD      RIHDDKF-----DTARARAALERAIARINSKENV------
ATPE_DICDH      ALNIINP-IDIRERIKAGEAKSFAESRVEAFKFLAT----
ATPE_AQUAE      KMATAQTMEELKEWEKEAEKARTLLELVEKYR--------
ATPE_MYCPU      ILSNSKN--KDSDYFRNELKLKKVINRLKISSNSTQSPKK
ATPE_UREPA      DLNNEED---DKKKLQLKSKIKLNESILIAYKDR------