CLUSTAL format seed alignment for MF_00532_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS9_SYNY3       ---------------------------------MQANDSSNKVVYWGTGRRKAAIARVRL
RR9_GUITH       ------------------------------------MIENLKTNYTGTGHRKQAIARVYL
RR9_PORPU       ---------------------------------MSTELIKTRAIYSGTGRRKCSVAQVRL
RR9_MESVI       ---------------------------------MSVQKMMPIINYLGTGRRKSAVARVRL
RR9_CYAPA       ------------------------------------MGQKEQTLAYGTGRRKTSVAKVRL
RR9_NEPOL       ------------------------------------MDHTSSVGLRKTGRRKCAVAQVRI
RR9_TRICV       --------------------------------MNTKIGLSLSEKYYWSWKTKTSNCPCFS
RS9_CHLMU       ------------------------------------MTKNTIQESVATGRRKQAVSSVRL
RS9_CHLTR       ----------------------------------------MIQESVATGRRKQAVSSVRL
RS9_CHLPN       ------------------------------------MAKSTIQESVATGRRKQAVSSVRL
RS9_MYCLE       ----------------MTETSEAVEIAVGTPAAKHSESFVFERSIQTVGRRKEAVVRVRL
RS9_MYCTU       ----------------MTETTPAPQTPAA--PAGPAQSFVLERPIQTVGRRKEAVVRVRL
RS9_STRCO       MAETTPEQPLEEIDIDSYTTESEVPVEGEYTSESMASAFGEPQPAAGLGRRKNAIARVRI
RS9_CAMJE       -----------------------------------------MATTYATGKRKTAIAKVWV
RS9_HELPY       -----------------------------------------MRKIYATGKRKTAIAKVWL
RS9_RHILO       ---------MAELSSLAELGAATGNTNTQAAAPVHVQKLDKSGRAYATGKRKNAIARVWV
RS9_RHIME       ---------MADLSALKEI-A----TTAEPAAPVHVKKVDAQGRSYATGKRKDAVARVWI
RS9_CAUVC       ---------MTDAQGFDALASLS--S-NPEAAAPAEPKIDAQGRAYATGKRKNAIARVWI
RS9_RICCN       --------MPELKIKTEKVEKQLTKEPL--VLKTPKEQIDNLGKFYATGKRKNAIARVWL
RS9_RICPR       --------MTELKIKTEKVVKQLTKESLKSVLKIPKEKIDSVSKFYATGKRKNAIARVWL
RS9_AQUAE       -----------------------------MIQKLKDFKLTPENTYYATGKRKEAVARVWL
RS9_ECOLI       ---------------------------------------MAENQYYGTGRRKSSAARVFI
RS9_VIBCH       ---------------------------------------MAENQYYGTGRRKSSAARVFI
RS9_HAEIN       ---------------------------------------MAENQNYGTGRRKSSSARVFI
RS9_HISS2       ---------------------------------------MAENQNYGTGRRKSSSARVFI
RS9_PASMU       ---------------------------------------MAENQNYGTGRRKSSSARVFI
RS9_BUCAI       ---------------------------------------MIQTQNYGTGRRKSSSARVFL
RS9_PSEAE       ---------------------------------------MSATQNYGTGRRKTATARVFL
RS9_NEIMA       ---------------------------------------MNGKYYYGTGRRKSSVARVFL
RS9_XYLFA       ---------------------------------------MPITQNYGTGRRKSSKARIFL
RS9_MYCGE       ---------------------------------------MDKKSFYGLGRRKSSTAKVYL
RS9_MYCPN       ---------------------------------------MEKQSYYGLGRRKSSSAKVYL
RS9_UREPA       ------------------------------------MQKSNIVEYKGLGRRKSSIARVKL
RS9_MYCPU       ---------------------------------MAISYQLKSPAFRGLGRRKSSVARVIL
RS9_GEOSE       ---------------------------------------MAQVQYYGTGRRKSSVARVRL
RS9_BACSU       ---------------------------------------MAQVQYYGTGRRKSSVARVRL
RS9_LISIN       ---------------------------------------MAQVQYYGTGRRKSSVARVRL
RS9_STAAM       ---------------------------------------MAQVEYRGTGRRKNSVARVRL
RS9_BACHD       ---------------------------------------MAQVQYYGTGRRKHSVARVRL
RS9_CLOAB       ---------------------------------------MAKVQYMGTGRRKEAVARVRL
RS9_STRPN       ---------------------------------------MSQAQYAGTGRRKNAVARVRL
RS9_STRP1       ---------------------------------------MAQAQYAGTGRRKNAVARVRL
RS9_LACLA       ---------------------------------------MAQVQYAGTGRRKNAVARVRL
RS9_BORBU       ---------------------------------MKKSNFSNVNLSMGTGRRKSSVARVYI
RS9_TREPA       ----------------------------------------MKNLGIGTGRRKTAVARVCI
RS9_DEIRA       ------------------------------------MAIQQPEQYYGTGRRKAAVARVFL
RS9_THET8       -----------------------------------------MEQYYGTGRRKEAVARVFL
RS9_THEMA       --------------------------------------MAEVVGYYGTGRRKTAVARVYL
RR9_EUGLO       ---------------------------------------MIFKFFEAIGKRKCSIAKISL
RR9_EUGGR       ---------------------------------------MKLNSIEVIGKRKSSIAKIIL
RR9_CHLVU       ----------------------------------MIKITKTISQSTQSGGRKTAKARVQL
                                                                   * :      

RS9_SYNY3       VP------GQGEVIVNGK---PGEIYFNRIANYIQSLKAPLETLG-LEGEYNILVNAHGG
RR9_GUITH       TP------GSGLIEVNGI---KGELYFQYSPNYIRLSKSPLTTLG-LENKYNIYVNAHGG
RR9_PORPU       VP------GSGNLVINGI---PGESYLQFSPNYLRVSYAPLQVLG-LLNQYDIHVNARGG
RR9_MESVI       VP------GNGEVIINGL---PGTNYLQFNGSYLSAVRSPLETLG-LEDNYDIIVKAVGG
RR9_CYAPA       IP------GKGEILINSK---PANLYLQYNLSYLAAVKSPLESLG-LANEYNVIVNTQGG
RR9_NEPOL       IE------GTGQLTINQR---PGVPYLQYNPAYLLAAQGALDVTE-LTNRYDTIVKTKGG
RR9_TRICV       CS------GEGNIVINKV---SGEKYLQYNLTYLKDIWAPLKELN-LEKQFDIIALVRGG
RS9_CHLMU       RS------GNGKIDVNGK---TLEQYFP-LEVQRATILAPLKMLG-DVNSFDLIIRVSGG
RS9_CHLTR       RS------GNGKIDVNGK---TLEQYFP-LEVQRATILAPLRMLG-DVNSFDLIIRVSGG
RS9_CHLPN       RP------GSGKIDVNGK---SFEDYFP-LEIQRTTILSPLKKITEDQSQYDLIIRVSGG
RS9_MYCLE       VL------GTGKFDLNGR---SLEDYFP-NKVHQQLIKAPLVTVE-RTRNFDIFALLHGG
RS9_MYCTU       VP------GTGKFDLNGR---SLEDYFP-NKVHQQLIKAPLVTVD-RVESFDIFAHLGGG
RS9_STRCO       VP------GTGKWKVNGR---TLEDYFP-NKVHQQEVNEPFKVLE-LDNRYDVIARISGG
RS9_CAMJE       KPGS------GKISVNGV---DLNTWLGGHEAIKLKVVQPLLVTK-QETSMDIKATTLGG
RS9_HELPY       TPGK------GELSINEQ---SLNQWLGGHEAIKMKVMQPLLLTK-QEQSVDIKAVVFGG
RS9_RHILO       KPGS------GKIVVNDK---EFATYFA-RPVLQMILNQPIIASN-RSGQYDIVATVVGG
RS9_RHIME       KAGS------GKITINGK---PFSDYFA-RPVLQMILQQPVVAAA-RDGQFDIDATVAGG
RS9_CAUVC       KPGK------GSITINGR---DQEVYFA-RPVLRMMIAQPLEVTD-RLGQFDVVVTVEGS
RS9_RICCN       KVGK------GKIVVNNK---TIAQYFP-SETYVKTILQPFVLTK-TIDQYDIICTVRGG
RS9_RICPR       KVGK------GKIVVNNK---ILNQYFP-SETYVKTILQPFILTK-TIDQYDVICTVKGG
RS9_AQUAE       LRDRPNTFIVGSDKTNKE---YDLREYVQRETLYNKIMYPFKVTG-HEGKFGIYATVRGG
RS9_ECOLI       KP------GNGKIVINQR---SLEQYFG-RETARMVVRQPLELVD-MVEKLDLYITVKGG
RS9_VIBCH       KP------GSGNIVINKR---SLEEYFG-RPTSCMVVKQPLELVD-MVEKLDLYITVKGG
RS9_HAEIN       KP------GSGKITINQR---ELDVYFG-RETARMVVRQPLELVX-LTDKLDLYITVKGG
RS9_HISS2       KP------GSGKIVINQR---ELDVYFG-RETSRMIVRQPLELVE-LTDKLDLYVTVKGG
RS9_PASMU       KP------GSGKITINQR---DLDVYFG-RETARMIVRQPLELVE-MTEKLDLYVTVKGG
RS9_BUCAI       RS------GNGEIVVNKR---SLNEYFG-RETSCMIVRQPLELVD-MVDKFNIYITVKGG
RS9_PSEAE       RP------GTGKISINNR---GLDQFFG-RETARMVVRQPLELTE-TVEKFDIFVTVVGG
RS9_NEIMA       IK------GTGQIIVNGR---PVDEFFA-RETSRMVVRQPLVLTE-NAESFDIKVNVVGG
RS9_XYLFA       RK------GSGNITVNGR---PLDEFFG-RETARMIVRQPLELTK-NVANFDILITATGG
RS9_MYCGE       YQSK----DKGKITINHR---NPSDYFP-NKLVIQDMEQPLELTK-LKDNFDINVVVKGG
RS9_MYCPN       TPTQ----DKGKITVNRR---DPSEYFP-NKLVIQDMEQPLDLTD-LKKNFDINVVVKGG
RS9_UREPA       VP------GSGKVLVNDR---QPENYFP-NKLVIQDMMQPLVLTK-TAETYDVYVKVIGG
RS9_MYCPU       LK------GSGKFTINKR---EAKEYLK-SDIYIKDALQPFDLTQ-TNNTFDIRVTVRGG
RS9_GEOSE       VP------GDGRIIVNKQ---DIREYIP-TEALIEMVKQPLVLTE-TLGSYDVLVNVHGG
RS9_BACSU       VP------GEGRIVVNNR---EISEHIP-SAALIEDIKQPLTLTE-TAGTYDVLVNVHGG
RS9_LISIN       VP------GDGKIVINNR---DWEDYIP-FAALREVIKQPLVATE-TLGNYDVLVNVHGG
RS9_STAAM       VP------GEGNITVNNR---DVREYLP-FESLILDLNQPFDVTE-TKGNYDVLVNVHGG
RS9_BACHD       VP------GDGNIVINGR---SLDEYFG-LETLKLIVKQPLVETG-TEGQYDVRVNVDGG
RS9_CLOAB       VP------GEGKVVINKR---SAEDYFG-LETLRFIVNQPLNLTG-TKGKFDVLVNVHGG
RS9_STRPN       VP------GTGKITVNKK---DVEEYIP-HADLRLVINQPFAVTS-TVGSYDVFVNVIGG
RS9_STRP1       VP------GTGKITVNKK---DVEEYIP-HADLRLIINQPFAVTS-TEGSYDVFVNVVGG
RS9_LACLA       VP------GTGKITVNGR---EVESYIP-HADMRLVINQPFAATQ-TEGSYDTLVNVNGG
RS9_BORBU       RE------GSGNIKVNNR---DFDSYIQ-LENLRTMALSPLVLTN-TLGKYDLYINVYGG
RS9_TREPA       RM------GNGNVTVNRR---DVGAYFP-TAEQLRRVREPLFATA-NERRYDVIVNVYGG
RS9_DEIRA       RP------GEGKIVVNGK---EFQTYFR-GLLRAVNALQGFRETG-TAGRFDAVITVTGG
RS9_THET8       RP------GNGKVTVNGQ---DFNEYFQ-GLVRAVAALEPLRAVD-ALGHFDAYITVRGG
RS9_THEMA       RP------GEGKVKVNGKEYESLNDYFK-NPAWTKHAIEPLEVTN-TLGKFDLVIRVNGG
RR9_EUGLO       FSTV--KYNCGVININGK---HAYEYLQKN-------CNPFDFLKIK--NYNVCIYVKGG
RR9_EUGGR       FLP---KDGGGEILINGE---KAFNYLQNNLRTLKVVCSPFELLNIN--NYKVHAYVKGG
RR9_CHLVU       LPG-----TGTKVMVNGK---QASDYFQNNAVYLQNMFTPRDLVKTET-KYDVHILVEGG
                               *                                          *.

RS9_SYNY3       GLTGQADAVKLGVARALCQLSPEN-RQPLKAEGYLTRDPRAKERKKYGLHKARKAPQYSK
RR9_GUITH       GLTGQVEAIRLGLARALCKLNPEN-RTALKFEGYLTRDSRITERKKYGLKKARKAPQFSK
RR9_PORPU       GLTGQADAIRLGVARALCSINPEN-RSALKSEGYLTRDPKVKERKKYGLKKARKAPQFSK
RR9_MESVI       GLTGQAEAIRLGVARALCTIDTSN-RHPLKKEGFLTRDSRVKERKKYGLKKARKAPQFSK
RR9_CYAPA       GLTGQSEAIRLGLARALCQISLTH-RPLLKSDHHLTRDARAKERKKYGLHKARKAPQYSK
RR9_NEPOL       GLTGQAEAIKLGLARALCSLHIKH-RKALKPQGYLTRNPLRKERKKYGLKKARKAPQFSK
RR9_TRICV       GLTGQTESIQLGVARLLCQMNPQN-RSVLKPFGFLTRDARIKERKKYGLRKARKAPQYSK
RS9_CHLMU       GVQGQVIATRLGLARAVLQEKEDM-KQELKSQGFLTRDPRKKERKKYGRKKARKSFQFSK
RS9_CHLTR       GVQGQVIATRLGLARAVLQEKEDM-KQELKAQGFLTRDPRKKERKKYGRKKARKSFQFSK
RS9_CHLPN       GIQGQVIATRLGLARALLKENEEN-RQDLKSCGFLTRDPRKKERKKYGHKKARKSFQFSK
RS9_MYCLE       GPSGQAGALRLGIARALILASPED-RPALKKAGFLTRDPRSTERKKYGLKKARKAPQYSK
RS9_MYCTU       GPSGQAGALRLGIARALILVSPED-RPALKKAGFLTRDPRATERKKYGLKKARKAPQYSK
RS9_STRCO       GVSGQAGALRLGVARALNEADVDNNRGALKKAGYLKRDDRAVERKKAGLKKARKAPQYSK
RS9_CAMJE       GYSAQAEALRHGISRALAAMDADF-RALLKPKGLLTRDSRTVERKKYGRRKARRSPQFSK
RS9_HELPY       GYSAQAEALRHGISKALNAYDIAF-RAILKPKGLLTRDSRVVERKKYGKRKARRSPQFSK
RS9_RHILO       GLSGQAGAVRHGISKALTYYEPAL-RAVLKKGGFLTRDSRVVERKKYGKAKARRSFQFSK
RS9_RHIME       GLSGQAGAVRHGISKALTYFEPGL-RPVLKRGGFLTRDSRVVERKKYGRAKARRSFQFSK
RS9_CAUVC       GLSGQAGAIRHGLSKALTYYEPGL-RPVLKPHGFLTRDSRVVERKKYGKAKARRSFQFSK
RS9_RICCN       GISGQKGAILHGISKALDKSAPDF-HAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSK
RS9_RICPR       GISGQKGAILHGISKALDKSAPCF-HAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSK
RS9_AQUAE       GISAQAEAIMYGVAKALLQHNPDL-RPTLKKAGLLTRDAREKERKKYGQMGARAKYRWSK
RS9_ECOLI       GISGQAGAIRHGITRALMEYDESL-RSELRKAGFVTRDARQVERKKVGLRKARRRPQFSK
RS9_VIBCH       GISGQAGAIRHGITRALMEYDESL-RPVLRAAGYVTRDARRVERKKVGLRKARRRPQFSK
RS9_HAEIN       GISGQAGAIRHGITRALMEYDETL-RPALRAAGFVTRDARRVERKKVGLHKARRRPQYSK
RS9_HISS2       GISGQAGAIRHGITRALIEYDETL-RPALRAAGFVTRDARRVERKKIGLHKARRRPQYSK
RS9_PASMU       GISGQAGAIRHGITRALIEYDESL-RSVLRAAGFVTRDARQVERKKVGLRKARRRPQFSK
RS9_BUCAI       GISGQAGAIRQGITRALIKYNQTL-RFELRKAGFVTRDSRQVERKKVGFRKARKRPQFSK
RS9_PSEAE       GVSGQAGAIRHGITRALIEYDETL-RSSLRKAGYVTRDAREVERKKVGLRKARKRPQYSK
RS9_NEIMA       GETGQSGAIRHGITRALIDFDAAL-KPALSQAGFVTRDAREVERKKPGLRKARRAKQFSK
RS9_XYLFA       GTTGQAGAIRLGIARALVEYDASL-KPELRKAGFMTRDAREVERKKVGLHKARRATQFSK
RS9_MYCGE       GFTGQAGAIRLGIVRALIKFNPDL-KKLLKTKKLTTRDKRAKERKKFGLYGARRAPQFTK
RS9_MYCPN       GFTGQAGAIRLGIVRALLQFNPEL-KKILKSKKLTTRDKRVKERKKFGLYGARRAPQFTK
RS9_UREPA       GFNGQAGAIRLGITRALIQTREDL-KTDLRKAGLVTRDSRVKERKKFGLYGARRAPQFTK
RS9_MYCPU       GLAGQAGAIRLGIARALLEISADY-RSVLKEAKMLTRNTKVKERKKPGLRKARKARQFSK
RS9_GEOSE       GFAGQAGAIRHGIARALLQVDPEF-RTVLKRAGLLTRDARVKERKKYGLKGARRAPQFSK
RS9_BACSU       GLSGQAGAIRHGIARALLEADPEY-RTTLKRAGLLTRDARMKERKKYGLKGARRAPQFSK
RS9_LISIN       GYTGQAGAIRHGVARALLQVAPEY-RPALKSAGLLTRDPRMKERKKYGLKGARRAPQFSK
RS9_STAAM       GFTGQAQAIRHGIARALLEADPEY-RGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSK
RS9_BACHD       GFTGQAGAIRHGIARALLQVDPEY-RPSLKSAGFLTRDARMKERKKYGLKAARRAPQFSK
RS9_CLOAB       GFTGQAGAIRHGISRALLKADETL-KGELKKAGFLTRDPRMKERKKYGLKKARRAPQFSK
RS9_STRPN       GYAGQSGAIRHGIARALLQVDPDF-RDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSK
RS9_STRP1       GYGGQSGAIRHGIARALLQVDPDF-RDSLKRAGLLTRDARMVERKKPGLKKARKASQFSK
RS9_LACLA       GVSGQAGAIRHGIARALLQVDPDF-RSALKRAGLLTRDARMVERKKPGLKKARKASQFSK
RS9_BORBU       GISGQSGAIRHGISRALFKLDESN-KMILRSNGFLTRDSRKVERKKFGQKKARKSFQFSK
RS9_TREPA       GLDGQAGACAHGIARALVRADASN-QASLRAGGLLTRDSRMVERKKYGQRGARRRFQFSK
RS9_DEIRA       GPSGQADAIKLGIARALLKVNPDF-RAQMKPKGLLTRDPREVERKKYGLKKARRAPQFSK
RS9_THET8       GKSGQIDAIKLGIARALVQYNPDY-RAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSK
RS9_THEMA       GLSGQSGAVRLGIARALLQYDQNL-RPVLKKYKMLTRDPREVERKKYGLKKARRAPQFSK
RR9_EUGLO       GLIGQAEAIKLAISRALKSFLRKKKIKKLKDFGFLTRNSSCKERRKYGLKKARKAPQYSK
RR9_EUGGR       GLSGQADAIKLAISKSLSVFIEKEDKKKLKVNGFLTRNSLCKERRKYGLKKARKAPQFSK
RR9_CHLVU       GLSAQAQAVKLALSKAFVDFF-PEYRKVFKKPGLLTRDARIKERRKYGLKKARKAPQFSK
                *  .*  :   .: : .           :      .*:    **:* *   **   :::*

RS9_SYNY3       R
RR9_GUITH       R
RR9_PORPU       R
RR9_MESVI       R
RR9_CYAPA       R
RR9_NEPOL       R
RR9_TRICV       R
RS9_CHLMU       R
RS9_CHLTR       R
RS9_CHLPN       R
RS9_MYCLE       R
RS9_MYCTU       R
RS9_STRCO       R
RS9_CAMJE       R
RS9_HELPY       R
RS9_RHILO       R
RS9_RHIME       R
RS9_CAUVC       R
RS9_RICCN       R
RS9_RICPR       R
RS9_AQUAE       R
RS9_ECOLI       R
RS9_VIBCH       R
RS9_HAEIN       R
RS9_HISS2       R
RS9_PASMU       R
RS9_BUCAI       R
RS9_PSEAE       R
RS9_NEIMA       R
RS9_XYLFA       R
RS9_MYCGE       R
RS9_MYCPN       R
RS9_UREPA       R
RS9_MYCPU       R
RS9_GEOSE       R
RS9_BACSU       R
RS9_LISIN       R
RS9_STAAM       R
RS9_BACHD       R
RS9_CLOAB       R
RS9_STRPN       R
RS9_STRP1       R
RS9_LACLA       R
RS9_BORBU       R
RS9_TREPA       R
RS9_DEIRA       R
RS9_THET8       R
RS9_THEMA       R
RR9_EUGLO       R
RR9_EUGGR       R
RR9_CHLVU       R
                *