CLUSTAL format seed alignment for MF_00533

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NIFH3_AZOVI      --------MTRKVAIYGKGGIGKSTTTQNTAAALAYFHDKKVFTHGCDPKADSTRLILGG
NIFH2_RHOCA      --------MTRKIAIYGKGGIGKSTTTQNTAAALAFFHEKNVFIHGCDPKADSTRLILGG
NIFH3_CLOPA      --------MTRKIAIYGKGGIGKSTTQQNTAAAMAHFYDKKVFIHGCDPKADSTRLILGG
NIFH1_METBA      --------MTRKIAFYGKGGIGKSTTQQNTAAAMAYYHGKKIFIHGCDPKADCTRLVLGG
NIFH1_METTH      --------MVRKIAIYGKGGIGKSTTQQNTAAAMSYFHGKNVMIHGCDPKADSTRLILGG
NIFH1_METTM      --------MVRKIAIYGKGGIGKSTTQQNTAAAMSYFHGKNVMIHGCDPKADSTRLILGG
NIFH_METMP       --------MVRKIAIYGKGGIGKSTTTQNTVAAMAHFHDKKVFIHGCDPKADSTRLILHG
NIFH1_METIV      --------MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGG
NIFH1_METTL      MSFDEIAPDAKKVAIYGKGGIGKSTTTQNTAAALAYFFDKKVMIHGCDPKADSTRMILHG
NIFH_RHIME       ------MAALRQIAFYGKGGIGKSTTSQNTLAALV-DLGQKILIVGCDPKADSTRLILNA
NIFH_RHILT       ------MAALRQIAFYGKGGIGKSTTSQNTLAALV-ELGQKILIVGCDPKADSTRLILNS
NIFH_SINFN       ------MAGLRQIAFYGKGGIGKSTTSQNTLAALV-DLGQKILIVGCDPKADSTRLILNA
NIFH_RHIET       ------MSDLRQIAFYGKGGIGKSTTSQNTLAALV-DLGQKILIVGCDPKADSTRLILNA
NIFH_RHILO       ------MSGLRQIAFYGKGGIGKSTTSQNTLAALV-DLGQKILIVGCDPKADSTRLILNA
NIFH_GLUDA       ------MSKLRQIAFYGKGGIGKSTTSQNTLAALV-EMGQKILIVGCDPKADSTRLILNA
NIFH_AZOBR       -------MSLRQIAFYGKGGIGKSTTSQNTLAALV-ELDQKILIVGCDPKADSTRLILHA
NIFH1_RHOCA      ------MGKLRQIAFYGKGGIGKSTTSQNTLAALV-EMGQKILIVGCDPKADSTRLILNT
NIFH_RHOSH       ------MGKLRQIAFYGKGGIGKSTTSQNTLAALV-EMGQKILIVGCDPKADSTRLILNT
NIFH_RHORU       ------MSALRQIAFYGKGGIGKSTTSQNTLAALV-EMGQRILIVGCDPKADSTRLILNT
NIFH1_AZOC5      ------MSSLRQIAFYGKGGIGKSTTSQNTLAALA-EMGHRILIVGCDPKADSTRLILHA
NIFH2_AZOC5      ------MSSLRQIAFYGKGGIGKSTTSQNTLAALA-EMGHRILIVGCDPKADSTRLILHA
NIFH_BRADU       ------MASLRQIAFYGKGGIGKSTTSQNTLAALA-EMGQKILIVGCDPKADSTRLILHA
NIFH_BRASP       ------MSSLRQIAFYGKGGIGKSTTSQNTLAALA-EMGQKILIVGCDPKADSTRLILHA
NIFH_ACIFR       -----MSDKLRQIAFYGKGGIGKSTTSQKHLAALA-EMGQKILIVGCDPKADSTRLILHS
NIFH_HERSE       ------MASLRQIAFYGKGGIGKSTTSQNTLAALA-QMGQRILIVGCDPKADSTRLILHA
NIFH1_TRIV2      ----MTDENIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRIMIVGCDPKADSTRLMLHA
NIFH_NOSS6       ----MTDENIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRIMIVGCDPKADSTRLMLHA
NIFH_ANASL       ----MTDENIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRIMIVGCDPKADSTRLMLHA
NIFH1_NOSS1      ----MTDENIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRIMIVGCDPKADSTRLMLHS
NIFH1_MASLA      -----MTENIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRIMIVGCDPKADSTRLMLHS
NIFH2_NOSS1      ---MSIDKKIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRILIVGCDPKADSTRLMLHS
NIFH_NOSCO       ----MTEENIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGQRILIVGCDPKADSTRLMLHS
NIFH2_MASLA      ----MSDERIRQIAFYGKGGIGKSTTSQNTLAAMA-EMGKRILIVGCDPKADSTRLILHC
NIFH2_TRIV2      ----MID-NIRQIAFYGKGGIGKSTTSQNTIAGLA-EMGERIMIVGCDPKADSTRLMLHS
NIFH_LEPBY       ----MSDENIRQIAFYGKGGIGKSTTSQNTIAALA-EMGERIMIVGCDPKADSTRLMLHS
NIFH_TRIEI       ---------MRQIAFYGKGGIGKSTTSQNTLAAMANRHGQRIMIVGCDPKADSTRLILNA
NIFH_TRITH       ---------MRQIAFYGKGGIGKSTTSQNTLAAMANRHGQRIMIVGCDPKADSTRLILDA
NIFH_RIPO1       ---------MRQIAFYGKGGIGKSTTSQNTLAGMA-QAGNRIMIVGCDPKADSTRLILNC
NIFH_FRAAL       ---------MRQIAFYGKGGIGKSTTQQNTMAAMA-EMGQRVMIVGCDPKADSTRLILHS
NIFH_FRASP       ---------MRQIAFYGKGGIGKSTTQQNTMAAMA-EMGKKVMIVGCDPKADSTRLILHS
NIFH_FRASE       ---------MRQIAFYGKGGIGKSTTQQNTMAAMA-EMGRRVMIVGCDPKADSTRLILHS
NIFH1_PAEDU      -----MSKKPRQIAFYGKGGIGKSTTSQNTLAQLATTFGQKIMIVGCDPKADSTRLILNT
NIFH1_AZOCH      -------MAMRQCAIYGKGGIGKSTTTQNLVAALA-EMGKKVMIVGCDPKADSTRLILHS
NIFH1_AZOVI      -------MAMRQCAIYGKGGIGKSTTTQNLVAALA-EMGKKVMIVGCDPKADSTRLILHS
NIFH_ALCFA       -------MAMRQCAIYGKGGIGKSTTTQNLVAALA-ELGKKVMIVGCDPKADSTRLILHS
NIFH_KLEPN       -------MTMRQCAIYGKGGIGKSTTTQNLVAALA-EMGKKVMIVGCDPKADSTRLILHA
NIFH2_AZOCH      -------MALRQCAIYGKGGIGKSTTTQNLVAALA-EAGKKVMIVGCDPKADSTRLILHS
NIFH2_AZOVI      -------MALRQCAIYGKGGIGKSTTTQNLVAALA-EAGKKVMIVGCDPKADSTRLILHS
NIFH1_CLOPA      ---------MRQVAIYGKGGIGKSTTTQNLTSGLH-AMGKTIMVVGCDPKADSTRLLLGG
NIFH5_CLOPA      ---------MRQVAIYGKGGIGKSTTTQNLTSGLH-AMGKTIMVVGCDPKADSTRLLLGG
NIFH4_CLOPA      ---------MRQVAIYGKGGIGKSTTTQNLTAGLA-ERGNKIMVVGCDPKADSTRLLLGG
NIFH2_CLOPA      ---------MRQLAIYGKGGIAKSTTTQNLTAGLV-ERGNKIMVVGCDPKADSTRLLLGG
NIFH6_CLOPA      ---------MRQLAIYGKGGIGKSTTTQNLTAGLV-ERGNKIMVVGCDPKADSTRLLLGG
NIFH_CLOAB       ---------MRQVAIYGKGGIGKSTTTQNLTSGLA-ELGKKIMVVGCDPKADSTRLLLGG
NIFH_RUMCE       ---------MRQVAIYGKGGIGKSTTTQNLTAGLG-EMGKKIMIVGCDPKADSTRLVLGG
NIFH2_METBA      ---------MRQIAIYGKGGIGKSTTTQNLTASLS-TMGNKIMLVGCDPKADSTRMLLGG
NIFH_DESGI       ---------MRKIAIYGKGGIGKSTTTQNTVAGLA-EMGKRVMVVGCDPKADSTRLLLGG
NIFH_METJA       ---------MRKFCVYGKGGIGKSTTVSNIAAALA-EDGKKVLVVGCDPKADTTRNLVGR
NIFH_METVO       ---------MRKFCIYGKGGIGKSTNVGNMAAALA-EDGKKVLVVGCDPKADSTRTLMHG
NIFH2_METTL      ---------MKQIAFYGKGGIGKSTTVCNIAAALA-DQGKKVMVVGCDPKHDCTSNLRGG
NIFH2_PAEDU      -----MAKKIKQIAIYGKGGIGKSTTTSNISAALS-VAGYKVMQFGCDPKSDSTNTLRGG
NIFH2_METIV      --------MSKRIAIYGKGGIGKSTIVSNIAAAYS-KD-YNVLVIGCDPKADTTRTLIGK
NIFH2_METTH      ---------MKRIAIYGKGGIGKSTIVSNMAAAYS-SE-HRVLVIGCDPKADTTRTLYGE
                           :: ..******.***   :  :         ::  ***** * *  :   

NIFH3_AZOVI      KPEETLMDMVRDKG----------AEKITN-DDVIKKGFLDIQCVESGGPEPGVGCAGRG
NIFH2_RHOCA      LPQQTVMDTLRIEG----------AERVTV-DKVVKTGFKDIRCVESGGPEPGVGCAGRG
NIFH3_CLOPA      MPQKTLMDMLRDEG----------EEKITT-ENIVRVGYEDIRCVESGGPEPGVGCAGRG
NIFH1_METBA      VAQTTIMDTLRELG----------EDAVTA-ENVINTGFDGIKCVESGGPEPGVGCAGRG
NIFH1_METTH      KMQTTMMDTLRELG----------EVACTP-DKVIETGFGGIKCVESGGPEPGVGCAGRG
NIFH1_METTM      KMQTTMMDTLRELG----------EGACTP-DKVIETGFGGIRCVESGGPEPGVGCAGRG
NIFH_METMP       KQQVTMMDTLREKG----------EDECTP-DKVIEVGFGGVKCVESGGPEPGVGCAGRG
NIFH1_METIV      KMQTTMMDTLREEG----------EEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRG
NIFH1_METTL      KPQDTVMDVLREEG----------EEAVTL-EKVRKIGFKDILCVESGGPEPGVGCAGRG
NIFH_RHIME       KAQDTVLHLAATEG----------SVEDLELEDVLKVGYRGIKCVESGGPEPGVGCAGRG
NIFH_RHILT       KAQGTVLDLAATKG----------SVEDLELGDVLKTGYGGIKCVESGGPEPGVGCAGRG
NIFH_SINFN       KAQDTVLHLAAKEG----------SVEDLEVEDVLKVGYKGIKCVESGGPEPGVGCAGRG
NIFH_RHIET       KAQDTVLHLAAQEG----------SVEDLELEDVLKAGYKGIKCVESGGPEPGVGCAGRG
NIFH_RHILO       KAQDTVLHLAAQEG----------SVEDLELQDVLKIGYKDIKCVESGGPEPGVGCAGRG
NIFH_GLUDA       KAQDTVLSLAAEAG----------SVEDLELEDVLKIGYKGIKCVESGGPEPGVGCAGRG
NIFH_AZOBR       KAQDTVLHLAAEAG----------SVEDLELEDVLKIGYKGIKCVESGGPEPGVGCAGRG
NIFH1_RHOCA      KLQDTVLHLAAEAG----------SVEDLEVEDVVKIGYKGIKCTEAGGPEPGVGCAGRG
NIFH_RHOSH       KLQDTVLHLAAEAG----------SVEDLELEDVVKIGYKGIKCTEAGGPEPGVGCAGRG
NIFH_RHORU       KLQDTVLHLAAEAG----------SVEDLDVADVVKIGYKGIKCTESGGPEPGVGCAGRG
NIFH1_AZOC5      KAQDTILSLAAAAG----------SVEDLELEEVMKIGYRDIRCVESGGPEPGVGCAGRG
NIFH2_AZOC5      KAQDTILSLAAAAG----------SVEDLELEEVMKIGYRDIRCVESGGPEPGVGCAGRG
NIFH_BRADU       KAQDTILSLAASAG----------SVEDLELEDVMKVGYQDIRCVESGGPEPGVGCAGRG
NIFH_BRASP       KAQDTILSLAASAG----------SVEDLELEDVMKVGYKDIRCVESGGPEPGVGCAGRG
NIFH_ACIFR       KAQDTVLSLAAEAG----------SVEDLELEDVMKVGYRDIRCVESGGPEPGVGCAGRG
NIFH_HERSE       KAQDTILSLAADAG----------SVEDLELEDVMKIGYQNIRCVESGGPEPGVGCAGRG
NIFH1_TRIV2      KAQTTVLHLAAERG----------AVEDLELHEVMLTGFRGVRCVESGGPEPGVGCAGRG
NIFH_NOSS6       KAKTTVLHLAAERG----------AVEDLELHEVMLTGFRGVRCVESGGPEPGVGCAGRG
NIFH_ANASL       KAQTTVLHLAAERG----------AVEDLELEEVMLTGFRGVKCVESGGPEPGVGCAGRG
NIFH1_NOSS1      KAQTTVLHLAAERG----------AVEDLELHEVMLTGFRGVKCVESGGPEPGVGCAGRG
NIFH1_MASLA      KAQTTVLHLAAERG----------AVEDLELEEVMLTGFRGVKCVESGGPEPGVGCAGRG
NIFH2_NOSS1      KAQTTVLHLAAERG----------AVEDLELEEVMLTGFRGVKCVESGGPEPGVGCAGRG
NIFH_NOSCO       KAQTTVLHLAAERG----------AVEDIEIEEVMLTGFRNVRCVESGGPEPGVGCAGRG
NIFH2_MASLA      KAQTTVLHLAAEKG----------AVEDLELEEVVINGFRNIRCVESGGPEPGVGCAGRG
NIFH2_TRIV2      KAQTTILHLAAERG----------AVEDLELDEVLLTGYQGVKCVESGGPEPGVGCAGRG
NIFH_LEPBY       KAQTTILHLAAERG----------AVEDLELEEVLLTGYRDVKCVESGGPEPGVGCAGRG
NIFH_TRIEI       KAQTTVLHVAAERG----------AVEDVELDEVLKPGFGGIKCVESGGPEPGVGCAGRG
NIFH_TRITH       KAQTTVLHVAAELG----------AVEDVELDQVLKPGFGGIKCVESGGPEPGVGCAGRG
NIFH_RIPO1       KAQVTVLHLAAERG----------AVEDLELSDVLLTGFENIKCVESGGPEPGVGCAGRG
NIFH_FRAAL       KAQTSVIQLAAEKG----------SVEDLELDEVLVEGQWGIKCVESGGPEPGVGCAGRG
NIFH_FRASP       KAQTSVIQLAAEKG----------SVEDLELDEVLVEGQWGIKCVESGGPEPAVGCAGRG
NIFH_FRASE       KAQTSVIKLAAEKG----------SVEDLELNEVLVEGQWGIKCVESGGPEPGVGCAGRG
NIFH1_PAEDU      KAQQTVLHLAAELG----------SVEDLELEDVVATGFGGILCVESGGPEPGVGCAGRG
NIFH1_AZOCH      KAQNTIMEMAAEAG----------TVEDLELEDVLKVGYGGVKCVESGGPEPGVGCAGRG
NIFH1_AZOVI      KAQNTIMEMAAEAG----------TVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRG
NIFH_ALCFA       KAQNTIMEMAAEAG----------TVEDLELEDVLKTGYGDIKCVESGGPEPGVGCAGRG
NIFH_KLEPN       KAQNTIMEMAAEVG----------SVEDLELEDVLQIGYGDVRCAESGGPEPGVGCAGRG
NIFH2_AZOCH      KAQNTVMEMAASAG----------SGEDLELEDVLQIGYGGVKCVESGGPEPGVGCAGRG
NIFH2_AZOVI      KAQGTVMEMAASAG----------WVEDLELEDVLQIGFGGVKCVESGGPEPGVGCAGRG
NIFH1_CLOPA      LAQKSVLDTLREEG----------ED--VELDSILKEGYGGIRCVESGGPEPGVGCAGRG
NIFH5_CLOPA      LAQKSVLDTLREEG----------ED--VELDSILKEGYGGIRCVESGGPEPGVGCAGRG
NIFH4_CLOPA      LAQKSVLDTLREEG----------ED--VELDSILKEGFGGIRCVESGGPEPGVGCAGRG
NIFH2_CLOPA      LAQKTVLDTLREEG----------ED--VELDSILKTGYAGIRCVESGGPEPGVGCAGRG
NIFH6_CLOPA      LAQKTVLDTLREEG----------ED--VELDSILKTGYAGIRCVESGGPEPGVGCAGRG
NIFH_CLOAB       LAQKTVLDTLREEG----------ED--VDLDTIMKTGFGNIKCVESGGPEPGVGCAGRG
NIFH_RUMCE       LAQKTVLDTLREEG----------ED--IELDTVLKVGYAGIKGVESGGPEPGVGCAGRG
NIFH2_METBA      LNQKTVLDTLRSEG----------DEG-VDLDVVMQRGFGDIKCVESGGPEPGVGCAGRG
NIFH_DESGI       LSQRTVLDTLREEG----------ED--VDLDDIVSPGFANTLCTESGGPEPGVGCAGRG
NIFH_METJA       K-IPTVLDVFRKKG-----------AENMKLEDIVFEGFGGVYCVESGGPEPGVGCAGRG
NIFH_METVO       K-INTVLDTFRDKG-----------PEYMKIEDIVYEGFNGVYCVESGGPEPGVGCAGRG
NIFH2_METTL      QEIPTVLDILREKGLDKLGLETIIEKEMIEINDIIYEGYNGIYCVEAGGPKPGYGCAGRG
NIFH2_PAEDU      EYIPTVLDTLRDKQ-------------IVRAHDVIFEGFNGIYCVEAGGPAPGVGCAGRG
NIFH2_METIV      R-LPTILDIVKKKK-------------NASIEEVLFEGYGNVKCVESGGPEPGVGCAGRG
NIFH2_METTH      R-LPTVLDVLKENR-------------EPDVSEVIHTGFGGVRCVESGGPEPGVGCAGRG
                     :::                          :   *  .   .*:*** *. ******

NIFH3_AZOVI      VITAIDLMEENGAYTDDL--DFVFFDDLGDVVCGGFAMPIRDGKAQEVYIVASGEMMAIY
NIFH2_RHOCA      VITAIDLMEENEAYSEDL--DFLFFDVLGDVVCGGFAMPIRDGKAEEVYIVASGEMMAIY
NIFH3_CLOPA      VITAIDLMEKNGAYTEDL--DFVFFDVLGDVVCGGFAMPIRDGKAQEVYIVASGEMMAVY
NIFH1_METBA      VITAINLMEEMGAYSEDL--DFIHFDVLGDVVCGGFAMPIREGKAQEVYIVASGEMMATY
NIFH1_METTH      VITAITLMERHGVYEKDL--DFVFFDVLGDVVCGGFAMPVRDGKAEEIYIVASGEMMALY
NIFH1_METTM      VITAITLMERHGVYENDL--DFVFFDVLGDVVCGGFAMPVRDGKAEEIYIVASGEMMALY
NIFH_METMP       VITAITLMEQHGVYEDDL--DFVFFDVLGDVVCGGFAMPVRDGKADEIYVVASGEMMALY
NIFH1_METIV      VITAITIMEHMKVYDDN---DFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALY
NIFH1_METTL      VITAVDMMRELEGYPDDL--DNLFFDVLGDVVCGGFAMPLRDGLAQEIYIVTSGEMMALY
NIFH_RHIME       VITSINFLEENGAY-ND--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_RHILT       VITSINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_SINFN       VITSINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_RHIET       VITSINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_RHILO       VITSINFLEENGAY-DN--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_GLUDA       VITSINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_AZOBR       VITSINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH1_RHOCA      VITAINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_RHOSH       VITAINFLEENGAY-DD--VDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH_RHORU       VITAINFLEENGAY-DD--LDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
NIFH1_AZOC5      VITSINFLEENGAY-ED--IDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMY
NIFH2_AZOC5      VITSINFLEENGAY-ED--IDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMY
NIFH_BRADU       VITSINFLEENGAY-EN--IDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMY
NIFH_BRASP       VITSINFLEENGAY-EN--IDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMY
NIFH_ACIFR       VITSINFLEENGAY-DG--ANYVSYDVLGDVVCGGFAMPIRK-QAQEIYIVMSGEMMAMY
NIFH_HERSE       VITSINFLEEEGAY-DD--TDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMY
NIFH1_TRIV2      IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH_NOSS6       IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH_ANASL       IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH1_NOSS1      IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH1_MASLA      IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH2_NOSS1      IITAINFLEENGAY-QD--VDFVSYDVLGDVVCGGFAMPIRENKAQEIYIVTSGEMMAMY
NIFH_NOSCO       IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH2_MASLA      IITAINFLEENGAY-QD--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMF
NIFH2_TRIV2      IITAINFLEENGAY-ED--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVCSGEMMAMY
NIFH_LEPBY       IITAINFLEENGAY-ED--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH_TRIEI       IITAINFLEEEGAY-TD--LDFVSYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH_TRITH       IITAINFLEEEGAY-TD--LDFVSYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH_RIPO1       IITSINFLEEEGAY-ED--LDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMY
NIFH_FRAAL       VITSITYLEEAGAY-EN--LDFVTYDVLGDVVCGGFAMPIRQGKAQEIYIVTSGEMMAMY
NIFH_FRASP       VITSINYLEEAGAY-ED--LDFVTYDVLGDVVCGGFAMPIRQGKAQEIYIVTSGEMMAMY
NIFH_FRASE       VITSITYLEEAGAY-EN--LDFVTYDVLGDVVCGGFAMPIRQGKAQEIYIVTSGEMMAMY
NIFH1_PAEDU      IITSINFLEEQGAY-DG--MDFISYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH1_AZOCH      VITAINFLEEEGAYEDD--LDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH1_AZOVI      VITAINFLEEEGAYEDD--LDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH_ALCFA       VITAINFLEEKAAYEDD--LDFVFYDVLGDVVCGGFAMPIRENKAQEIYVVCSGEMMAMY
NIFH_KLEPN       VITAINFLEEEGAYEDD--LDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH2_AZOCH      VITAINFLEEEGAYSDD--LDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH2_AZOVI      VITAINFLEEEGAYSDD--LDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
NIFH1_CLOPA      IITSINMLEQLGAYTDD--LDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALY
NIFH5_CLOPA      IITSINMLEQLGAYTDD--LDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALY
NIFH4_CLOPA      IITSINMLEQLGAYTDD--LDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALY
NIFH2_CLOPA      IITSINMLEQLGAYTDD--LDFVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALY
NIFH6_CLOPA      IITSINMLEQLGAYTDD--LDFVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALY
NIFH_CLOAB       IITSINMLEQLGAYEDE--LDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGEMMAMY
NIFH_RUMCE       IITSIGLLERLGAYEAD--LDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVCSAEMMGLY
NIFH2_METBA      IITSIGLLENLGAYTDD--LDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIY
NIFH_DESGI       IITSINLLEQLGAFKEEKKLDYTFYDVLGDVVCGGFAMPIREGKAQEIYIVVSGEMMAMY
NIFH_METJA       VITAVDMLNRLGAFEEL-KPDVVIYDILGDVVCGGFAMPLQKHLADDVYIVTTCDPMAIY
NIFH_METVO       VITAVDMLDRLGVYDQL-KPDVVIYDILGDVVCGGFAMPLQKKLAEDVYIVTTCDPMAIY
NIFH2_METTL      VIVVIDLLKKMNLYKDL-KLDIVLYDVLGDVVCGGFAMPLRMGLAEQIYVVTSSDYMAIY
NIFH2_PAEDU      IITSVSLLKQQKVFEEL-DLDYVIYDVLGDVVCGGFAVPVREGIAEHVFTVTSADFMALY
NIFH2_METIV      VIVAMGLLDKLGTFSD--DIDIIIYDVLGDVVCGGFAVPLREDFADEVYIVTSGEYMALY
NIFH2_METTH      VIVAMNLLERLGVFRE--DIDVVIYDVLGDVVCGGFAVPLREDFADEVYIVTSGEYMSLY
                 :*. :  : .   :      :   :* **********:*::   *..:: * : : *. :

NIFH3_AZOVI      AANNICKGLVKYAKQSAVGLGGIICNSRKVDGERESVEEFTAAIGTKMIHFVPRDNIVQK
NIFH2_RHOCA      AANNICKGLAKYARQSGVRLGGIICNSRNVDGEKEFLEEFTKAIGTKMIHFVPRDNIVQK
NIFH3_CLOPA      AANNICKGLVKYANQSGVRLGGIICNSRMVDLEREFIEEFAASIGTQMIHFMPRDNIVQK
NIFH1_METBA      AANNICKGLLKYAEQSGVRLGGIICNSRRVDNELEMMEEFASALGTQLLYFVPRDNIVQK
NIFH1_METTH      AANNICKGMVKYARQSGVRLGGIICNSRNVDGEKELLEEFCERIGTQMIHFVPRDNIVQK
NIFH1_METTM      AANNICRGMVKYARQSGVRLGGIICNSRNVDGERELLEEFCERIGTQMIHFVPRDNIVQK
NIFH_METMP       AANNICKGMVKYAEQSGVRLGGIICNSRNVDGELDLLQEFCDKIGTQLIHFVPRDNIVQK
NIFH1_METIV      AANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQK
NIFH1_METTL      AANNIAKGILKYAEQSGVRLGGIICNARNVDGEKELMDEFCDKLGTKLIHYVPRDNIVQK
NIFH_RHIME       AANNIAKGILKYAHAGGVRLGGLICNERQTDRELDLAEALAARLNSKLIHFVPRDNIVQH
NIFH_RHILT       AANNIARGILKYASAGSVRLGGLICNERQTDRELDLAEALAAKLNSKLIHFVPRDNIVQH
NIFH_SINFN       AANNIAKGILKYAHSGGVRLGGLICNERQTDRELDLAEALAAKLNSRLIHFVPRDNIVQH
NIFH_RHIET       AANNIAKGILKYAHSGGVRLGGLICNERQTDRELDLSEALAARLNSKLIHFVPRDNIVQH
NIFH_RHILO       AANNIAKGILKYAHSGGVRLGGLICNERQTDRELDLSEALAARLNSKLIHFVPRDNIVQH
NIFH_GLUDA       AANNIAKGILKYAHSGGVRLGGLICNERQTDREYDLADALAKRLNSKLVHFVPRANIVQH
NIFH_AZOBR       AANNIAKGILKYAHSGGVRLGGLICNERQTDKEIDLASALAARLGTQLIHFVPRDNIVQH
NIFH1_RHOCA      AANNIAKGILKYANSGGVRLGGLICNERKTDRELELAEALAAKLGCKMIHFVPRNNVVQH
NIFH_RHOSH       AANNIAKGILKYANSGGVRLGGLICNERKTDRELELAEALAARLGCKMIHFVPRDNIVQH
NIFH_RHORU       AANNIAKGILKYAHTGGVRLGGLICNERQTDKEVELAEALAGRLGCRLIHFVPRDNGVQH
NIFH1_AZOC5      AANNISKGILKYANSGGVRLGGLVCNERQTDKELELAENLAKKLGTQLIYFVPRDNIVQH
NIFH2_AZOC5      AANNISKGILKYANSGGVRLGGLVCNERQTDKELELAENLAKKLGTQLIYFVPRDNIVQH
NIFH_BRADU       AANNISKGILKYANSGGVRLGGLICNERQTDKELELAEALAKKLGTQLIYFVPRDNVVQH
NIFH_BRASP       AANNISKGILKYANSGGVRLGGLICNERQTDKELELAEALAKKLGTQLIYFVPRDNVVQH
NIFH_ACIFR       AANNISKGVLKYANSGGVRLGGLICNERQTDKELELAEALAGKLGTKLIHFVPRDFIVQH
NIFH_HERSE       AANNISKGILKYANSGGVRLGGLICNERKTDKELELATALAAKLNSKLIHFVPRDNIVQH
NIFH1_TRIV2      AANNIARGILKYAHSGGVRLGGLICNSRKTDREAELIENLAERLNTQMIHFVPRDNIVQH
NIFH_NOSS6       AANNIARGILKYAHSGGVRLGGLICNSRKTDREAELIENLAERLNTQMIHFVPRDNIVQH
NIFH_ANASL       AANNIARGILKYAHSGGVRLGGLICNSRKTDREAELIENLAERLNTQMIHFVPRDNIVQH
NIFH1_NOSS1      AANNIARGILKYAHSGGVRLGGLICNSRKVDREDELIMNLAERLNTQMIHFVPRDNIVQH
NIFH1_MASLA      AANNIARGILKYAHSGGVRLGGLICNSRKVDREAELIENLAERLNTQMIHFVPRDNIVQH
NIFH2_NOSS1      AANNIARGILKYAHTGGVRLGGLICNSRNVDREIELIETLAKRLNTQMIHYVPRDNIVQH
NIFH_NOSCO       AANNIARGVLKYAHTGGVRLGGLICNSRNTDREIELIETLAKRLNTQMIHYVPRDNIVQH
NIFH2_MASLA      AANNISRGILKYAHSGGVRLGGLICNSRKTDREWDLISELARRISTQMIHFVPRDNIVQH
NIFH2_TRIV2      AANNIARGILKYAHSGGVRLGGLICNSRNVDREVELIEALAERLNTQMIHFVPRNNVVQH
NIFH_LEPBY       AANNIARGILKYAHSGGVRLGGLICNSRKVDREIELIETLAQRLNTQMIHFVPRDNIVQH
NIFH_TRIEI       AANNIARGVLKYAHAGGVRLGGLICNSRKVDRETELIENLAARLNTQMIHFVPRDNVVQR
NIFH_TRITH       AANNIARGVLKYAHAGGVRLGGLICNSRKVDRETELIENLAARLNTQMIHFVPRDNVVQR
NIFH_RIPO1       AANNIARGILKYAHTGGVRLGGLICNSRNVNKEIELIEELAERLNTQMIHFVPRSKQVQE
NIFH_FRAAL       AANNIARGILKYAHSGGVRLGGLICNSRKTDREDELIMELARRLNTQMIHFIPRNNVVQH
NIFH_FRASP       AANNIARGVLKYAHSGGVRLGGLICNSRNTDREDELIMELARRLNTQMIHFIPRNNVVQH
NIFH_FRASE       AANNIARGVLKYGHSGGVRLGGLICNSRNTDREDELIIELARRLNTQMIHFIPRNNVVQH
NIFH1_PAEDU      AANNIARGILKYAQSGSVRLGGLICNSRKTDREDELITELARRLNTQMIHFVPRDNVVQH
NIFH1_AZOCH      AANNISKGIVKYANSGSVRLGGLICNSRNTDREDELIIALAAKLGTQMIHFVPRDNVVQR
NIFH1_AZOVI      AANNISKGIVKYANSGSVRLGGLICNSRNTDREDELIIALANKLGTQMIHFVPRDNVVQR
NIFH_ALCFA       AANNISKGIVKYANSGSVRLGGLICNSRNTDREDELIMALADKLGSQMIHFVPRDNVVQR
NIFH_KLEPN       AANNISKGIVKYAKSGKVRLGGLICNSRQTDREDELIIALAEKLGTQMIHFVPRDNIVQR
NIFH2_AZOCH      AANNIAKGIVKYAHSGSVRLGGLICNSRKTDREDELIMALAAKIGTQMIHFVPRDNVVQH
NIFH2_AZOVI      AANNIAKGSVKYAHSGSVRLGGLICNSRKTDREDELIMALAAKIGTQMIHFVPRDNVVQH
NIFH1_CLOPA      AANNISKGIQKYAKSGGVRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPMVTK
NIFH5_CLOPA      AANNISKGIQKYAKSGGVRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPMVTK
NIFH4_CLOPA      AANNISKGIQKYAKSGGVRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPMVTK
NIFH2_CLOPA      AANNISKGIQKYAKSGGVRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPSVTK
NIFH6_CLOPA      AANNISKGIQKYAKSGGVRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPSVTK
NIFH_CLOAB       AANNISKGISKFANTGGVRLGGIICNSRKVKNEKELLEAFAKELGTQLIYFVPRSHEVQK
NIFH_RUMCE       AANNIAKGISKYANTGGVRLGGLICNSRKVDGEADLVSRVAKEIGTQMIHFVPATMRCRR
NIFH2_METBA      AANNICKGLAKFAK-GGARLGGIICNSRNVDGERELLDAFAKKLGSHLIHFIPRDNIVQR
NIFH_DESGI       AANNICKGIVKYADAGGVRLGGLICNSRKVDNEDKLILALAERLGTQMIHFVPRDNQVQR
NIFH_METJA       AANNICKGIKRYASRGKIALGGIIYNGRSVIDAPEIVKDFAKKIGTQVIGKIPMSNIITR
NIFH_METVO       AANNICKGIKRYGNRGKIALGGIIYNGRSVVDEPEIIDKFVEGINSQVMGKVPMSNIITK
NIFH2_METTL      AANNICRGISEFVKRGGSKLGGLIYNVRGSMDAYDIINEFADKLGANIVGKVPNSHLIPE
NIFH2_PAEDU      AANNLFKGIHKYSTEGGALLGGVIANSINAPYAKEIVDDFVARTHTQVMEYVPRSVSVTQ
NIFH2_METIV      AANNICRGIKKL----KSNLGGIICNCRGIENEVQIVSEFAGKVGSKVIGIIPGSEMVQK
NIFH2_METTH      AANNIARGIRKL----KGKLGGVICNCRGIRDEVEIVSEFASRIGSRLIGAVPRSNLVQE
                 ****: :*  .        ***:: *        .    .      .::  :*      .

NIFH3_AZOVI      AEFNKKTVTEFAPEENQAKEYGELARKIIEN-DEFVIPKPLTMDQLEDMVVKYGIAD---
NIFH2_RHOCA      AEFNKQTVTEFQPEANQAQEYRELGRKIIEN-EDFVIPKPLAMDELEAMVVKYGLMD---
NIFH3_CLOPA      AEFNKQTVIEFDDTCNQAKEYGELARKIIEN-EMFVIPTPLKMDDLEAMVVKYGMTD---
NIFH1_METBA      AEFNKKTVVEYDPTCNQALEYKELAKKILEN-DMFVIPKPLSMDQLEKMVERYGLMD---
NIFH1_METTH      AEFNKKSVIEFDPECNQSQEYRELARKIIEN-KDFVIPEPMTMDEMEELVVKYGVMD---
NIFH1_METTM      AEFNKKSVIEFDPECNQSQEYRELARKIIEN-TDFVIPEPMTMDEMEDLVVKYGVLD---
NIFH_METMP       AEFQKKAVVDYDDTCNQALEYKELARKIIEN-ENLVIPTPMTMDELEELTSKYGFLD---
NIFH1_METIV      AEFNKRTVVDFDAECSQAHEYSELARKIIEN-DNFVIPDPMTMDELEEMVVSYGLMD---
NIFH1_METTL      AEFNKMTVIEFDPECNQAKEYRTLAKNIDEN-DELVKPTPMTMDELEELVVKYGLIDL--
NIFH_RHIME       AELRKMTVIQYAPNSKQAGEYRALAEKIHANSGRGTVPTPITMEELEDMLLDFGIMKSDE
NIFH_RHILT       AELRKMTVIQYAPRSKQAAEYRWLAEKIHSNSGKGTIPTPITMEELEDMLLDFGIMKSDE
NIFH_SINFN       AELRKMTVIQYAPESQQAAEYRALADKIHANSGQGTVPTPITMEELEDMLLDFGVMKTDE
NIFH_RHIET       AELRKMTVIQYAPDSKQAGEYRALAEKIHANSGQGTIPTPITMEELEDMLLDFGIMKSDE
NIFH_RHILO       AELRKMTVIQYAPDSKQAGEYRALAEKIHGNSGQGTIPTPITMEELEDMLLDFGIMKTDE
NIFH_GLUDA       AELRKQTVIEYAPDSAQAGEYRTLAQKIHANSGQGTVPTPITMEELEDMLLEFGIMKTDE
NIFH_AZOBR       AELRRMTVIEYAPDSQQAQEYRQLANKVHANKGKGTIPTPITMEELEEMLMDFGIMKSEE
NIFH1_RHOCA      AELRRETVIQYDPTCSQAQEYRELARKIHENSGKGVIPTPITMEELEEMLMDFGIMQSEE
NIFH_RHOSH       AELRRETVIQYAPESKQAQEYRELARKIHENSGKGVIPTPITMEELEEMLMDFGIMQSEE
NIFH_RHORU       AELRRQTVIQYAPDSKQAGEYRTLATKIHNNSGQGVVPTPITMEDLEEMLMEFGIMKSDE
NIFH1_AZOC5      AELRRMTVIEYAPDSVQANHYRNLAERVHNNGGKGIIPTPITMDELEDMLMEHGIMKTVD
NIFH2_AZOC5      AELRRMTVIEYAPDSVQANHYRNLAERVHNNGGKGIIPTPITMDELEDMLMEHGIMKTVD
NIFH_BRADU       AELRRMTVLEYAPDSKQADHYRKLAAKVHNNGGKGIIPTPISMDELEDMLMEHGIIKAVD
NIFH_BRASP       AELRRMTVLEYAPESQQADHYRNLATKVHNNGGKGIIPTPISMDELEDMLMEHGIMKPVD
NIFH_ACIFR       AELRRMTVLEYAPESKQAQEYRTLAEKIHANAGNPAIPTPITMDELEDLLMDFGIMQKED
NIFH_HERSE       AELRRMTVLEYAPDSKQAGEYRTLANKIHENAGNGTIPTPITMDELEDLLMQHGLMPVVD
NIFH1_TRIV2      AELRRMTVNEYAPDSNQGQEYRALAKKIINN-DKLTIPTPIEMDELEALLIEYGILDDDS
NIFH_NOSS6       AELRRMTVNEYAPDSNQGQEYRALAKKIINN-DKLTIPTPIEMDELEALLIEYGILDDDS
NIFH_ANASL       AELRRMTVNEYAPDSNQGQEYRALAKKIINN-DKLTIPTPIEMDELEALLIEYGILDDDT
NIFH1_NOSS1      AELRRMTVNEYAPDSNQGQEYRALAKKIINN-DKLTIPTPMEMDELEALLIEYGLLDDDT
NIFH1_MASLA      AELRRMTVNEYAPDSNQSQEYRALAKKIINN-TKLTIPTPMEMDELEALLIEYGILDDDT
NIFH2_NOSS1      AELRRMTVNEYAPDSNQGNEYRILANKIINN-ENLKIPTPIEMEELEELLIEFGILESEE
NIFH_NOSCO       AELRRMTVNEYAPESNQANEYRILAQKIIDN-KNLAIPTPIEMEELEELLIEFGILESDE
NIFH2_MASLA      AELRRMTVNEYAPDSNQANEYRTLATKIIDN-EFMAVPTPLEMDELEELLIEFGILESDE
NIFH2_TRIV2      AELRRMTVIEYATEHPQANEYRTLAKKIKEN-TKLTIPTPISMDELEELLVEFGILGGEE
NIFH_LEPBY       AELRRMTVNEYAPDSAQAQEYATLARKIKDN-TNLTIPTPISMDELEDLLVEFGLLGGDE
NIFH_TRIEI       AEIRRMTVEQYAPEDNQAQEYDQLAQKIINN-EKLTIPTPLEMDELEELLIEFGLLGDEE
NIFH_TRITH       AEIRRLTVEQYAPEDNQAQEYNKLAEKIINN-EKLTIPTPLEMDELEELLIEFGLLAATK
NIFH_RIPO1       AELRRQTVIQYSPEHPQAQEYRDLGDKIVNN-TKLTIPTPIDNDELEELLINYGLLGSEE
NIFH_FRAAL       AELRRMTVIEYDPKNSQADEYRQLANKIVNN-DMKTIPTPITMDELEELLIDFGIMAQED
NIFH_FRASP       AELRRMTVIEYDPKNSQADQYRELARKIVDN-DMKTIPTPITMDELEELLIEFGIMQQED
NIFH_FRASE       AEVRRMTVIEYDPQNSQANEYRQLAKKIDNN-EMKTIPTPIRMDELEELLIEFGIMEQED
NIFH1_PAEDU      AELRRMTVTQYNPEHPQANEYKQLADKILHN-EKLTIPTPIEMDELEQLLIDFGVVEDEE
NIFH1_AZOCH      AEIRRMTVIEYDPTAKQADEYRTLARKVVEN-KMLIIPNPITMDELEALLMEFGVMEEED
NIFH1_AZOVI      AEIRRMTVIEYDPKAKQADEYRALARKVVDN-KLLVIPNPITMDELEELLMEFGIMEVED
NIFH_ALCFA       AEIRRMTVIEYDPAAKQADEYRTLAKKIVEN-KKLVIPTPISMDELEALLMEFGIMDEED
NIFH_KLEPN       AEIRRMTVIEYDPACKQANEYRTLAQKIVNN-TMKVVPTPCTMDELESLLMEFGIMEEED
NIFH2_AZOCH      AEIRRMTVIEYDPKAKQADEYRALAQKILNN-KLLVIPNPASMEDLEELLMEFGIMEAED
NIFH2_AZOVI      AEIRRMTVIEYDPKAGQADEYRALARKIVDN-KLLVIPNPASMEELEELLMEFGIMEVED
NIFH1_CLOPA      AEINKQTVIEYDPTCEQAEEYRELARKVDAN-ELFVIPKPMTQERLEEILMQYGLMDL--
NIFH5_CLOPA      AEINKQTVIEFDPTCEQAEEYRELARKVDAN-ELFVIPKPMTQERLEEILMEYGLMDL--
NIFH4_CLOPA      AEINKKTVIDFDPKSEQADEYRELARKIDEN-ELFVIPKPMTQERLEEILVQYGLNDL--
NIFH2_CLOPA      AEINKKTVIEYDPTCEQANEYRELARKVEEN-DMFVIPKPMTQERLEQILMEHGLID---
NIFH6_CLOPA      AEINKKTVIEYDPTCEQANEYRELARKVEEN-DMFVIPKPMTQERLEQILMEHGLID---
NIFH_CLOAB       AEINKQTVIQFNPKDEQADEYRALAKAIDGN-DMYVVPKPMAQDKLEAILMEYGLLE---
NIFH_RUMCE       RKSIKRQLSTFRPMT-QADEYRTLARKIDGN-DMFVVPRPMSIDRLEAILMEHGILD---
NIFH2_METBA      AEINRKTVIDFDPESNQAKEYLTLAHNVQNN-DKLVVPTPLPMEELEAMMVEFGIVDL--
NIFH_DESGI       AELMRKTVIEFSPEHPQADEYRALANKIDQN-QMFVVPKPLSIEELEKLLVDHGIMN---
NIFH_METJA       AEIYKKTVIEYAPDSEIANTFREIAKAIYEN-ENRVIPNPLSEEELDEITEKIDVLLKES
NIFH_METVO       AELRKQTTIEYAPDSEIANKFRELANSIYEN-KKTTIPTPLSEQGLDELTESIEELVRRK
NIFH2_METTL      AEIEGKTVIEYDPNDEISQVYRELAKKIYEN-NEGTIPKPLENIEIMTIGKKIKERLKKE
NIFH2_PAEDU      AELQGKTTIEADPNSKQAQIYKSLAQKIVDH-TESKVPVPLETSELREWASNWGKQLVEL
NIFH2_METIV      SEIDAKTVIEKFGESEQADLYRELAKSIYSN-EDFVIPEPMGVDEFDEFFRGFQ------
NIFH2_METTH      SELEARTVIERFPESEQASVYRKLAEDIYRN-TEFTVPEPMDQEEFEEFFRKFRVEG---
                  :               .  :  :.  :  :      * *     :              

NIFH3_AZOVI      --------------------------
NIFH2_RHOCA      --------------------------
NIFH3_CLOPA      --------------------------
NIFH1_METBA      --------------------------
NIFH1_METTH      --------------------------
NIFH1_METTM      --------------------------
NIFH_METMP       --------------------------
NIFH1_METIV      --------------------------
NIFH1_METTL      --------------------------
NIFH_RHIME       QMLAELHAKEAKVIAPH---------
NIFH_RHILT       QMLEELLAKEVQAAVAP---------
NIFH_SINFN       QMLAELQAKEAAAAAQ----------
NIFH_RHIET       QMLAELQAKESAVVAAQ---------
NIFH_RHILO       QMLAELQAKEAKLAVAQ---------
NIFH_GLUDA       QALAELAAKEAKAAAALA--------
NIFH_AZOBR       QQLAELQAKEAAKA------------
NIFH1_RHOCA      DREKQIAEMEAAMKA-----------
NIFH_RHOSH       DRLAAIAAAEA---------------
NIFH_RHORU       EALAELEAKESAAAN-----------
NIFH1_AZOC5      ETQVGKTAAELAALSA----------
NIFH2_AZOC5      ESQVGKTAAELAALSA----------
NIFH_BRADU       ESIIGKTAAELAAS------------
NIFH_BRASP       ESIVGKTAAELAAS------------
NIFH_ACIFR       TSIIGKTAAELAAAGM----------
NIFH_HERSE       ESMVGKSAEVAA--------------
NIFH1_TRIV2      KHAEIIGKPAEATK------------
NIFH_NOSS6       KHAEIIGKPAEATK------------
NIFH_ANASL       KHAEIIGKPANAK-------------
NIFH1_NOSS1      KHSEIIGKPAEATK------------
NIFH1_MASLA      KHADIIGKPAEASAK-----------
NIFH2_NOSS1      NAAKMIATTSESKSK-----------
NIFH_NOSCO       NTAMLVGKTATEAPVV----------
NIFH2_MASLA      QVKQLTETDKAAKESEKKQEDAEGEA
NIFH2_TRIV2      EYQKAIAQDAGKAVVV----------
NIFH_LEPBY       EYEKAIKQDLAKRGA-----------
NIFH_TRIEI       DRQKQIAAQDAAIKATAAK-------
NIFH_TRITH       KIVRNKLQHKMQQQQKK---------
NIFH_RIPO1       EYKKVMEADMAAQALTRGAK------
NIFH_FRAAL       E--SVIGKAAAVA-------------
NIFH_FRASP       E--SIIAKAAAVA-------------
NIFH_FRASE       E--SIIAKANATS-------------
NIFH1_PAEDU      TAIKKLEAAGH---------------
NIFH1_AZOCH      ESIVGKAAAAEE--------------
NIFH1_AZOVI      ESIVGKTAEEV---------------
NIFH_ALCFA       MTIVGKTAAEEPAFCSL---------
NIFH_KLEPN       TSIIGKTAAEENAA------------
NIFH2_AZOCH      ESIVGKAGAEG---------------
NIFH2_AZOVI      ESVVGKAAAEG---------------
NIFH1_CLOPA      --------------------------
NIFH5_CLOPA      --------------------------
NIFH4_CLOPA      --------------------------
NIFH2_CLOPA      --------------------------
NIFH6_CLOPA      --------------------------
NIFH_CLOAB       --------------------------
NIFH_RUMCE       --------------------------
NIFH2_METBA      --------------------------
NIFH_DESGI       --------------------------
NIFH_METJA       VKG-----------------------
NIFH_METVO       YE------------------------
NIFH2_METTL      RMKN----------------------
NIFH2_PAEDU      EAGVLSPAAAGNL-------------
NIFH2_METIV      --------------------------
NIFH2_METTH      --------------------------