CLUSTAL format seed alignment for MF_00531

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RR19_EUGLO       ------------------------------------------------------------
RS156_ARATH      --------------------------------------------------------MAIN
RS15B_SCHPO      --------------------------------------------------------MAEE
RS19_CENSY       ------------------------------------------------------------
RS19_NANEQ       ------------------------------------------------------------
RS19_META3       ------------------------------------------------MAKQKKFSGKGS
RS19_METB6       ------------------------------------------------------------
RS19_METS5       ------------------------------------------------------------
RS19_METBU       ------------------------------------------------------------
RS19_CALMQ       ------------------------------------------------MSKKPEGKVEAK
RS19_METKA       ------------------------------------------------------------
RS19_HALLT       ------------------------------------------------------------
RS19_METAR       --------------------------------------------------MVS-------
RS19_PICTO       --------------------------------------------------MVAKRQVSVK
RS19_ARCFU       ------------------------------------------------------------
RS19_METTP       ------------------------------------------------------------
RT19_ACACA       ------------------------------------------------------------
RT19_DICCI       ------------------------------------------------------------
RT19_TETSU       ------------------------------------------------------------
RT19_PROWI       ------------------------------------------------------------
RT19_MARPO       ------------------------------------------------------------
RT19_ARATH       MAFCTKLGGHWKQGVNVPVSSMLGSLRYMSTKLYIGGLSPGTDEHSLKDAFSSFNGVTEA
RT19_SCHPO       ------------------------------------------------------------
RT19_YEAST       ------------------------------------------------------------
RS19_WOLPP       ------------------------------------------------------------
RS19_ANAPZ       ------------------------------------------------------------
RS19_CARRP       ------------------------------------------------------------
RR19_HELSJ       ------------------------------------------------------------
RR19_EUGGR       ------------------------------------------------------------
RS19_PSET1       ------------------------------------------------------------
RR19_CRYJA       ------------------------------------------------------------
RR19_AGRST       ------------------------------------------------------------
RR19_JASNU       ------------------------------------------------------------
RR19_OENAR       ------------------------------------------------------------
RR19_CYAM1       ------------------------------------------------------------
RS19_ELUMP       ------------------------------------------------------------
RS19_TREPA       ------------------------------------------------------------
RS19_PELUB       ------------------------------------------------------------
RS19_ASTYP       ------------------------------------------------------------
RS19_DEHM1       ------------------------------------------------------------
RS19_CHLAD       ------------------------------------------------------------
RS19_FINM2       ------------------------------------------------------------
RS19_MYCPE       ------------------------------------------------------------
RS19_SORC5       ------------------------------------------------------------
RS19_SALRD       ------------------------------------------------------------
RS19_PERMH       ------------------------------------------------------------
RS19_PELPB       ------------------------------------------------------------
RS19_PETMO       ------------------------------------------------------------
                                                                             

RR19_EUGLO       ------------------------------------------------------------
RS156_ARATH      EPEFATAVAVATKK--------------------------RTFKKFSFRGFNVDALLKMS
RS15B_SCHPO      NHDEAVRVAELRKK--------------------------RTFRTFAYRGVELEQLLDLS
RS19_CENSY       -----------------------------------------MVKKFEYRGKPAEELESMP
RS19_NANEQ       ------------------------------------MIFSTMAKEFRYKGYTLQELEQMS
RS19_META3       ARSKRKQNRKQVGP--------------------------RRRVEFKYKGFTLGELQEMP
RS19_METB6       --MAAPKKTQKRMP--------------------------RRREEFTYRGYKIDELKAMG
RS19_METS5       --------MSVEIP--------------------------AEWKKFRYRGKSLEELLNMP
RS19_METBU       ----MAKKSTSRLP--------------------------KRKGEYTFRGKTVAQLQEMS
RS19_CALMQ       PTAKATEAAAAAAPAAAGAEEESSAEAGRRGWIMPTPIPQEEWKNFKYRGFTFDELMKMP
RS19_METKA       ---MAEERSKDDIPD----------------------WWEKEWVEFRYRGYTLGELMKMP
RS19_HALLT       --------------------------------MSSDYRTGREGKEFAYRGHSLDELQEMD
RS19_METAR       ----KQSKQAGRLP--------------------------KRKEEFTYRGLTIAEMKKLD
RS19_PICTO       SIKRKARKAQKAIT--------------------------GRAKEFSYRGHSLEELQNME
RS19_ARCFU       ---------------------------------MALKSKVIRPRDFKYRGYTLEELQKMP
RS19_METTP       ----MAKKAGSKLP--------------------------KRKEEFTYRGYRVSELAKMR
RT19_ACACA       ------------------------------------------------------------
RT19_DICCI       ------------------------------------------------------------
RT19_TETSU       ------------------------------------------------------------
RT19_PROWI       ------------------------------------------------------------
RT19_MARPO       ------------------------------------------------------------
RT19_ARATH       RVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNISVNVAKDWPSLPLSLDES
RT19_SCHPO       ------------------------------------------------------------
RT19_YEAST       ------------------------------------------------------------
RS19_WOLPP       ------------------------------------------------------------
RS19_ANAPZ       ------------------------------------------------------------
RS19_CARRP       ------------------------------------------------------------
RR19_HELSJ       ------------------------------------------------------------
RR19_EUGGR       ------------------------------------------------------------
RS19_PSET1       ------------------------------------------------------------
RR19_CRYJA       ------------------------------------------------------------
RR19_AGRST       ------------------------------------------------------------
RR19_JASNU       ------------------------------------------------------------
RR19_OENAR       ------------------------------------------------------------
RR19_CYAM1       ------------------------------------------------------------
RS19_ELUMP       ------------------------------------------------------------
RS19_TREPA       ------------------------------------------------------------
RS19_PELUB       ------------------------------------------------------------
RS19_ASTYP       ------------------------------------------------------------
RS19_DEHM1       ------------------------------------------------------------
RS19_CHLAD       ------------------------------------------------------------
RS19_FINM2       ------------------------------------------------------------
RS19_MYCPE       ------------------------------------------------------------
RS19_SORC5       ------------------------------------------------------------
RS19_SALRD       ------------------------------------------------------------
RS19_PERMH       ------------------------------------------------------------
RS19_PELPB       ------------------------------------------------------------
RS19_PETMO       ------------------------------------------------------------
                                                                             

RR19_EUGLO       -----------MSRSSK-----K----S-PFISYRLFNTIDKMNLKN---LKQ------L
RS156_ARATH      NVDLAKLFNARVRRRFY-----R----GLKKQPLILIKKLRRAKKEA---SDENKMKPEV
RS15B_SCHPO      AEQLVDLFHARARRRML-----R----GLGPNASRFIRKLRKAKSEA---PLNE--KPAT
RS19_CENSY       LDSLFRLFNSRQRRSLT-----R----GITDGKRKLIREIKDARAGK---EGN------P
RS19_NANEQ       LEELAKIMPARQRRTLL-----RRLKFGWSDQQKKLFKKILLAKEGK---YKK------P
RS19_META3       IKKFMEIVPARQRRSMK-----K----GITPKQRKLVMKIKKARRLA---NRGK--DPRT
RS19_METB6       LSELIPLMPARARRKFN-----R----GLNRGEETLLEKIRGGDEK--------------
RS19_METS5       MDDFIKLLPARQRRSLR-----K----GFTPSERTLIEKIRKIRRDS---KADK--P---
RS19_METBU       FEDFAELLPAKERRSIR-----R----GFSDSQKGVLQQFRDGKES--------------
RS19_CALMQ       MNEFIKLLPARQRRTLK-----R----GLRPCHRQLLEKIRKAKAFAAKGKSI------P
RS19_METKA       IEEFIELLPARQRRSLK-----R----GLPSRHKKLLRKVRRARRLL---RRGK--KPPV
RS19_HALLT       VDEVAELLPARQRRSIV-----R----GLGTEQQKLLEKVRSRDKETTADN--------P
RS19_METAR       MNQVAALLPARQRRKIK-----R----EFGEEHQKLLNAVKAGETK--------------
RS19_PICTO       LNELLPLLPARARRSYS-----R----QMNHEQEKLYEKLLGDKEN--------------
RS19_ARCFU       LEELAKLLPARERRKIK-----R----GFTEQEEKLLRKLRKKG---------------T
RS19_METTP       LEEIAELLPSRQRRTLR-----R----GLSKEHRKFMAKL-RARGT--------------
RT19_ACACA       ------------MRSVW-----K----G------CFYKNNNNGLS---------------
RT19_DICCI       -----------MVRSRW-----K----G-IYVAKELQNYNTVSNP--------------T
RT19_TETSU       -----------MSRAIW-----K----G-PFIDPFFFRKNGSSNSNN-------------
RT19_PROWI       -----------MARSLS-----K----P-PFCEVKLATNNS------------------V
RT19_MARPO       -----------MTRSIW-----K----G-PFVDTCLFKQKKI-----------------R
RT19_ARATH       IEEAEKKENKMMSRSVW-----K----D-PFVDAFLMKKKNAALNRK-------------
RT19_SCHPO       ----MFWTSVARARSVW-----K----G-PNVVDFGVNVQQCIKGNV------------P
RT19_YEAST       ----MQPAARLLSRSVW-----K----G-PNIVPLPIREAMTKGT--------------P
RS19_WOLPP       -----------MSRSVW-----K----P-PFLHPSVLRLVQRALKEG--SINK------V
RS19_ANAPZ       -----------MSRSVK-----K----P-PFCAPHVLRLANRVIASN--RTSV------V
RS19_CARRP       -----------MSRSIK-----K----G-VFLHKSLFLKIKNNKLEN-------------
RR19_HELSJ       --MGINNINKIPVRNNK-----I------SFVAVHLIKALTSKKQEKLVKLQRKKKIISV
RR19_EUGGR       -----------MSRSLK-----K----G-PFVFYSLIKKVDQMNSNR---FKS------V
RS19_PSET1       ------------MRNSHATFSQE----G-SFYRPTLLKKVEKALESG---DKK------P
RR19_CRYJA       -----------MARSLR-----K----N-TFVSNDLLSKIDNLNMNK---EKK------I
RR19_AGRST       -----------MTRK-K-----T----N-PFVAHHLLAKIEKVNRKE---EKE------T
RR19_JASNU       -----------MARSLK-----K----N-PFVVHHLVRKIDKLNKKK---KKG------I
RR19_OENAR       -----------MKRSLK-----N----N-PFVANPLLRKMEKLNRRE---DKI------L
RR19_CYAM1       -----------MSRSVK-----K----G-AYVHVRLLKKIERLNQKG---EKQ------I
RS19_ELUMP       -----------MGRSTK-----K----G-PFIDNNLLEKVQKMNTSS---EKK------P
RS19_TREPA       -----------MSRSVK-----K----G-PFVDKKLYKRVVEMNKAANQRNKK------V
RS19_PELUB       -----------MARSVW-----K----G-PFVEESLIKKVEKQKLDP---KKM------P
RS19_ASTYP       -----------MPRSVK-----K----G-PIVASHLLAKIEKQKNLK---NKK------V
RS19_DEHM1       -----------MSRSVK-----K----G-PALCPKLMKKVEVASATN---QKS------I
RS19_CHLAD       -----------MSRSSK-----K----G-PYVDIKLLDKIEAMNKAN---EKR------A
RS19_FINM2       -----------MSRSLK-----K----G-PFCDEHLMKKVEELNKND---EKK------I
RS19_MYCPE       -----------MSRSSK-----K----G-PYIEPSLMKKVQAMKAAD---KKK------P
RS19_SORC5       -----------MPRSIK-----K----G-PFIDGHLLEKIQAAQATN---AKK------V
RS19_SALRD       -----------MPRSLR-----K----G-PYVYYKLQRKVDALNESD---EKK------V
RS19_PERMH       -----MGYKGKWNERFK-----N------PYVNEKLLKKIRKMNETG---ERK------I
RS19_PELPB       -----------MPRSLK-----K----G-PFIDIKLEKRILDMNSKG---EKK------V
RS19_PETMO       -----------MGRSLK-----K----G-PYVHPSLIKKIREMNEKG---EKK------V
                                                                             

RR19_EUGLO       VFTKSRSSTVFPSMVGHNISVYNGKNYVPFLI-LNQMISSKLGEFSRTRNF-RGHKGINK
RS156_ARATH      VKTHLRNMIIVPEMIGSVVGVHNGKKFNEIVI-KPEMIGHYLAEFSMTCKK-VNHHRPRI
RS15B_SCHPO      VKTHLRNMIILPEMVGSVVGIYNGKLFNQVEI-RPEMIGHYLGEFSITYKP-TKHGRPGI
RS19_CENSY       IKTHLRDLIVLPSMTGVTVNVFSGKEFRPVEI-TTEMIGHYLGEYVITNKR-VSHGAPGV
RS19_NANEQ       IKTHARNTIILPFMVGVTVHVYNGKEYVPVQI-KPEMIGHYLGEFSFTTKR-PKHSAPGI
RS19_META3       IRTHCRDFVITPEMIGLPFGIYNGKEFIEVKL-VEEAIGRFLGEFAPSRKV-VQHGSPGM
RS19_METB6       IRTHLREMIVMPEMIGKSIEIYNGKEFLKVEF-QPESVFHYLGEFALTRKR-VTHGSAGI
RS19_METS5       IKTHVRSLVILPEMVGLKFAVYNGKQFVEFQV-VPEMIGHYLGEFSIPIQK-VEHGEPGL
RS19_METBU       VRTHFRNMIIFPEMIGKNLEVYNGKEFVKIEI-MPEMIGHRFGEYSPTRNR-VSHGSAGV
RS19_CALMQ       VRTHCRDMIILPEMVGLTIFVYNGITYIPVPI-SPWHIGHYLGEFAITTKI-VQHGEPGL
RS19_METKA       IRTHCRDMIILPEMVGLTIAVYNGKEFKEVKI-EPEMIGHYLGEFAKTRKT-VEHG--GI
RS19_HALLT       IRTHLRDMPILPEFVGVTFSVYNGHSFERVQV-EPEMIGHFLGEFHLTRST-VEHGQAGI
RS19_METAR       IKTHLRDMIILPEMVGVTFEIHNGKEWKAVET-TPEMVGHYLGEFALTRHS-VSHGSAGI
RS19_PICTO       IKTHVRDLIVLPQFVGKTIELYNGNSYIKFEI-KPEMIGHYLGEFALTRKE-VKHSGPGV
RS19_ARCFU       ARTHCRDMVVLPEMVGKVVFVHNGKEFVRVEI-KPEMIGHRLGEFALTRRF-EKHSGPGV
RS19_METTP       AKTHLRDAIVLPEMVGKVVEIHNGKTFQRVEI-IPEMIGHYLGEYALTRAR-VIHGAAGV
RT19_ACACA       -----KSSTVINTMLKKKFTLHDGKSYKSILI-DRSMVGLKIGEFVFTRKMGVLHKKKVL
RT19_DICCI       IVTTERSSVIIPYYLSKTIYVYNGRKYVGVKI-TEKSLGRKLGEYVLTKKV-EKYKASKK
RT19_TETSU       -KIYSRRSVVSPKFIGREVEIYNGHKWITIKI-KEDMIGHKFGEFAFTRKA-TIHKKKTK
RT19_PROWI       TKIWSRRSAILPQFVGKTVSIHNGRIFIPCKI-SPEMIGHKFGEFAVTRKK-PIHKKKK-
RT19_MARPO       WRIWSRRSCILPQFVGCYAQIYNGKGFVGLKI-TEEMVGHKFGEFASTRKT-SSLGKRAL
RT19_ARATH       --IWSRRSTILPEYVDSAVRIYNGKTHVRCKI-TEGKVGHKFGEFAFTRKV-KKHAKAK-
RT19_SCHPO       IKTAVRSATILPRMVGAQFMVHNGKSYANVKI-TEDMIGHKLGEFAPTRKA-FHYRQTKN
RT19_YEAST       IRTNARAATILPQFVGLKFQIHNGKEYVPIEI-SEDMVGHKLGEFAPTRKR-FSYTQTKN
RS19_WOLPP       IKIHSRASVILPNCLGLKFAVYNGKDYIPVSVDNQNMIGHKFGEFSPTRKF-TGHGGDKK
RS19_ANAPZ       INIHSRSSVILNKFVGLTFGVYNGKTYVPVKV-TDNIVGRKFGEFSPTRRF-LGHAGDKK
RS19_CARRP       IKTWSRNSTIIPDMIGININIHNGKLFKKVFI-VEDMIGCKLGEFSFTRKF-KSHSKKIK
RR19_HELSJ       IKTWSRSSTIVPLMIGEIIAVHNGREHIPVYI-TEEMVGFKLGEFATTRIW-RGHLKKTT
RR19_EUGGR       ILTWSRSCTIIPIMIGNTIGVYNGKEHIPVLV-SDQMIGHKLGEFVQTRNY-RGHKKHDK
RS19_PSET1       IKTWSRRSMIIPNMIGLTIAVHNGRQHVPVFI-TDEMIGHKLGEFAPTRTY-RGHAADKK
RR19_CRYJA       IVTWSRRSAIVPAMIGHTIAVHNGKSHLPIFI-SNGMINHKLGEFVPTSIF-QGHAKKDK
RR19_AGRST       IVTWSRASSILPTMVGHTIAIHNGKEHIPIYI-TNPMVGRKLGEFVPTRHF-TSYENARK
RR19_JASNU       IKTWSRASTIIPTMIGHTIAVYKGKEHLPIYI-TDYMTGHKLGEFAPTLYFLRGHPTERP
RR19_OENAR       IRTWSRASTIILTMIGHTIAIHNGKEHLPIYI-TDYMVGHKLGEFAPTINF-HEHAKNDN
RR19_CYAM1       IKTWARSSTIVPAMVGHTLAVYNGKTHIPVFI-TDALVGHKLGEFAPTRNF-RSHVKGDR
RS19_ELUMP       IKTWARACTIVPEFIGHTFMVHNGKKFLPVYI-TERMVGHKLGEFSFTRVF-KTHGGMTK
RS19_TREPA       IKSYSRCSTIIPEMVGFTISVHNGKSWIPVYI-TEEFVGHKLGEFSPTRVF-RGHSGSDK
RS19_PELUB       IKTWSRKSTIIPEFIGVSFLIYNGKKFIPVTI-SEDMVGHKLGEFSPTRTF-FGHTPAEK
RS19_ASTYP       IQTWSRSSTITPIFVGHKIAVYNGREHIPVYI-TENMVGHKLGEFSPTRTY-RGHNKKDK
RS19_DEHM1       IKTWARWSTITPLMVGLNVGVHDGRRHVPIYI-TENMVGHRLGEFTTTRNF-RGHAKAEK
RS19_CHLAD       IRTWSRDSTIFPQMIGHTILVHDGRRHVPVYI-TENMVGHKLGEFAPTRFF-RGHGGKKA
RS19_FINM2       IKTWSRRSTIFPNFVGHTIAVHDGRKHVPVYI-TDDMVGHKLGEFVPTRTY-KGHIKNEK
RS19_MYCPE       IKTWSRRSTIFPDFVGLNFEVHNGKSFVNVYV-TEDMIGHKLGEFAQTRTF-KQHTSNRK
RS19_SORC5       IKTWSRRSTILPESVGLTFAVHNGRKFVPVFV-TENMVGHKLGEFAPTRTF-HGHSGDKK
RS19_SALRD       IKTWSRDSIITPDFVGHTFAVHNGHQFIPVYV-TENMVGHKLGEFAPTRTF-TEHSQAKV
RS19_PERMH       IKTWDRACTITEEMVGHTIAVYNGMKFIPVYI-QPEMVGHKLGEFSLTRTF-RGHPDKSA
RS19_PELPB       IKTWSRSSMISPDFVGHTVAVHNGKNHVPVYV-GDNMVGHKLGEFAPTRSF-RGHAGGGK
RS19_PETMO       IKTWSRASMILPEMVGHTIAVHNGMKHIPVYI-TEQMIGHRLGEFSPTRRF-GGHPDKKA
                      .   :          :..*                 :.*:  .            

RR19_EUGLO       KLI----KKSSKKVTKNKKSIKKNIKTTSKKFKK
RS156_ARATH      CGCCCFRRSTRFIPLR------------------
RS15B_SCHPO      GAT----HSSRFIPLK------------------
RS19_CENSY       GAS----RSSLYVPLK------------------
RS19_NANEQ       GAT----RSSAHVSKK------------------
RS19_META3       GAT----RGSMFVPIK------------------
RS19_METB6       GAT----RGSKYVPLK------------------
RS19_METS5       KAT----RSSLFMAMKG-----------------
RS19_METBU       GAT----RSSKFVPLK------------------
RS19_CALMQ       KAT----KSTLHIAAK------------------
RS19_METKA       GAT----RSSLFVPLK------------------
RS19_HALLT       GAT----RSSKFVPLK------------------
RS19_METAR       GAT----RGSKYVPLK------------------
RS19_PICTO       GAT----RSSKFLPLK------------------
RS19_ARCFU       GAT----RSSKYVPLK------------------
RS19_METTP       GAT----RSSKFVPLK------------------
RT19_ACACA       KKK----GKK------------------------
RT19_DICCI       VKK----K--------------------------
RT19_TETSU       ----------------------------------
RT19_PROWI       ----------------------------------
RT19_MARPO       PSK----TKIKPIKKVR-----------------
RT19_ARATH       ----------------------------------
RT19_SCHPO       R---------------------------------
RT19_YEAST       K---------------------------------
RS19_WOLPP       ATR----R--------------------------
RS19_ANAPZ       VSR----KG-------------------------
RS19_CARRP       RKK----K--------------------------
RR19_HELSJ       HKK----NNKTYGLYF------------------
RR19_EUGGR       KTK----TKR------------------------
RS19_PSET1       AKK----R--------------------------
RR19_CRYJA       KSK----NEKKKN---------------------
RR19_AGRST       DTK----SRR------------------------
RR19_JASNU       TKN----DNRSQR---------------------
RR19_OENAR       KSR----RSKMRIDY-------------------
RR19_CYAM1       KIR----KSI------------------------
RS19_ELUMP       EST----ALK------------------------
RS19_TREPA       KVG----R--------------------------
RS19_PELUB       KGK----PAEKKK---------------------
RS19_ASTYP       KIQ----KK-------------------------
RS19_DEHM1       VSQ----VK-------------------------
RS19_CHLAD       DKR----GKVK-----------------------
RS19_FINM2       TSK----VRN------------------------
RS19_MYCPE       DLA----K--------------------------
RS19_SORC5       AKV----AKGGPGGR-------------------
RS19_SALRD       DQR----IRKPGQ---------------------
RS19_PERMH       KAV----KKK------------------------
RS19_PELPB       AEK----GGSAPRKK-------------------
RS19_PETMO       VKG----KIEKQG---------------------