CLUSTAL format seed alignment for MF_00534

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYN_CLOB1       ----------------------------MDITLVKSLYRETEKHMDKEVKINGWVRTVRD
SYN_CLOBH       ----------------------------MDITLVKSLYRETEKHMDKEVKINGWVRTVRD
SYN_CLOBL       ----------------------------MDITLVKSLYREAEKYMDKEVKINGWVRTVRD
SYN_CLOK5       ----------------------------MKKTLVKSLYRETEKFIDKDIEISGWIRTIRD
SYN_CLOAB       ----------------------------MENVLVKQLYRLSSEFGGKKVRLSGWVRTIRA
SYN_CLONN       ----------------------------METVLVKQLYRETEKFAGKEVKISGWIRTLRA
SYN_CLOTE       ----------------------------MKKISIKQLYREPEKFINKDIVVAGWIRTERT
SYN_CLOPE       ---------------------------MKDVVLVKSLYRNTSEYSDKKVKISGWIRTLRA
SYN_BACAN       ----------------------------MENTLVKSLYRDTDKYAGQTVQVSGWIRNLRD
SYN_BACCZ       ----------------------------MENTLVKSLYRDTDKYAGQTVQVSGWIRNLRD
SYN_BACC1       ----------------------------MENTLVKSLYRDTDKYAGQTVQVSGWIRNLRD
SYN_BACHK       ----------------------------MENTLVKSLYRDTDKYAGQTVQVSGWIRNLRD
SYN_BACCR       ----------------------------MENTLVKSLYRDTEKYADQTVQVSGWIRNLRD
SYN_BACCN       ----------------------------MENTLVKSLYRETDKYVDQKVQVSGWIRNLRD
SYN_ALKOO       ----------------------------MKSILVKDIYRNTEKYAGQEIVIEGWIRTLRA
SYN_ALKMQ       ----------------------------MKTVSVKEIYRQTEQYAGQSIRVEGWIRTLRA
SYN_ACET2       ----------------------------MKTTLVKSLYRNTKDYVGKEIVVAGWVRTVRD
SYN_DESHY       ----------------------------MENTLIKSIYRDTPAYLNQELQISGWVRTLRV
SYN_FUSNN       ------------------------------MITVKDIFRHGEDYLDKEIELFGWVRKIRD
SYN_UREP2       ----------------------------MQLKIKEIFNQDYVKLEGQKIQIKAWVRSNRD
SYN_UREPA       ----------------------------MQLKIKEIFNQDYVKLEGQKIQIKAWVRSNRD
SYN_MYCGE       ----------------------------MKSVTVKQLLQTPRKFNNKQIKLSGWVKNKRA
SYN_MYCPN       ----------------------------MSATAISDLFEKPAQFKNKKIKLTGWLKNKRT
SYN_MYCPE       ----------------------------METVAVRDIFKNY--KEFSNVKLVGWVRSNRD
SYN_MYCGA       ----------------------------MQLIEIKELLLSHSKREGEQVVLVGSFKSIRS
SYN_MYCCT       -------------------------------MEIKQVFEQNSELIDQEIELIARVRSNRQ
SYN_MYCMS       -------------------------------MEIRQIFEQHSGLLDKEVEILGRVRSNRQ
SYN_MESFL       -------------------------------MDIKFLYDNHETLKEQKVTIIGRVRSNRQ
SYN_MYCPU       -----------------------------MKMLVKQIYENAKELDKSKIKIKGWVVTSRG
SYN_MYCMO       ------------------------------MTSIKHLLINAKKYDQKEFEIKAWVASNRG
SYN_MYCH7       -----------------------------MFQTINEISIHPELYNQKKVLIQGWITNIRG
SYN_MYCH2       -----------------------------MFQTINEISIHPELYNQKKVLIQGWITNIRG
SYN_MYCHJ       -----------------------------MFQTINEISIHPELYNQKKVLIQGWITNIRG
SYN_AYWBP       -----------------------------MKISIKDIFQKPELFYQKKILLNGWVRNCRY
SYN_ONYPE       -----------------------------MKISIKDIFQKPELFYQKKIVLNGWVRNCRY
SYN_ACHLI       -----------------------------MDLTIRTIYKDPARYAGQEVILKGWIRNHRD
SYN_GEOSL       -----------------------------MNERIRIREILAGTPAGTEVIVKGWVRTSRV
SYN_GEOMG       -----------------------------MSARIRIRNALAGEGLGNEIMVKGWVRTIRT
SYN_GEOUR       -----------------------------MYGRTRVSAALAASRPGEELVLKGWVRTVRV
SYN_PELPD       -------------------------------MRTIIRQLLSQGVSGQTYAIAGWVRSLRI
SYN_BORBU       -------------------------------MFASIKDILKNPILNSNVTINGWIRTKRS
SYN_BORBP       -------------------------------MFSSIKDILENPILNSNVTINGWIRTKRS
SYN_BORAP       -------------------------------MFASIKDILENPILNSNVTINGWIRTKRS
SYN_NOSS1       ------------------------------MVNRRIAEILRSGQPDESLVVQGWVRTKRE
SYN_SYNY3       ------------------------------MNKRRIIEVLRHGQADDQVMVQGWLRTKRT
SYN_MICAN       -------------------------------MTTRIKEIFQTGQPDQSVTVQGWVRTKRE
SYN_THEEB       -------------------------------MQQRIKDILHQGQVGDRITVKGWVRTKRE
SYN_SOLUE       -----------------------------MIQPDSYVRSLLKRSPGESVTARGWVKTRRD
SYN_TREDE       -------------------------------MIHLIKDILTSEPKGQAIDVYGWVRTKRE
SYN_TREPA       ----------------------------MRAMHPLLKEILTHPPSGQHECVHGWVRSKRE
SYN_BACFN       ---------------------------MEKISRTKIVDLMKREDFGAMVNVKGWVRTRRG
SYN_BACFR       ---------------------------MEKISRTKIVDLMKREDFGAMVNVKGWVRTRRG
SYN_BACTN       ---------------------------MEKIGRTKIVDLLKREDIGAMVNVKGWVRTRRG
SYN_PHOV8       ---------------------------MEKISRTKIVDLLKRRDFGAMVNVKGWVRTRRG
SYN_PARD8       ---------------------------METIKRTKIVDVLKSDAFGTTVNVKGWVRTRRG
SYN_PORGI       --------------------------MDKKMKRTRIADALHGGLVGQEINIKGWVRTKRG
SYN_DESVV       ------------------------------MQRTQIVDALAATAPQPVIRLCGWVRTRRD
SYN_DESVH       ------------------------------MQRTQIVDALAATAPQPVIRLCGWVRTRRD
SYN_DESAG       ------------------------------MKRTQILDALNASAPCDDIRICGWVRTRRD
SYN_LAWIP       ------------------------------MLPSTIVEILCSKTAQADVHVGGWIRTRRN
SYN_PARUW       --------------------------MRTKIKSLRGTTPEVRALIGHDITLKGWVRTVRN
SYN_ACTP2       ---------------------------MSKFPTVSEILSGK-VAVGEEVAVRGWVRTRRD
SYN_HAEDU       ---------------------------MSKFPTVSEILSGK-IVVGEKVTVRGWVRTRRD
SYN_HISS2       ---------------------------MTKIASVANILKGK-ITVGETVTVRGWIRTRRD
SYN_HAES1       ---------------------------MTKIASVANILKGK-ITVGETVTVRGWIRTRRD
SYN_PASMU       ---------------------------MTKVASIVDVLQGK-IAIGETVTVRGWIRTRRD
SYN_HAEIN       ---------------------------MSKVASIVDVLQGK-VAIGETVTVRGWVRTRRD
SYN_HAEIG       ---------------------------MSKVASIVDVLQGK-VAIGETVTVRGWVRTRRD
SYN_HAEIE       ---------------------------MSKVASIVDVLQGK-VAIGETVTVRGWVRTRRD
SYN_MANSM       ---------------------------MTKIVSVAEVLQGR-TAIGEKVTVRGWVRTRRD
SYN_ACTSZ       ---------------------------MTKIASIADVLQGE-IAVGEKVTVRGWVRTRRD
SYN_YERPA       ----------------------------MSVVPVVDVLQGR-AAVGSEVTVRGWVRTRRD
SYN_YERPN       ----------------------------MSVVPVVDVLQGR-AAVGSEVTVRGWVRTRRD
SYN_YERP3       ----------------------------MSVVPVVDVLQGR-AAVGSEVTVRGWVRTRRD
SYN_YERPE       ----------------------------MSVVPVVDVLQGR-AAVGSEVTVRGWVRTRRD
SYN_YERPS       ----------------------------MSVVPVVDVLQGR-AAVGSEVTVRGWVRTRRD
SYN_YERPP       ----------------------------MSVVPVVDVLQGR-AAVGSEVTVRGWVRTRRD
SYN_YERE8       ----------------------------MSVVPVVDVLQGR-AAVDSEVTVRGWVRTRRD
SYN_SERP5       ----------------------------MSVVPVVDVLQGR-AAVDSEVTVRGWVRTRRD
SYN_PECAS       ----------------------------MSVVPVVDVLQGR-VAVDSEVTVRGWVRTRRD
SYN_PHOLL       ----------------------------MSVAPVVDVLQGR-VAVDSEVTVRGWIRTRRD
SYN_SALTI       ----------------------------MSVVPVADVLQGR-VAVDQEVTVRGWVRTRRD
SYN_SALPA       ----------------------------MSVVPVADVLQGR-VAVDQEVTVRGWVRTRRD
SYN_SALCH       ----------------------------MSVVPVADVLQGR-VAVDQEVTVRGWVRTRRD
SYN_SALTY       ----------------------------MSVVPVADVLQGR-VAVDQEVTVRGWVRTRRD
SYN_ECOLC       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_SHIF8       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_SHIFL       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECOL5       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECO24       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_SHIBS       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECOLI       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECOUT       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_SHISS       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECOHS       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECOL6       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ECO57       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_SHIDS       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_KLEP7       ----------------------------MSVVPVADVLQGR-VAVDSEVTVRGWVRTRRD
SYN_ENT38       ----------------------------MSVVPVADVLQGR-VAVDQEVTVRGWVRTRRD
SYN_SODGM       ----------------------------MSVVPVVDVLQGR-MPADSEITVQGWVRTRRD
SYN_BAUCH       ----------------------------MIILPIAKILQGIILAADHEVIVQGWVRTRRD
SYN_SHEHH       ----------------------------MSITSVASVFKGD-FAIGSQITVRGWVRSRRD
SYN_SHEPA       ----------------------------MSITSVASVFKGD-FAIGSQITVRGWVRSRRD
SYN_SHESH       ----------------------------MSITSVASVFKGE-FAIGSQVTVRGWVRSRRD
SYN_SHELP       ----------------------------MSIASVASVFKGD-FAVGSQVTVRGWVRTRRD
SYN_SHESM       ----------------------------MSIASVASVFKGE-HAVGSTVTVRGWVRTRRD
SYN_SHESR       ----------------------------MSIASVASVFKGE-HAVGSTVTVRGWVRTRRD
SYN_SHESA       ----------------------------MSIASVASVFKGE-HAVGSTVTVRGWVRTRRD
SYN_SHEON       ----------------------------MSIASVASVFKGE-HAVGSTVTVRGWVRTRRD
SYN_SHEB5       ----------------------------MSIASVASVFKGE-HAVGSKVTVRGWVRTRRD
SYN_SHEB8       ----------------------------MSIASVASVFKGE-HAVGSKVTVRGWVRTRRD
SYN_SHEB9       ----------------------------MSIASVASVFKGE-HAVGSKVTVRGWVRTRRD
SYN_SHEPC       ----------------------------MSIASVASVFKGE-HAVGSKVTVRGWVRTRRD
SYN_SHESW       ----------------------------MSIASVASVFKGE-HAVGSKVTVRGWVRTRRD
SYN_SHEDO       ----------------------------MSIASVASVFNGD-HAVGSQVTVRGWVRTRRD
SYN_SHEFN       ----------------------------MSIASVASVFKGE-HAVGSQVTVRGWVRTRRD
SYN_SHEAM       ----------------------------MSIASIASVFKGD-FAPGTEITVRGWVRTRRD
SYN_VIBVY       ----------------------------MTYAPVKDVLSGK-LAVDSEVTVRGWIRTRRD
SYN_VIBVU       ----------------------------MTYAPVKDVLSGK-LAVDSEVTVRGWIRTRRD
SYN_VIBPA       ----------------------------MTYAPVSDVLSGK-LAVDSEVTVRGWIRSRRD
SYN_ALIF1       ----------------------------MTYAPVTDVLSGK-LAVDSEVTVRGWIRSRRD
SYN_VIBCH       ----------------------------MTYAPVNDVLSGK-LAVDSEVTVRGWIRTRRD
SYN_PHOPR       ----------------------------MTYAPVTDVLSGK-LAVDSEVTVRGWIRSRRD
SYN_AERHH       ----------------------------MTHASVVDVLTGK-YAVGTTQTVKGWIRTRRD
SYN_PSET1       ----------------------------MSHLAISELLKGK-VSVDSQVTVKGWIRTRRD
SYN_PSEA6       ----------------------------MAQAPVADIFAGK-YSVGQQVTVKGWVRTRRD
SYN_IDILO       ----------------------------MSYASVVDVLTGK-VAVDETVTVRGWVRTRRD
SYN_COLP3       ----------------------------MSVISITDVLAGN-FPVNESITIHGWIRTRRD
SYN_PSYIN       ----------------------------MSKTAIVEIFNSK-FPIGTEVTVQGWIRTRRD
SYN_HAHCH       ----------------------------MTHYAISDLLKNK-AEIGSEVTVKGWVRSRRD
SYN_XYLFT       ----------------------------MTVASVEQMFSGK-IQVGSEVTVRGWVRTRRD
SYN_XYLFA       ----------------------------MTVASVEQMFSGK-IQVGSEVTVRGWVRTRRD
SYN_XANC5       ----------------------------MTVVSVEHALAGK-LPEGGEVTVRGWVRTLRG
SYN_XANAC       ----------------------------MTVVSVEHALAGK-LPEGGEVTVRGWVRTLRG
SYN_XANOR       ----------------------------MTVVSVEHALAGK-LPEGGEVTVRGWVRTLRG
SYN_XANOM       ----------------------------MTVVSVEHALAGK-LPEGGEVTVRGWVRTLRG
SYN_XANC8       ----------------------------MTVVSVEHALAGK-IPEGGEVTVRGWVRTLRG
SYN_XANCP       ----------------------------MTVVSVEHALAGK-IPEGGEVTVRGWVRTLRG
SYN_MYXXD       ----------------------------MQVVSVKKALAGG-VEEGTKVEVRGWVRTRRD
SYN_BUCAI       ----------------------------MNRVSISDIYKDDII-VNSLITVCGWVRNRRS
SYN_BUCAP       ----------------------------MSRISISEIYKDDII-VNTPITIFGWVRSRRS
SYN_BUCBP       ----------------------------MKTVSIFDIYLNKIK-LNSKINIQGWVRNRRR
SYN_WIGBR       ----------------------------MKSVSIIDIIEKKIF-KKKLVEINGWVRTKRN
SYN_BLOPB       ----------------------------MNVVSVVDILSGHVS-KNTEITIQGWIRTRRD
SYN_BLOFL       ----------------------------MNTISIVKILNEFDQLQNTEITLYGWIRTRRH
SYN_DESPS       -----------------------------MRQRITELLVAK--AEEQVVTVAGWIRTRRD
SYN_RHOBA       MWWRRSRTNSLRYTVHPFASLQRSMIAPMDWTTIDACRTST--ELPRPVEIRGWIRTRRD
SYN_BACSU       ---------------------------------MKTTINQVYKHVGEEVTIGAWVANKRS
SYN_BACVZ       ---------------------------------MKTTINQVYKHTGEEVMIGAWVANKRS
SYN_BACLD       ---------------------------------MKTTINQVYKHVGEEVTIGAWIANKRS
SYN_GEOTN       ---------------------------------MKTTIAEVNQYVGQEVTIGAWLANKRS
SYN_ALKHC       ---------------------------------MKTTIAKIGQYVDQEVTLGAWLANKRS
SYN_BACSK       ---------------------------------MKTTIAQVGRYVNEQVTIGAWIANKRS
SYN_STAES       ---------------------------------MKTTIKQAKKHLNQEVTIGAWLTNKRS
SYN_STAEQ       ---------------------------------MKTTIKQAKKHLNQEVTIGAWLTNKRS
SYN_STAHJ       ---------------------------------MKTTIKQAKQHLNQEVTIGAWLTNKRS
SYN_STAAS       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAW       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAT       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAE       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAC       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAA3       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAA8       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAA2       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAN       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAM       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAA9       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAA1       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAB       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAAR       ---------------------------------MKTTIKQAKDHLNQDVTIGAWLTNKRS
SYN_STAS1       ---------------------------------MNTTIKEAKQYIGQEVTIGAWLTNKRS
SYN_OCEIH       ---------------------------------MKITIAQAPQYIEQEVTIGAWLSNKRS
SYN_LISMF       ---------------------------------MKITINQASEFVGKEVTIGAWLANKRS
SYN_LISIN       ---------------------------------MKITINQASEFVGKEVTIGAWLANKRS
SYN_LISMO       ---------------------------------MKITINQASEFVGKEVTIGAWLANKRS
SYN_LISW6       ---------------------------------MKITINQASEFVGKEVTIGAWLANKRS
SYN_STRR6       -------------------------------MTKRVTIIDVKDYVGQEVTIGAWVANKSG
SYN_STRP2       -------------------------------MTKRVTIIDVKDYVGQEVTIGAWVANKSG
SYN_STRPN       -------------------------------MTKRVTIIDVKDYVGQEVTIGAWVANKSG
SYN_STRSV       ------------------------------MSKKIVTIIDVKNYVGQEVTIGAWVANKSG
SYN_STRT1       ------------------------------MSKQLVSIIDVPKHIGEEITIGAWVANKSG
SYN_STRT2       ------------------------------MSKQLVSIIDVPKHIGEEITIGAWVANKSG
SYN_STRTD       ------------------------------MSKQLVSIIDVPKHIGEEITIGAWVANKSG
SYN_STRPC       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVTNKSG
SYN_STRPB       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVTNKSG
SYN_STRP1       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRPD       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRPM       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRPG       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRP3       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRP8       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRP6       ------------------------------MSKKLISIVNVKDYVGQEVTIGAWVANKSG
SYN_STRPF       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRA5       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRA3       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRA1       ------------------------------MSKKLISIVDVKDYVGQEVTIGAWVANKSG
SYN_STRS2       ------------------------------MSRKLITINQVKDYVGQEVTIGAWVANKSG
SYN_STRSY       ------------------------------MSRKLITINQVKDYVGQEVTIGAWVANKSG
SYN_STRMU       ------------------------------MSKDYISIIDVKNHVGEEVTIGAWVANKSG
SYN_LACLM       -------------------------------MKDLISIIDVKDHVGETVKIGAWVADKSG
SYN_LACLS       -------------------------------MKDLISIINVKDHVGETVKIGAWVADKSG
SYN_LACLA       -------------------------------MKDLISIIDVKDHVGETVKIGAWVADKSG
SYN_ENTFA       --------------------------MNGETNVEQIQIIDSNKHVGETVKIGAWIANKRS
SYN_LACSS       -------------------------------MVKKISIIDAKDHVDEEVKIGVWLTDKRS
SYN_LACP3       -------------------------------MTEQIRIIDAKEHVNEEVKIGAWLTDKRS
SYN_LACS1       --------------------------------MKTISIIDAKHHVNEKVKIGVWLTNKRS
SYN2_LACPL      -------------------------------MVQQINIIDAKDHVDEKVKIGAWLTNKRS
SYN1_LACPL      --------------------------------METISIINAADHVNEQVKIGVWLSNKRS
SYN_LIMRD       --------------------------------METITISEVPKHVGETVKIGVWLTDKRS
SYN_LACJO       -------------------------------MTELISIKDSSKHVDQEVKMHVWLTDKRS
SYN_LACGA       -------------------------------MTELISIKDSSKHVDQKVKMHVWLTDKRS
SYN_LACH4       -------------------------------MTELISIKDSSKHVDQEVKMHVWLTDKRS
SYN_LACDA       -------------------------------MTELISIRESSKHVDEEVRMHVWLTDKRS
SYN_THET8       ---------------------------------MRVFIDEIARHVDQEVELRGWLYQRRS
SYN_THET2       ---------------------------------MRVFIDEIARHVDQEVELRGWLYQRRS
SYN_DEIGD       -----------------------------MTVIPNVSIDALKNHVGETVRVNAWLTDKSG
SYN_DESRM       --------------------------------MQGTLIRHLGKHVDEEVSIQGWLYNKRS
SYN_PELTS       --------------------------------MEKVLIKHLGNYAGQEVLIKGWLYNKRS
SYN_SYMTH       --------------------------------MKWVTVDRLPQYEGQTVELRGWVQNYRS
SYN_ROSS1       -----------------------------MSLLPTATISTIAHHNGEVVTLAGWVVHKTE
SYN_ROSCS       -----------------------------MSLLPTATISDIARHNGRVVTLAGWVAHKTE
SYN_CHLAA       -----------------------------MSLLPTATVATIARYVGQRVTLAGWVYHKTE
SYN_KORVE       -----------------------------MEQAPVSTIHEIGKHDGQSVTIKGWLYNLRE
SYN_THEAC       --------------------------------MLSIAEVSTKAYVGSKVSIRGWVYRIRS
SYN_THEVO       --------------------------------MLSIAEASSEAHVGSEVSVRGWVYRIRS
SYN_PYRHO       ------------------------------MIEKVYCQEVKPELDGKKVRLAGWVYTNMR
SYN_PYRFU       ------------------------------MIEKVYCSEVKPELEGKKVKLAGWVYSNMK
SYN_PYRAB       ------------------------------MIEKTYCQDIKPELDGKRVKLAGWVYSNMR
SYN_THEKO       ------------------------------MIDKVYCADVTPEMEGKKVKLAGWVYRKRE
SYN_LEPIN       -----------------------------MSETPIVSNHDLGKYVDQKVVIQGWVHGIRG
SYN_LEPIC       -----------------------------MSETPIVSNHDLGKYVDQKVVIQGWVHGIRG
                                                                      .     

SYN_CLOB1       S-KNFAFVEVNDGSFFKNVQVILES------------------------SLENFKELC--
SYN_CLOBH       S-KNFAFVEVNDGSFFKNVQVILES------------------------SLENFKELC--
SYN_CLOBL       S-KNFAFVEVNDGSFFKNVQVILES------------------------SLENFKELC--
SYN_CLOK5       S-KSFAFIELNDGSFFKNVQVVLDD------------------------KIENFKEII--
SYN_CLOAB       S-KSFGFIEINDGSFFKNIQVVFDD------------------------KLDNFKEIS--
SYN_CLONN       S-NKFGFIEVNDGSFFKNIQVVFGA------------------------ELENFKEIS--
SYN_CLOTE       S-KNFGFIELNDGSFFKNLQIIIDT------------------------NLDNFDKVS--
SYN_CLOPE       S-NAFGFIEVNDGSFFKNVQVVFDSA-----------------------KISNYKEIS--
SYN_BACAN       S-KAFGFIELNDGSFFKSVQIVFDT------------------------ELDNFKEIA--
SYN_BACCZ       S-KAFGFIELNDGSFFKSVQIVFDT------------------------ELDNFKEIA--
SYN_BACC1       S-KAFGFIELNDGSFFKSVQIVFDT------------------------ELDNFKEIA--
SYN_BACHK       S-KAFGFIELNDGSFFKSVQIVFDT------------------------ELDNFKEIA--
SYN_BACCR       S-KAFGFIELNDGSFFKSVQIVFDT------------------------ELENFKEIA--
SYN_BACCN       S-KVFGFIELNDGSFFKSVQIVFDT------------------------ELDNFKEIT--
SYN_ALKOO       S-KAFGFIEVNDGSFFKNIQVVFEE------------------------GLENFAEVS--
SYN_ALKMQ       S-KAFGFIELNDGTFFKNIQIVFDE------------------------DLHNFSDVS--
SYN_ACET2       S-KAFGFIELNDGSFFKNLQIVFEEK-----------------------NLPNFKEIA--
SYN_DESHY       S-KSFGFIEINDGSFFKGIQVVFEE------------------------DLNNFEEIA--
SYN_FUSNN       Q-KKFGFIELNDGSFFKGVQIVFEE------------------------GLENFDEVS--
SYN_UREP2       S-KKIGFLVLNDGSSLTNLQAVYRV-D----------------------KIDNYEEIA--
SYN_UREPA       S-KKIGFLVLNDGSSLTNLQAVYRV-D----------------------KIDNYEEIA--
SYN_MYCGE       S-ANIIFLAISDGSSINTLQAVVKQED----------------------NPQVFSLLQ--
SYN_MYCPN       S-ANIIFLEVNDGSTLLNLQAVVKQ-D----------------------QPELFALAE--
SYN_MYCPE       N-GSIGFISFTDGSCIHSIQLVYKN-G----------------------ETNNFEEAK--
SYN_MYCGA       S-GAIGFIAFSDSTALEPVQIVFKK-E----------------------NTPNFDEIS--
SYN_MYCCT       G-KFVSFMILNDGTTFTDLQVVYKTKT----------------------K--GYEQAL--
SYN_MYCMS       G-KFVSFMILNDGTTFTDLQVVYKTK--------------------------GYEQAL--
SYN_MESFL       G-KAVSFMVLNDGTVLNDLQVVYKPET----------------------F--GFEQGS--
SYN_MYCPU       N-KKIQFIELNDGSSVLHLQLVLKS------------------------EKMDLNDI---
SYN_MYCMO       N-TNIRFVEINDGSTIKNLQVVIKK------------------------EIMSFLEVD--
SYN_MYCH7       N-LKIIFVELNDGSSFKNLQCVLKK------------------------EFIDFDKIE--
SYN_MYCH2       N-LKIIFVELNDGSSFKNLQCVLKK------------------------EFIDFDKIE--
SYN_MYCHJ       N-LKIIFVELNDGSSFKNLQCVLKK------------------------EFIDFDKIE--
SYN_AYWBP       Q-KKLIFIDLNDGTFLENLQIVCKEIK--NIETA---------------DINEFQENQKF
SYN_ONYPE       Q-KKLIFIDLNDGTFLENLQIICKETKTKNIETAA--------------EITEFHENQKV
SYN_ACHLI       Q-KEFGFINLNDGSFFENIQVVYERAT-----------------------TKDFDAVT--
SYN_GEOSL       G-KGVAFLAVNDGSCLASLQVVAEP------------------------GLANYHELR--
SYN_GEOMG       G-KEVAFLALNDGSCFANLQVVAEP------------------------GLATFADVC--
SYN_GEOUR       G-KDVTFLAINDGSCMTSLQVVVEP------------------------ALPNYQDVC--
SYN_PELPD       S-KGIAFIALNDGSNLAGIQVVVEE------------------------QSPAFSEID--
SYN_BORBU       N-GKIGFIEINDGSTLKGIQAVINE-----------------------EENQFSEKD---
SYN_BORBP       N-GKIGFIEINDGSTLKGIQAVINE-----------------------EENQFTEKD---
SYN_BORAP       N-GKIGFIEINDGSTLKGIQAVINE-----------------------EENQFDEKD---
SYN_NOSS1       L-KGFAFIEVNDGSSLGNLQVVINQ------------------------DLPDYAVI---
SYN_SYNY3       L-KDFSFVEVNDGSSLANLQVVLDG------------------------SLADYDRL---
SYN_MICAN       L-KEFTFLEVNDGSSLANLQVILEP------------------------TLPDYENV---
SYN_THEEB       L-KECTFVNLNDGSTLAGLQVVIPN------------------------TVAAATPT---
SYN_SOLUE       S-KNVHFIQLNDGSSPVDLQVVLDA------------------------GVVP-EDV---
SYN_TREDE       T-KNLVFIEINDGSCFASIQATFD--------------------RDTGLDNNTEAL----
SYN_TREPA       T-KRAVFISLSDGSCPDTLQVTVPLPECSASLSSGAQAEQIPNVRDAVLQGETLAQT---
SYN_BACFN       S-KQVNFIALNDGSTINNVQVVVDL-------------------------ANFDEEM---
SYN_BACFR       S-KQVNFIALNDGSTINNVQVVVDL-------------------------ANFDEEM---
SYN_BACTN       S-KQVNFIALNDGSTINNVQIVVDL-------------------------ANFDEEM---
SYN_PHOV8       S-KQVNFIALNDGSTINNVQIVVDL-------------------------ANFDEEM---
SYN_PARD8       S-KQVNFIALNDGSTINNVQIVVDV-------------------------DKLGDEF---
SYN_PORGI       N-KAVNFIALNDGSTIHNMQIVADL-------------------------ASFDAAQ---
SYN_DESVV       A-KGFSFLEINDGSCLANIQAIVDE-------------------------GIPAYAN---
SYN_DESVH       A-KGFSFLEINDGSCLANIQAIVDE-------------------------GIPAYAN---
SYN_DESAG       A-KGFSFLELNDGSCLTNIQVIVDE-------------------------ETDAYRS---
SYN_LAWIP       A-KGFVFLELNDGSCLKNIQCIINE-------------------------GSAAWDM---
SYN_PARUW       Q-KTFTFIEINDGSTLSNFQIIATP------------------------DIAGYDQL---
SYN_ACTP2       SKAGLSFLAVYDGSCFDPIQSIINN---------------------------DLANYND-
SYN_HAEDU       SKAGLSFLTVYDGSCFEPIQVIINN---------------------------DLANYQT-
SYN_HISS2       SKAGLSFLAIYDGSCFDPIQAIVNN---------------------------DIENYET-
SYN_HAES1       SKAGLSFLAIYDGSCFDPIQAIVNN---------------------------DIENYET-
SYN_PASMU       SKAGLSFLAIYDGSCFDPIQAIVNN---------------------------DIENYET-
SYN_HAEIN       SKAGLSFLAVYDGSCFDPIQAIINN---------------------------DIENYES-
SYN_HAEIG       SKAGLSFLAVYDGSCFDPIQAIINN---------------------------DIENYES-
SYN_HAEIE       SKAGLSFLAVYDGSCFDPIQAIINN---------------------------DIKNYES-
SYN_MANSM       SKAGLSFLAVYDGSCFDPIQAIINN---------------------------DIVNYES-
SYN_ACTSZ       SKAGLSFLTVYDGSCFNPIQAIINN---------------------------DIVNYES-
SYN_YERPA       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_YERPN       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_YERP3       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_YERPE       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_YERPS       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_YERPP       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_YERE8       SKAGISFVAVYDGSCFDPLQAVVNN---------------------------TLPNYQD-
SYN_SERP5       SKAGISFLAVYDGSCFDPLQAVVNN---------------------------SLPNYQD-
SYN_PECAS       SKAGISFIAVYDGSCFNPLQAVVNN---------------------------NLSNYQD-
SYN_PHOLL       SKAGISFLAVYDGSCFNPLQAVVNN---------------------------NLPNYQD-
SYN_SALTI       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SALPA       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SALCH       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SALTY       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECOLC       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SHIF8       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SHIFL       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECOL5       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECO24       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SHIBS       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECOLI       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECOUT       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SHISS       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECOHS       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECOL6       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_ECO57       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_SHIDS       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYNE-
SYN_KLEP7       SKAGFSFLAVYDGSCFDPVQAVINN---------------------------SLPNYNQ-
SYN_ENT38       SKAGISFLAVYDGSCFDPVQAVINN---------------------------SLPNYND-
SYN_SODGM       SKAGISFLAVYDGSCFDPLQAVINN---------------------------TLPNYQN-
SYN_BAUCH       SKAGISFLSIYDGSCLDSLQVIINH---------------------------DLPNYKS-
SYN_SHEHH       SKAGISFLAVYDGSCFDPIQGVVPN---------------------------NLENYTN-
SYN_SHEPA       SKAGISFLAVYDGSCFDPIQGVVPN---------------------------NLENYTN-
SYN_SHESH       SKAGISFLAVYDGSCFDPIQGVVPN---------------------------SLENYND-
SYN_SHELP       SKAGISFLAVYDGSCFDPIQGVVPN---------------------------SLDNYND-
SYN_SHESM       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLENYDN-
SYN_SHESR       SKAGISFLAVYDGSCFNPIQGVVPS---------------------------SLENYDN-
SYN_SHESA       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLENYDN-
SYN_SHEON       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLENYDN-
SYN_SHEB5       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLDNYDN-
SYN_SHEB8       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLDNYDN-
SYN_SHEB9       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLDNYDN-
SYN_SHEPC       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLENYDN-
SYN_SHESW       SKAGISFLAVYDGSCFNPIQGVVPN---------------------------SLENYDN-
SYN_SHEDO       SKAGISFLALYDGSCFDPIQGVIPN---------------------------NLPNYDD-
SYN_SHEFN       SKAGISFLAVYDGSCFDPIQGVLPN---------------------------SLANYND-
SYN_SHEAM       SKAGISFLAVYDGSCFDAIQGVVPN---------------------------ALSNYND-
SYN_VIBVY       SKAGISFLAIYDGSCFDPIQAVVPN---------------------------NLNNYND-
SYN_VIBVU       SKAGISFLAIYDGSCFDPIQAVVPN---------------------------NLNNYND-
SYN_VIBPA       SKAGISFLAIYDGSCFDPIQAVVPN---------------------------NLNNYDN-
SYN_ALIF1       SKAGISFLAVYDGSCFDPIQAVVPN---------------------------DLNNYND-
SYN_VIBCH       SKAGISFLAIYDGSCFNPIQAVVPN---------------------------NLNNYDN-
SYN_PHOPR       SKAGISFLAIYDGSCFDPIQAVVPN---------------------------ELNNYQE-
SYN_AERHH       SKAGISFLAISDGSCFHPVQAVVPN---------------------------TLANYEN-
SYN_PSET1       SKAGISFLAVHDGSCFDPIQAVVPN---------------------------SLNNYD--
SYN_PSEA6       SKAGLSFVALHDGSCFDPIQVIALN---------------------------TLNNYA--
SYN_IDILO       SKAGISFINLHDGSCFDAIQAVVPA---------------------------ELPNYSN-
SYN_COLP3       SKAGISFLALHDGSCFDAIQAIVPN---------------------------ELDNYES-
SYN_PSYIN       SKAGISFLAIYDGSCFDPIQAVVPA---------------------------ALENYSD-
SYN_HAHCH       SKAGVSFIHVHDGSCFDAIQAVVAK---------------------------ELPNYDA-
SYN_XYLFT       SKAGLSFVSVSDGSCFAAIQVVTPA---------------------------HLPNYET-
SYN_XYLFA       SKAGLSFVSVSDGSCFAAIQVVTPA---------------------------HLPNYET-
SYN_XANC5       S-AGLAFINVTDGSCFAPIQVVAND---------------------------TLPNFD--
SYN_XANAC       S-AGLAFINVTDGSCFAPIQVVAND---------------------------TLPNFD--
SYN_XANOR       S-AGLAFINVTDGSCFAPIQVVAND---------------------------TLPNFD--
SYN_XANOM       S-AGLAFINVTDGSCFAPIQVVAND---------------------------TLPNFD--
SYN_XANC8       S-AGLAFINVTDGSCFAPIQVVATD---------------------------TLPNFD--
SYN_XANCP       S-AGLAFINVTDGSCFAPIQVVATD---------------------------TLPNFD--
SYN_MYXXD       SKAGISFVNVSDGSTFDPIQVVAPN---------------------------SLPNYEK-
SYN_BUCAI       SKSGFSFITIYDGSCFNSIQVIANN---------------------------TLPNYYK-
SYN_BUCAP       SKSGFSFITVYDGSCLNSVQVVADK---------------------------TLSNYYK-
SYN_BUCBP       SKLGLLFIDLYDGSCLYTMQVVVKD---------------------------ILSNYDS-
SYN_WIGBR       SKLGISFVDVYDGSCLQHIQVIAKK---------------------------DLSNYKS-
SYN_BLOPB       SKAKISFLDLYDGSCINSLQIIAYD---------------------------KLHNYKN-
SYN_BLOFL       SKTKITFLNLYDGSCLESLQIVVKN---------------------------NLHNYET-
SYN_DESPS       T-GDFSFLEVNDGSTLINMQVIADK---------------------------SLGNYEE-
SYN_RHOBA       SKGGFSFLEVNDGTSLGNLQVVAPA---------------------------ELENYAE-
SYN_BACSU       S-GKIAFLQLRDGTGFIQGVVVKAEVEESI-----------------------FQTAK--
SYN_BACVZ       S-GKIAFLQLRDGTGFIQGVVVKAEVEEDI-----------------------FQIAK--
SYN_BACLD       S-GKIAFLQLRDGTGFIQGVVVKAEVDEET-----------------------FQTAK--
SYN_GEOTN       S-GKIAFLQLRDGTGFIQGVVEKANVSEEV-----------------------FQRAK--
SYN_ALKHC       S-GKIAFLQLRDGTGFIQGVVVKAEVGDEW-----------------------FQKAK--
SYN_BACSK       S-GKIAFLQLRDGTGFIQGVVVKAEVPEDV-----------------------FALAK--
SYN_STAES       S-GKIAFLQLRDGTGFMQGVVVKSEVDEET-----------------------FQLAK--
SYN_STAEQ       S-GKIAFLQLRDGTGFMQGVVVKSEVDEET-----------------------FQLAK--
SYN_STAHJ       S-GKIAFLQLRDGSGFMQGVVVKSEVSDET-----------------------FQLAK--
SYN_STAAS       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAW       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAT       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAE       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAC       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAA3       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAA8       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAA2       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAN       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAM       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAA9       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAA1       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAB       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAAR       S-GKIAFLQLRDGTGFMQGVVVKSEVDEEV-----------------------FKLAK--
SYN_STAS1       S-GKIAFLQLRDGTGFIQGVVAKAEVDEEI-----------------------FQKAK--
SYN_OCEIH       S-GKIAFLQLRDGTGFMQGIVVKSDVSEDV-----------------------FSTSK--
SYN_LISMF       S-GKIAFLQLRDGTGFMQGVVVKAEVGDDI-----------------------FATAK--
SYN_LISIN       S-GKIAFLQLRDGTGFMQGVVVKAEVGDDM-----------------------FATAK--
SYN_LISMO       S-GKIAFLQLRDGTGFMQGVVVKAEVGDDI-----------------------FATAK--
SYN_LISW6       S-GKIAFLQLRDGTGFMQGVVVKAEVGDDM-----------------------FASAK--
SYN_STRR6       K-GKIAFLQLRDGTAFFQGVAFKPNFVEKFGEEVGL---------------EKFDVIK--
SYN_STRP2       K-GKIAFLQLRDGTAFFQGVAFKPNFVEKFGEEVGL---------------EKFDVIK--
SYN_STRPN       K-GKIAFLQLRDGTAFFQGVAFKPNFVEKFGEEVGL---------------EKFDVIK--
SYN_STRSV       K-GKIAFLQLRDGSAFFQGVAFKPNFIEKFGEEEGL---------------AKFDTIK--
SYN_STRT1       K-GKIAFLQLRDGTAFFQGVAFKPNFIEKFGEEEGL---------------EKFDTIK--
SYN_STRT2       K-GKIAFLQLRDGTAFFQGVAFKPNFIEKFGEEEGL---------------EKFDTIK--
SYN_STRTD       K-GKIAFLQLRDGTAFFQGVAFKPNFIEKFGEEEGL---------------EKFDTIK--
SYN_STRPC       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRPB       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRP1       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRPD       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRPM       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRPG       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRP3       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRP8       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRP6       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRPF       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGH---------------EKFDVIK--
SYN_STRA5       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRA3       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRA1       K-GKIAFVQLRDGSAFFQGVAFKPNFIEKYGEESGL---------------EKFDVIK--
SYN_STRS2       K-GKLAFLQLRDGTAFFQAVAFKPNFIEKFGEEAGT---------------EKFDVAK--
SYN_STRSY       K-GKLAFLQLRDGTAFFQAVAFKPNFIEKFGEEAGT---------------EKFDVAK--
SYN_STRMU       K-GKIAFLQLRDGTAFFQAVAFKPNFIEKFGEEAGL---------------EKFNTIK--
SYN_LACLM       K-GKLQFLQLRDGTAFFQAVVFKPNMIEKFGEEEGT---------------AKFDEIK--
SYN_LACLS       K-GKLQFLQLRDGTAFFQAVVFKPNMIEKFGEEEGT---------------AKFDEIK--
SYN_LACLA       K-GKLQFLQLRDGTAFFQAVVFKPNMIENFGEEEGT---------------AKFDEIK--
SYN_ENTFA       S-GKIAFLQLRDGTAFFQGVVFKPNFIEAFGEEAGT---------------EKFQEIK--
SYN_LACSS       S-GKISFLQLRDGSAFFQGVVVKSQVSEEV-----------------------FQLAK--
SYN_LACP3       S-GKITFLQLRDGSAYFQGVVSKADVPEEV-----------------------FSLAK--
SYN_LACS1       S-GKIAFLQLRDGSAYFQGVVVKNAVSEET-----------------------FALAK--
SYN2_LACPL      S-GKIAFLQLRDGSAFFQGVVVKSQVSEEV-----------------------FELAK--
SYN1_LACPL      S-GKIAFLQLRDGTATFQGVALKNELGETA-----------------------FAQLT--
SYN_LIMRD       S-GKIAFLQLRDGTGFFQGIIRKNDVSEEK-----------------------FDSAKH-
SYN_LACJO       S-GKIIFLQLRDGTAFFQGVIRKNDVSEEV-----------------------FEAAK--
SYN_LACGA       S-GKIIFLQLRDGTAFFQGVVRKNDVSEEV-----------------------FEAAK--
SYN_LACH4       S-GKIIFLQLRDGTAFFQGVVRKNDVTDEV-----------------------FEVAK--
SYN_LACDA       S-GKIVFLQLRDGTAFFQGVVRKNDVSEEV-----------------------FEAAK--
SYN_THET8       K-GKIHFLILRDGTGFLQATVVQGEVPEAV-----------------------FREAD--
SYN_THET2       K-GKIHFLILRDGTGFLQATVVQGEVPEAV-----------------------FREAD--
SYN_DEIGD       K-GKLQFLKLRDGSGFVQATVFKGDVPEEV-----------------------FEAAR--
SYN_DESRM       S-GKIQFLIVRDGTGLVQGVLVKKEAPE------------------------IFELAK--
SYN_PELTS       S-GKICFLIVRDGTGLVQGVVEKKAAGED-----------------------LFSLAG--
SYN_SYMTH       S-GKIQFIIFRDGTGVCQAVLFIKDVPPE-----------------------VFEAGK--
SYN_ROSS1       K-GKLVFIRLRDGSGVIQCVVFRNNVTEA-----------------------TFAAAQ--
SYN_ROSCS       K-GKLVFIRLRDGSGVMQCVVFRKNVAEE-----------------------TFIAAQ--
SYN_CHLAA       K-GKLIFILLRDGSGTIQCVTFKKNVSEE-----------------------TFATAQ--
SYN_KORVE       S-GKLLFPIFRDGTGLLQGVLFKKNVSPE-----------------------LFDLVK--
SYN_THEAC       S-GGVTFVVVRDSSGIIQCTARKNELPEDV-----------------------YDTIS--
SYN_THEVO       S-GGVTFIVIRDSTGIVQCTAKKNELTPEQ-----------------------YDEIS--
SYN_PYRHO       V-GKKIFLWIRDSTGIVQAVVAKNVVGEET-----------------------FEKAK--
SYN_PYRFU       V-GKKIFLWIRDSTGIVQTVIAKNVVGEEV-----------------------FEKAK--
SYN_PYRAB       V-GKKIFLWIRDSTGIIQTVIAKNVVGEDV-----------------------FETAK--
SYN_THEKO       V-GKKVFIVLRDSSGIVQVVFSKDL-NEEA-----------------------YREAK--
SYN_LEPIN       S-NARQFLSLRNSGKILQVLAEKEILGEEV-----------------------FQTVK--
SYN_LEPIC       S-NARQFLSLRNSGKILQVLAEKEILGEEV-----------------------FQTVK--
                      *  . :.                                               

SYN_CLOB1       -----------------KMPISTSVEVEGIVQPTPNAKQPFEIKATRISIEGK--SSTDY
SYN_CLOBH       -----------------KMPISTSVEVEGIVQPTPNAKQPFEIKATRISIEGK--SSTDY
SYN_CLOBL       -----------------KMPISTSVEVEGIIQPTPNAKQPFEIKATRVSIEGK--SSTDY
SYN_CLOK5       -----------------KLPISSSLSVEGTLILTPNAKQSFEIKAKKISLEGN--SSSEY
SYN_CLOAB       -----------------KFIISSTITVEGEFVLTPNAKQPFEIHAENITLEGN--SDNDY
SYN_CLONN       -----------------KYAISSSISVEGEVVITEGAKQPFEIHAKKVVLEGK--SDADY
SYN_CLOTE       -----------------KLPISSSIVVEGKLVATPSAKQPFEVQASKVTVEGT--SLQDY
SYN_CLOPE       -----------------KLPISSSISVIGTLVETPDSKQPFEIQAEEIIVEGM--SDSDY
SYN_BACAN       -----------------KLPLSSSVKVEGKVIATPGAKQPFEIKAEKIDIEGL--SDSDY
SYN_BACCZ       -----------------KLPLSSSVKVEGKVIATPGAKQPFEIKAEKIDIEGL--SDSDY
SYN_BACC1       -----------------KLPLSSSVKVEGKVIVTPGAKQPFEIKAEKIDIEGL--SDSDY
SYN_BACHK       -----------------KLPLSSSVKVEGKVIATPGAKQPFEIKAEKIDIEGL--SDSDY
SYN_BACCR       -----------------KLPLSSSVKVEGKVIATPGAKQPFEIKAEKIDIEGL--SDSDY
SYN_BACCN       -----------------KLPLSSSIRVEGKFIATPTAKQPFEIKAEKIEIEGL--SDSDY
SYN_ALKOO       -----------------KLSISTAIIVKGKLEITPDAKQPFEIKATSIEVEGE--SDSDY
SYN_ALKMQ       -----------------KFTISSAIIIEGTLEITPGAKQPFEIKATNVELEAH--SHKDY
SYN_ACET2       -----------------KLSVGSAIIAHGELVETPGAKQPFELKATKIEIEGA--STPDY
SYN_DESHY       -----------------KVATGSSLIIKGLLVESPGAKQPFELKAQSIMIEGA--CSGDY
SYN_FUSNN       -----------------RLSIASTIKVKGTLVKSEGSGQDLEVKAKKIEIFQK--ADLEY
SYN_UREP2       -----------------AARMWAAVVIEGVIKLTPTAKQPLELEVLNAQILKQ--SDEDF
SYN_UREPA       -----------------AARMWAAVVIEGVIKLTPTAKQPLELEVLNAQILKQ--SDEDF
SYN_MYCGE       -----------------TVNLASAVMVWGEIILTPKAKQPLELKLKQVSLLAQ--AESDY
SYN_MYCPN       -----------------SISLASAVSVSGTVALTPKSKQPLELVVKQINVLST--ARADY
SYN_MYCPE       -----------------STRTGSAILVEGVVVESKQPNQSFEIKVTNFILLKQ--ADEDY
SYN_MYCGA       -----------------KLPISSMILVKGVVRNTPEKKQPFEIQASKIVVLKE--ADPSY
SYN_MYCCT       -----------------QARVSSIVKVIGRVVLTPEKQQKFEVQADAIELIDQ--AIEDY
SYN_MYCMS       -----------------QARVSSIVKVVGRVVLTPEKQQKFEVQADEIELIDQ--AIEDY
SYN_MESFL       -----------------KARVSSIVEIEGILIPTPTRPQPFEINATSITLLDQ--AIEEY
SYN_MYCPU       -----------------HFKTGSSIKAEGILNYTPKAEQSVELIVDKISLLAQ--SDEDF
SYN_MYCMO       -----------------KIRLGAAIHVKGVLKYTPGMAQEIELNADKFILLKN--TDEDF
SYN_MYCH7       -----------------NLALGVAVEISGIFSNTPERQQFGEVLVETLEIKGNN-YNTNF
SYN_MYCH2       -----------------NLALGVAVEISGIFSNTPERQQFGEVLVETLEIKGNN-YNTNF
SYN_MYCHJ       -----------------NLALGVAVEISGIFSNTPERQQFGEVLVETLEIKGNN-YNTNF
SYN_AYWBP       NNNNKSSNNINLEKLKEILQIGASLQVEGILKATNNLKTPFEISAQNISLLGT--SDFSY
SYN_ONYPE       NTKNESPNNINLEKLKEMLQIGASLQVEGILKATNNPQTPFEISAQNVSLLGA--SDFSY
SYN_ACHLI       -----------------RLSVGASIEVIGTLVLTPDRSQPFEIKALEVRLIGD--SGENY
SYN_GEOSL       -----------------GIGTGAAVAVRGIVAESPAAGQAVELHATKVVVVGG--ADEQY
SYN_GEOMG       -----------------AIGTGAAVAVRGRLVDSPASGQCYELHADEVAVIGL--ADESY
SYN_GEOUR       -----------------RIGTGSAVAVRGILRESPAAGQKYELAAEELEIIGP--ADDSY
SYN_PELPD       -----------------AIATGCSLRVTGTLVASPAAGQERELRAESIAIVGT--SDENY
SYN_BORBU       ---------------LKKLTTGTSISLTGLLVESPAKGQNYEIKTHSFNVIGET-DPETY
SYN_BORBP       ---------------LKKLTTGASISLTGLLVESPAKGQNYEIKIYSFNVIGEA-DSKTY
SYN_BORAP       ---------------LKNLTTGASISLTGLLVESPAKGQNYEIKTCGFNVIGEA-DPKTY
SYN_NOSS1       ---------------VKQLNTGASVEVNGVLVASQGKGQRIELKAEAVKVYGEA-DPETY
SYN_SYNY3       ---------------LSQLQTGAALVVEGKLAPSPGKGQRVELKATKLELLGGA-DPGSY
SYN_MICAN       ---------------LKTISTGAAIAVSGNLVPSPGKGQNIELKAAEITLYGDC-PPD-Y
SYN_THEEB       ---------------MKDLTTGAAAEFTGELVRSPGKNQAIELHAEEIHLWGTA-DPETY
SYN_SOLUE       ---------------VAKITTGACISVEGDLVASMGKGQAVEIKARALTVHGTA-DPEHY
SYN_TREDE       ---------------LKKAGTGVSVKVSGNLVPSPAAGQRVELQANNIHIFGDA-DQEKY
SYN_TREPA       ---------------LKRVTTGACIRAEGALVPSPGAGQALELRACNLTVLGEA-PAETY
SYN_BACFN       ---------------LKQITTGACLSVNGVLTESVGAGQKAEVQAREIEVLGTC-D-NTY
SYN_BACFR       ---------------LKQITTGACLSVNGVLTESVGAGQKAEVQAREIEVLGTC-D-NTY
SYN_BACTN       ---------------LKLITTGACISVNGVMVESVGSGQKVEVQAKEIEVLGTC-D-NTY
SYN_PHOV8       ---------------LKQITTGACISVNGELTESIGSGQAAEVQARGIEVLGTC-D-NTY
SYN_PARD8       ---------------LKPITTGASISVNGILTQSQGKGQSVEIQATEIEIFGTA-DPATY
SYN_PORGI       ---------------MSQITTGACIGVIGTLVESQGAGQSVEVQASAIEIYGTA-DPATY
SYN_DESVV       ---------------IGAVSTGAAVDITGELVESPGKGQKWEVRVQTLTLLGAA-DAETY
SYN_DESVH       ---------------IGAVSTGAAVDITGELVESPGKGQKWEVRVQTLTLLGAA-DAETY
SYN_DESAG       ---------------VGEATTGASVDIRGQLVESPGKGQKWEVRAATMTLLGKA-DPETF
SYN_LAWIP       ---------------LDGVNTGACVSVYGKLVPSPGRGQDWEIQVEKMVVHGLA-APEVF
SYN_PARUW       ---------------INQLSTGVSVSAIGTIVESPGKEQNLEMQATAITIIGKC-DPEVY
SYN_ACTP2       --------------EVLRLTAGCSVIVTGKVVESPAEGQAVELHATHVEVVGWVEDPDTY
SYN_HAEDU       --------------EILRLTAGCSVIVTGNIVESPASGQAVELQALEVEVVGWVDDPDTY
SYN_HISS2       --------------EILRLTTGCSVVVTGKIVESPAEGQAVELQADKIEVSGWVDDPETY
SYN_HAES1       --------------EILRLTTGCSVVVTGKIAESPAEGQAVELQANKIEVSGWVDDPETY
SYN_PASMU       --------------EVLRLTTGCSVIVTGTVVESPAEGQAVELQAEKVEVAGWVEDPETY
SYN_HAEIN       --------------EILRLTTGCSVIVTGKVVESPAEGQAVELQAEKVEVTGFVEDPDTY
SYN_HAEIG       --------------EILRLTTGCSVIVTGKVVESPAEGQAVELQAEKVEVTGFVEDPDTY
SYN_HAEIE       --------------EILRLTTGCSVIVTGKVVESPSEGQAVELQAEKVEVTGFVEDPDTY
SYN_MANSM       --------------EVLRLTTGCSVIVTGTVSKSPAEGQAVELQAETVEVVGWVEDPDTY
SYN_ACTSZ       --------------EVLRLTAGCSVIVTGTVVESPAQGQAVELQTETVEVVGWVEDPDTY
SYN_YERPA       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAINVVGWVDDPDTY
SYN_YERPN       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAINVVGWVDDPDTY
SYN_YERP3       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAINVVGWVDDPDTY
SYN_YERPE       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAINVVGWVDDPDTY
SYN_YERPS       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAINVVGWVDDPDTY
SYN_YERPP       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAINVVGWVDDPDTY
SYN_YERE8       --------------EVLHLTTGCSVEVTGTVVASPGEGQSFEIQATAIKVVGWVDDPDTY
SYN_SERP5       --------------EVLHLTTGCSIEVTGVVVASPGEGQSFELQATAIKVVGWVDDPDTY
SYN_PECAS       --------------DVLRLTTGCSVEITGNVVASPGEGQSFELQATNVNVVGWVDDPDTY
SYN_PHOLL       --------------EVLHLTTGCSVEVTGTVVASLGQGQNFELQATKIVVIGLVEDPDTY
SYN_SALTI       --------------EVLHLTTGCSVVVTGKVVASPGQGQSFEIQATKVEVAGWVEDPDTY
SYN_SALPA       --------------EVLHLTTGCSVVVTGKVVASPGQGQSFEIQATKVEVAGWVEDPDTY
SYN_SALCH       --------------EVLHLTTGCSVVVTGKVVASPGQGQSFEIQATKVEVAGWVEDPDTY
SYN_SALTY       --------------EVLHLTTGCSVVVTGKVVASPGQGQSFEIQATKVEVAGWVEDPDTY
SYN_ECOLC       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_SHIF8       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_SHIFL       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECOL5       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECO24       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_SHIBS       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECOLI       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECOUT       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_SHISS       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECOHS       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECOL6       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_ECO57       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQTSKVEVAGWVEDPDTY
SYN_SHIDS       --------------DVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTY
SYN_KLEP7       --------------EVLRLTTGCSVIVTGKVVASQGQGQSFEIQATSVEVTGWVEDPDTY
SYN_ENT38       --------------DVLHLTTGCSVIVTGVVVASPGQGQSFELQATAIEVTGWVEDPDTY
SYN_SODGM       --------------DILRLTSGCSVSVTGRVVESLGGGQRYEIQAQAIEVLGWVDDPDTY
SYN_BAUCH       --------------DVLHLTTGCSVVITGSIVTSIGVGQHFEIQAKNIKVLGWVKNPETY
SYN_SHEHH       --------------EVLKLTAGCSVVMTGEVVESPGKGQAFEMQVTKLEVVGFVEDPDTY
SYN_SHEPA       --------------EVLKLTAGCSVVMTGEVVESPGQGQAFEMQVTKVEVAGLVEDPDTY
SYN_SHESH       --------------EILKLTAGCSVVMTGEVVDSPGKGQAFELQVSSVEVAGWVEDPDTY
SYN_SHELP       --------------EILRLTAGCSVVMTGELVESPGKGQAFEMQVTKVEVTGWVEDPDTY
SYN_SHESM       --------------EVLKLTAGCSVIVTGEIVESPGAGQAYELQVTQVEVTGWVEDPDTY
SYN_SHESR       --------------EVLKLTAGCSVIVTGEIVESPGAGQAYELQVTHVEVTGWVEDPDTY
SYN_SHESA       --------------EVLKLTAGCSVIVTGEIVESPGAGQAYELQVTHVEVTGWVEDPDTY
SYN_SHEON       --------------EVLKLTAGCSVIVTGDIVESPGAGQAYELQVTAVEVTGWVEDPDTY
SYN_SHEB5       --------------EVLKLTAGCSVVMTGDVVESPGAGQAFELQVTDIEVAGWVDDPDTY
SYN_SHEB8       --------------EVLKLTAGCSVVMTGDVVESPGAGQAFELQVTDIEVAGWVDDPDTY
SYN_SHEB9       --------------EVLKLTAGCSVVMTGDVVESPGAGQAFELQVTELEVAGWVDDPDTY
SYN_SHEPC       --------------EVLKLTAGCSVVMTGDVVESPGAGQAFELQVTELEVTGWVDDPDTY
SYN_SHESW       --------------EVLKLTAGCSVVMTGDVVESPGAGQAFELQVTELEVTGWVDDPDTY
SYN_SHEDO       --------------EVLKLTAGCSLVMTGDVVESPGAGQAFELQVTAVEVTGWVDDPDTY
SYN_SHEFN       --------------DVLKLTAGCSVVMTGEVVASPGAGQAFELQVTEIVVTGFVDDPDTY
SYN_SHEAM       --------------EVLKLTAGCSVEMTGNLVESPGSGQAFELQATAVKVTGWVDDPDTY
SYN_VIBVY       --------------EVLKLTTGCSVEVTGKIVASPAAGQAFELAATDVKVVGWVEDADTY
SYN_VIBVU       --------------EVLKLTTGCSVEVTGKIVASPAAGQAFELAATDVKVVGWVEDADTY
SYN_VIBPA       --------------EVLKLTTGCSVEVTGKIVESPAQGQDFELAATDVKVVGWVEDAETY
SYN_ALIF1       --------------EVLKLTTGCSVEVTGTIVASPAKGQDFELAATEVKVVGWVEDAETY
SYN_VIBCH       --------------EVLKLTTGCSVEVTGKIVESPASGQAFELAASDVKVVGWVEDADTY
SYN_PHOPR       --------------EVLKLTTGCSVEVTGKIVESPAKGQDFELAATEVKVVGLVEDPDTY
SYN_AERHH       --------------EVLRLTTACSVEVTGVVAASQGSGQAFELQATEVKVVGWVEDPDTY
SYN_PSET1       --------------EVTSLTAGCSVSVTGVLVQSAGQGQSYEIQANSVTVLGWVENPDSY
SYN_PSEA6       --------------DIQRLTTSCSIIATGVLKESQGQGQSLEIEADEIEIVGWVENPDTY
SYN_IDILO       --------------EVQKLTTGCSVAITGVVVPSQGKGQSFELQATKVHVYGWVEDPDTY
SYN_COLP3       --------------DVLKLTTGCSVKVTGILVESPGKGQAFEIQATEVEVLGFVEDPDTY
SYN_PSYIN       --------------EVLNLTAGCSVQVTGELVESPGKGQQFEIQATQVEVLGFVQDPDTY
SYN_HAHCH       --------------DVLRLTTGCSLIVTGTLVESPGQGQSCEIQATSVELVGLVDDPETY
SYN_XYLFT       --------------EVRKLTTGCAVIVIGTLAPSLGQGQQFEIQAQSIEVVGWVEDPETY
SYN_XYLFA       --------------EVRKLTTGCAVIVIGTLAPSLGQGQQFEIQAQSIEVVGWVEDPETY
SYN_XANC5       --------------EIKRLTSGCSLIAKGVLVKSQGKGQSFEIQASGVEIVGWVEDPLTY
SYN_XANAC       --------------EIKRLTSGCSLIAKGVLVKSQGKGQSFEIQASGVDVVGWVEDPLTY
SYN_XANOR       --------------EIKRLTSGCSLIAKGVLVKSQGKGQSFEIQASGVEIVGWVEDPLTY
SYN_XANOM       --------------EIKRLTSGCSLIAKGVLVKSQGKGQSFEIQASGVEIVGWVEDPLTY
SYN_XANC8       --------------EIKRLTSGCSLIAKGVLVKSQGKGQSFEIQASGVEIVGWVEDPLTY
SYN_XANCP       --------------EIKRLTSGCSLIAKGVLVKSQGKGQSFEIQASGVEIVGWVEDPLTY
SYN_MYXXD       --------------EILHLTAGCSVISRGTLVKSQGKGQAYEVQADEVQVLGFVDDPDTY
SYN_BUCAI       --------------EILHLTTGCSVMLSGKLILSIGDKQKYEIQLKKIKVLGWVENPETY
SYN_BUCAP       --------------DILHLTIGCSVTITGILILSIGDKQKYEIKATKFQVLGWIKNPDTY
SYN_BUCBP       --------------EISKLSVGCSINVFGVLISSIGTKQKYEIQAKVVKVIGIINNPGSY
SYN_WIGBR       --------------DILRLTSGCSVKIFGVLKKSLKNSKIYELHATCIKVLGWIKDPGKY
SYN_BLOPB       --------------EILRLTSGCSVIIVGIIVKSIGIKQHVEVIAKNIKILGWIEDPSTY
SYN_BLOFL       --------------DILKLTTGCSIIAKGYITNSLGTKQRIELIATYIQVLGWIDNPSTY
SYN_DESPS       --------------EVKKLSTGCSVMVEGVLKESPAKGQSVEVHASSVTVVGWA-DPETY
SYN_RHOBA       --------------EIQKLTAGCSVVVQGELVESPAKGQSTELHASSVRVIGWC-DGETY
SYN_BACSU       -----------------SVTQETSLYIKGIVKEDERSPLGYELAVTDIEVIHEAT---DY
SYN_BACVZ       -----------------SVTQETSLYVKGIVKEDERSPLGYELAVTSIEVIHEAT---DY
SYN_BACLD       -----------------SVTQETSLYVKGVVKEDERSPLGYELAVTSLEVIHEAT---DY
SYN_GEOTN       -----------------TLTQETSLYVTGTVRVDERSPFGYELSVTNIQVINEAV---DY
SYN_ALKHC       -----------------NLTQESSLYVTGIVRKDERAPSGYELTVTSFDIIHEAT---DY
SYN_BACSK       -----------------SITQESSLYVTGTVREDERSPSGYELSVEQIELIHQAT---DY
SYN_STAES       -----------------DITQESSLYITGTITEDNRSDLGYEMQVKSIEIVHEAH---DY
SYN_STAEQ       -----------------DITQESSLYITGTITEDNRSDLGYEMQVKSIEIVHEAH---DY
SYN_STAHJ       -----------------EITQESSLYVTGVITEDNRSDLGYEMQVKSIEVIHEAH---DY
SYN_STAAS       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAW       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAT       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAE       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAC       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAA3       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAA8       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAA2       -----------------EIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAN       -----------------EIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAM       -----------------EIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAA9       -----------------EIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAA1       -----------------EIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAB       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAAR       -----------------EITQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAH---DY
SYN_STAS1       -----------------EITQESSLYVTGVISEDNRSDIGYEMQVKSIEVISEAH---DY
SYN_OCEIH       -----------------NITQESSLYVTGKIVEDTRSDFGYEMQVSNVEVIHEAN---DY
SYN_LISMF       -----------------ALTQETSLYVTGTINEDTRSPFGYEMAVSGVEVISESH---DY
SYN_LISIN       -----------------ALTQETSLFVTGTINEDTRSPFGYEMAVSGVEVISESH---DY
SYN_LISMO       -----------------ALTQETSLYVTGTINEDTRSPFGYEMAVSSVEVISESH---DY
SYN_LISW6       -----------------ALTQETSLYVTGTINEDTRSPFGYEMAVSGVEVISESH---DY
SYN_STRR6       -----------------RLSQETSVYVTGIVKEDERSKFGYELDITDIEVIGESQ---DY
SYN_STRP2       -----------------RLSQETSVYVTGIVKEDERSKFGYELDITDIEVIGESQ---DY
SYN_STRPN       -----------------RLSQETSVYVTGIVKEDERSKFGYELDITDIEVIGESQ---DY
SYN_STRSV       -----------------KLSQETSVYVTGVVKEDERSKFGYELDITDIEIIGESN---DY
SYN_STRT1       -----------------HLSQETSIYVTGMVKEDERSKFGYELDINDIEVIGKSQ---DY
SYN_STRT2       -----------------HLSQETSIYVTGMVKEDERSKFGYELDITDIEVIGKSQ---DY
SYN_STRTD       -----------------HLSQETSIYVTGMVKEDERSKFGYELDITDIEVIGESQ---GY
SYN_STRPC       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRPB       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRP1       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRPD       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRPM       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRPG       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRP3       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRP8       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRP6       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRPF       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEIIGESH---EY
SYN_STRA5       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEVIGESH---EY
SYN_STRA3       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEVIGESH---EY
SYN_STRA1       -----------------RLNQETSVYVTGIVKEDERSKFGYELDITDLEVIGESH---EY
SYN_STRS2       -----------------RLSQETSVYVTGIVKEDERSKFGYELDVTDLEVIGESQ---DY
SYN_STRSY       -----------------RLSQETSVYVTGIVKEDERSKFGYELDVTDLEVIGESQ---DY
SYN_STRMU       -----------------HLNQETAIEIKGIVKEDKRSKFGYELDATDLKVIGTSD---NY
SYN_LACLM       -----------------HLSQETSVYVTGVVKEDSRSKFGYELDVTELEVIGHSH---DY
SYN_LACLS       -----------------HLSQETSVYVTGVVKEDSRSKFGYELDVTELEVIGHSH---DY
SYN_LACLA       -----------------HLSQETSVYVTGVVKEDSRSKFGYELDVTDLEVIGQSH---DY
SYN_ENTFA       -----------------HLSQETAVMVTGVIKEDSRSKFGYEMDITDLEVVGASE---DY
SYN_LACSS       -----------------DVKQESSMWITGVIHEDTRSHFGYEIEVSNIELIGDSS---EY
SYN_LACP3       -----------------ELRQESSMWITGVIHQDSRSHFGYEIEVRNIELVGDSH---DY
SYN_LACS1       -----------------EVKQETSLYVTGVIHEDKRSHFGYEIEIEEIEVVGESN---EY
SYN2_LACPL      -----------------EVKQEASMWITGVIHEDSRSKFGYEIEVEDIVVVGESE---EY
SYN1_LACPL      -----------------DLAQETSLWVTGTIHADTRSPFGYELAISQFEVVGTSH---DY
SYN_LIMRD       -----------------DLHQETSFWVTGEIAEDKRSKFGYEIHIKDFDIVGESE---DY
SYN_LACJO       -----------------SLRQEASFYITGTVHEDKRSHFGYEIQISDLEIVSNNE---GY
SYN_LACGA       -----------------SLRQEASFYITGTVHEDKRSHFGYEIQISDLEIVSNNE---GY
SYN_LACH4       -----------------SLRQESSFYITGTVHEDARSHFGYEIQITDLKVVSNNE---GY
SYN_LACDA       -----------------GLRQEASFYLTGTIHEDARSHFGYEIQISDLEVVSNNE---GY
SYN_THET8       -----------------HLPQETALRVWGRVREDRRAPGGFELAVRDLQVVSRPQG--EY
SYN_THET2       -----------------HLPQETALRVWGRVREDRRAPGGFELAVRDLQVVSRPQG--EY
SYN_DEIGD       -----------------RLSQEQAVRVTGEVRADERAPGGVELAVRDLVPFAANQA--EY
SYN_DESRM       -----------------ELTQESAIRLRGIVREEPRSMGGYELTVTGLEIINLAQE---Y
SYN_PELTS       -----------------NITQESSLMLRGTVREEPRAPGGFEIQVTGLEIVHMAEP---Y
SYN_SYMTH       -----------------RLTQESSIIIRGSVRKDDRAPGGYEIGVQDLEIVQIAEE---Y
SYN_ROSS1       -----------------QLTIESSCRITGAVRADARAPGGFELDVNAIEIIQIAPE---Y
SYN_ROSCS       -----------------RLTLESSCRITGTVRADERAPGGFELDVNGIEIIQIAPE---Y
SYN_CHLAA       -----------------SLTQESSCRITGSVRADERAPGGYELDVESIELIGPSHE---Y
SYN_KORVE       -----------------NLTQESSVIVTGNVRAEQRAPGGYEMDVTALEVVQRVPENEPY
SYN_THEAC       -----------------SLGIESSVEFHGTLKEDRRSPSGYEIAVDSFRVYQKND---VF
SYN_THEVO       -----------------SLGIESSLSLIGTMKKEPRSPTGYEISIHKFTVYQKND---VF
SYN_PYRHO       -----------------KLGRESSVIVEGIVKADERAPGGAEVHVEKLEVIQAVS---EF
SYN_PYRFU       -----------------KLGRESSVIVEGIVKADERAPGGAEVRVEKLEVIQAVS---EF
SYN_PYRAB       -----------------KLGRESSVIVEGIVKADERAPGGAEVHVEKLKVIQAVS---EF
SYN_THEKO       -----------------KVGIESSVIIEGTVKADPRAPTGAEVQGEKLQIIQNVD---FF
SYN_LEPIN       -----------------HLRQETSVTVIGNLVKNEKSPIGFELVMESIQIVGESE---NY
SYN_LEPIC       -----------------HLRQETSVTVIGNLVKNEKSPIGFELVMESIQIVGESE---NY
                                            * .          *:                :

SYN_CLOB1       PLQKK--RHTFEYLRTIAHLRPRSNAFSAVFRVRSLAAYAVHKFFQERGFVYTNTPIITG
SYN_CLOBH       PLQKK--RHTFEYLRTIAHLRPRSNAFSAVFRVRSLAAYAVHKFFQERGFVYTNTPIITG
SYN_CLOBL       PLQKK--RHTFEYLRTIAHLRPRSNAFSAVFRVRSLAAYAVHKFFQERGFVYTNTPIITG
SYN_CLOK5       PLQKK--RHTLEYLRTIAHLRPRSNTFSAVFRVRSIAAYAVHKFFQEKDFVYVNTPIITG
SYN_CLOAB       PLQKK--RHTLEYLRSIAHLRPRSNTFSAVFRVRSLAAYAVHKFFQERDFVYVNTPLITA
SYN_CLONN       PLQKK--RHTFEYLRSIAHLRPRSNAFSAVFRVRSLAAYAIHKFFQDQGFVYVHTPIITG
SYN_CLOTE       PLQKK--RHSFEFLRSIAHLRPRSNTFSAVFRIRSLAAYAVHKFFQEKNFVYVHTPIITA
SYN_CLOPE       PLQKK--RHTFEYLRTIAHLRPRSNAFSATFRVRSVAAYAIHKFFQDQGFVYTHTPILTG
SYN_BACAN       PLQKK--RHTFEYLRTIAHLRPRTNAFSATFRVRSIAAFAIHQFFQERGFVHVHTPIITG
SYN_BACCZ       PLQKK--RHTFEYLRTIAHLRPRTNAFSATFRVRSIAAFAIHQFFQERGFVHVHTPIITG
SYN_BACC1       PLQKK--RHTFEYLRTIAHLRPRTNAFSATFRVRSIAAFAIHQFFQERGFVHVHTPIITG
SYN_BACHK       PLQKK--RHTFEYLRTIAHLRPRTNAFSATFRVRSIAAFAIHQFFQERGFVHVHTPIITG
SYN_BACCR       PLQKK--RHTFEYLRTIAHLRPRTNAFSATFRVRSIAAFAIHQFFQERGFVHVHTPIITG
SYN_BACCN       PLQKK--RHTFEYLRTIAHLRPRTNAFSATFRVRSIAAYAIHKFFQERGFVHVHTPIITG
SYN_ALKOO       PLQKK--RHTFEFLREIAHLRPRSNTFSAVFRVRSLAAFAIHQFFQERGFVYTHTPIITG
SYN_ALKMQ       PLQKK--RHTFEYLRQIAHLRPRSNAFSAVFRVRSIAAFAIHQFFQEKGFVYTHTPIVTG
SYN_ACET2       PLQKK--RHSFEYLRTIAHLRPRTNTFSAVFRVRSLLAYAIHKFFQERGFVYVHTPIITG
SYN_DESHY       PLQKK--RHSFEYLRTIAHLRPRTNTFAAVFRVRSLVAYAIHKFFQDKGFVYIHTPIITG
SYN_FUSNN       PLQNK--RHTFEYLRTKAHLRARTNTFSAVFRVRSVLAYALHKFFQENNFAYVHAPIITG
SYN_UREP2       LLSNN--DLNLETLRLNAHLRPRTNLFHAIMKVRATLAFAVHEFMNQNEYSWLAAPLFTG
SYN_UREPA       LLSNN--DLNLETLRLNAHLRPRTNLFHAIMKVRATLAFAVHEFMNQNEYSWLAAPLFTG
SYN_MYCGE       PLQKK--EHSQEFFRSNAHLRVRAKTYFAVMKIRSVLSHAIFEYFFKNDFILVQSPILTS
SYN_MYCPN       PLQKK--EHSLEFFRNNAYLRVRARTYFAIMKVRSLLSQAIFDYFFKNDFVLVHSPILTS
SYN_MYCPE       PLQKK--EHGAEFLRTIAHLRQRTNKYGTIMRLRSELAFAIHNFFHQNNFVWVSSPIITS
SYN_MYCGA       PLQKK--AHGSEFLRENAHLRVRTNKFYVIMKIRSELANAFFEFFKNNDFLYVHAPLITS
SYN_MYCCT       PLQKK--EHTTEYLREIAHLRAKTKTFNAIFKIRSAAAYAIHKFFNDRGFVYIHSPIITS
SYN_MYCMS       PLQKK--EHTTEYLREIAHLRAKTKTFNAIFKIRSAAAYAIHRFFNEKNFVYIHSPIITS
SYN_MESFL       PLQKK--EHSPEFLREISHLRARTKTFQAIFRIRSTAAFAIHKFFQENNYVYVTTPIITS
SYN_MYCPU       PIQTK--KTTLEFLRTIPHLRHRSNTIKAVMLVRSSISFFIHEYFQKNDFSLVAAPIITS
SYN_MYCMO       PIQKK--ETSLEALREIPHLRHRTTTLRAIMLIRSTLALEIHKFYNERGYLWVSSPIITG
SYN_MYCH7       PIQNQ--EISLEVLRQMPHFRHRSRLFRAIMKLRSALFFEIHKFFRRQGFINFSAPILTS
SYN_MYCH2       PIQNQ--EISLEVLRQMPHFRHRSRLFRVIMKLRSALFFEIHKFFRRQGFINFSAPILTS
SYN_MYCHJ       PIQNQ--EISLEVLRQMPHFRHRSRLFRVIMKLRSALFFEIHKFFRRQGFINFSAPILTS
SYN_AYWBP       PLQPK--KHSKVFLRQISHLRVRTKLFGAVFRIRNTAFFALHSFFQKKGFFHINTPIITP
SYN_ONYPE       PLQPK--KHSKAFLRQISHLRVRTKLFGAVFRIRNTAFFALHSFFQKKGFFHINTPIITA
SYN_ACHLI       PIQPK--RHTREFLREVAHLRPRTNLFSAVFRVRSIAAYAIHKFFQEQDFVYVHTPILTA
SYN_GEOSL       PLQKK--RHTFEYLRTIAHLRPRSNTFGAVFRVRSSLAQAVHRFFAERGFLYVHTPIITT
SYN_GEOMG       PLQKK--RHSFEYLRSIAHLRPRSNTFGAVFRVRSSVAQAVHRFFAERGFLYVHTPIITT
SYN_GEOUR       PLQKK--RHSFEYLRTIAHLRPRTNTFGAVFRVRSSLAQAVHRFFAERGFLYVHTPIITA
SYN_PELPD       PLQKK--RHSFEYLREIAHLRPRSNTFGAVFRLRSRLAQAIHRFFGDNNFLYVHTPIITA
SYN_BORBU       PLQKK--RHSFEFLREIPHLRIRTNTFGAIARVRNKISYKIHEYFQKNGFFYINTPIITS
SYN_BORBP       PLQKK--RHTFEFLREIPHLRIRTNTFGAIARVRNKISYKIHEYFQKNGFFYINTPIITS
SYN_BORAP       PLQKK--RHTFEFLREIPHLRIRTNTFGAVARVRSKISYKIHEYFQKNGFFYINTPIITS
SYN_NOSS1       PLQKK--RHSFEFLRTIGHLRSRTNSFGAVFRVRNACSAAIHQFFQERGFLWVHTPIITA
SYN_SYNY3       PLQKK--RHSFEFLRTIGHLRPRTNTIGAVMRVRNACATAIHQFFQERGFLWVHTPIITA
SYN_MICAN       PLQKK--RHSFEFLRTIAHLRARTNTLGAVMRVRNACATAIHSFFQEKGFIWVHTPIITA
SYN_THEEB       PLQKK--RHSFEFLRTIAHLRPRTNTLGAVMRVRNACATAIHQFFQERGFLWVHTPIITA
SYN_SOLUE       PLQKK--KHTLETLRELGHLRTRSNTFGAVFRVRNALACAIHKFFQDRGFMYVHTPVISA
SYN_TREDE       PLQKK--RHSMEFLRDIAHLRARTNTFGAVARIRSQMAYAIHTFFQERGFQYVHTPIITG
SYN_TREPA       PLQKK--SHSFEFLRAHAHLRARTSTFAACARVRSALAGAVHRFFSERHFQYVHTPIITA
SYN_BACFN       PLQKK--GHSMEFLREIAHLRPRTNTFGAVFRIRHNMAIAIHKFFHEKGFFYFHTPIITA
SYN_BACFR       PLQKK--GHSMEFLREIAHLRPRTNTFGAVFRIRHNMAIAIHKFFHEKGFFYFHTPIITA
SYN_BACTN       PLQKK--GHSMEFLREIAHLRPRTNTFGAVFRIRHNMAIAIHKFFHEKGFFYFHTPIITG
SYN_PHOV8       PLQKK--GHTMEFLREIAHLRPRTNTFGAVFRIRHNMAIAIHKFFHERGFFYFHTPIITA
SYN_PARD8       PLQKK--GHSMEFLREIAHLRPRTNTFGAVFRIRHNMAYAIHKFFHDRGFFYFHTPIITA
SYN_PORGI       PLQKK--GHTLEFLREIAHLRPRTNTFGAIYRIRHHMAIAIHTFFHNKGYYYFHAPLITA
SYN_DESVV       PLQKK--RHSDEFLRSIAHLRARTNKYGAAFRIRSEAAFAIHEFYRERGFFYVHTPILTG
SYN_DESVH       PLQKK--RHSDEFLRSIAHLRARTNKYGAAFRIRSEAAFAIHEFYRERGFFYVHTPILTG
SYN_DESAG       PLQKK--RHSDEYLRTIAHLRPRTNKFGAAFRIRAEASYAVHSFFRENGFFNVHTPILTG
SYN_LAWIP       PLQKK--RHSDEFLRTIAHLRVRTNKYGAIFRIRAEAAQAIHNYFYKKGFYYIHTPILTG
SYN_PARUW       LLQKK--RHTFEFLRSIAHLRPRTNTIGAVTRVRNALAFATHQFFQKRGFLYIHTPIITG
SYN_ACTP2       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHCLAQAIHRFFNEQGFYWVATPLITA
SYN_HAEDU       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHCLAQAIHRFFNGQGFYWVATPLITA
SYN_HISS2       PMSAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLAQAIHRFFHEQGFYWVATPLITA
SYN_HAES1       PMSAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLAQAIHRFFHEQGFYWVATPLITA
SYN_PASMU       PMAAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLAQAIHRFFHEQGFYWVATPLITA
SYN_HAEIN       PMAAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLSQAIHRFFHEQGFYWVATPLITA
SYN_HAEIG       PMAAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLSQAIHRFFHEQGFYWVATPLITA
SYN_HAEIE       PMAAK--RHSIEYLREVAHLRPRTNIIGAVSRVRHCLSQAIHRFFHEQGFYWVATPLITA
SYN_MANSM       PMAAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLAQAIHRFFNEQGFYWVATPLITA
SYN_ACTSZ       PMAAK--RHSIEYLREVAHLRPRTNIIGAVARVRHCLAQAIHRFFHEQGFYWVATPLITA
SYN_YERPA       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_YERPN       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_YERP3       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_YERPE       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_YERPS       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_YERPP       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_YERE8       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFDENGYFWVSTPLITA
SYN_SERP5       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFYHENGFFWVSTPLITA
SYN_PECAS       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFFHENGYFWVSTPLITA
SYN_PHOLL       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARMRHTLAQALHRFFHENGYFWVSTPLITA
SYN_SALTI       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFDEQGFFWVSTPLITA
SYN_SALPA       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFDEQGFFWVSTPLITA
SYN_SALCH       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFDEQGFFWVSTPLITA
SYN_SALTY       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFDEQGFFWVSTPLITA
SYN_ECOLC       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_SHIF8       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_SHIFL       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECOL5       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECO24       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_SHIBS       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECOLI       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECOUT       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_SHISS       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECOHS       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECOL6       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ECO57       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_SHIDS       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_KLEP7       PMAAK--RHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITA
SYN_ENT38       PMAAK--RHSIEYLREVAHLRPRTNMIGAVARVRHTLAQALHRFFDEQGYFWVSTPLITA
SYN_SODGM       PMAAK--RHSVEYLREVAHLRPRTNLIGAVARVRHTLAQAIHRFMDEQGFFWVSTPLITA
SYN_BAUCH       PITAK--KHSLEFLREVAHLRPRTNIIGAVTRVRHTLAQAIHRFMHIEGFFWVSTPLITT
SYN_SHEHH       PMAAK--RHSIEYLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYNEQGYIWVSTPLITA
SYN_SHEPA       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYNEQGYIWVSTPLITA
SYN_SHESH       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNSLSQAIHRFYHEQGFIWVSTPLITA
SYN_SHELP       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSHAIHNFYNEEGFIWVSTPLITA
SYN_SHESM       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHENGFVWVSTPLITA
SYN_SHESR       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHENGFVWVSTPLITA
SYN_SHESA       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHENGFVWVSTPLITA
SYN_SHEON       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHENGFVWVSTPLITA
SYN_SHEB5       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHEEGFIWVSTPLITA
SYN_SHEB8       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHEEGFIWVSTPLITA
SYN_SHEB9       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHEEGFIWVSTPLITA
SYN_SHEPC       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHEEGFIWVSTPLITA
SYN_SHESW       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHEEGFIWVSTPLITA
SYN_SHEDO       PMAAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHEQGFIWVSTPLITA
SYN_SHEFN       PMSAK--RHSIEHLRELAHLRPRTNIIGAVARVRNCLSQAIHRFYHQEGFIWVSTPLITA
SYN_SHEAM       PMAAK--RHSIEHLRDVAHLRPRTNIIGAVARVRNCLSQAIHRFYHENGFIWVSTPIITA
SYN_VIBVY       PMAKT--RHSIEYLREVAHLRPRTNVIGAVARVRHSLSQAIHRFYHEQGYYWLSAPLITA
SYN_VIBVU       PMAKT--RHSIEYLREVAHLRPRTNVIGAVARVRHSLSQAIHRFYHEQGYYWLSAPLITA
SYN_VIBPA       PMAKT--RHSIEYLREVAHLRPRTNVIGAVARVRNCLSQAIHRFYHEQGYFWVSAPLITA
SYN_ALIF1       PMAKT--RHSIEYLREVAHLRPRTNVIGAVARVRNCLSQAIHRFYHEQGYFWMSAPLITA
SYN_VIBCH       PMAKT--RHSIEYLREVAHLRPRTNVIGAVARVRNCLAQAIHRFYHEQGYFWVSAPLITA
SYN_PHOPR       PMAKT--RHSIEYLREVAHLRPRTNIIGAVARVRNCLSQAIHRFYHEQGFFWMSAPLITA
SYN_AERHH       PMAAK--RHSIEYLREQGHLRARTNMVGAVTRVRNCLSQAIHRFFHEQGYLWIAAPLITA
SYN_PSET1       PMAAK--RHSIEYLREHAHLRPRTNMIGAVTRVRNCLAQAIHRFYHEQGFLWISTPIITA
SYN_PSEA6       PMAPK--RHSLEYLREHAHLRPRTNVIGAVTRVRNCLSQAIHRFFHENGYCWVSTPILTA
SYN_IDILO       PMAPK--RHSMEYLREYAHLRPRTNITGAVMRVRNALSQAIHRFFHEEGYLWVSTPIITT
SYN_COLP3       PMAAK--RHSIEFLREQAHLRPRTNIGGAVTRVRNCLAQAVHRFLHSKGYFWISTPLITG
SYN_PSYIN       PMSAK--RHSIEYMREHAHLRARTNMFGAVTRVRNCLSHAMHNFFYEKGFNWISTPIITG
SYN_HAHCH       PVAKK--RHTFEFLRGVAHLRPRTNAFGAVTRVRTTLSHAVHHFFYEQGFQWINTPILTA
SYN_XYLFT       PIQPK--QHSLEFLREVAHLRPRTNLFGAVARIRHCLSQAVHRFFHENGYYWITTPIITT
SYN_XYLFA       PIQPK--QHSLEFLREVAHLRPRTNLFGAVARIRHCLSQAVHRFFHENGYYWITTPIITT
SYN_XANC5       PIQPK--PMTPEFLREVAHLRPRTNLFGAVTRIRNCLAQAVHRFFHQNGFNWISTPIITT
SYN_XANAC       PIQPK--PMTPEFLREVAHLRPRTNLFGAVTRIRNCLAQAVHRFFHQNGFNWISTPIITT
SYN_XANOR       PIQPK--PMTPEFLREVAHLRPRTNLFGAVTRIRNCLAQAVHRFFHQNGFNWISTPIITT
SYN_XANOM       PIQPK--PMTPEFLREVAHLRPRTNLFGAVTRIRNCLAQAVHRFFHQNGFNWISTPIITT
SYN_XANC8       PIQPK--PMSPEFLREVAHLRPRTNLFGAVTRIRNCLAQAVHRFFHQNGFNWISTPIITT
SYN_XANCP       PIQPK--PMSPEFLREVAHLRPRTNLFGAVTRIRNCLAQAVHRFFHQNGFNWISTPIITT
SYN_MYXXD       PIQPK--QHTLEFLRDVAHLRVRTNTFSAVTRVRHRAAQAVHRFFDEEGFFWVNTPIITA
SYN_BUCAI       PISSK--KHSTEYLREVAHLRSRTNLIGAIARIRNYILHSLHHFFYKEKYYWVPTPIITS
SYN_BUCAP       PISAK--KHSLEYLREVAHLRSRTNLIGVIVRIRHHIFQSLHKFLNKQGYYWIPTPIITG
SYN_BUCBP       PISSK--YHTMKHLRNVPHLRSRTNFFGAVSRVRNYLFNALHEFLFKNGYYWIPSPIITG
SYN_WIGBR       PISSK--PHTLEYLRSFSHLRPRTNIIGSVSRIRNIIFQEVHNFLNKKGFIWVPSPIITS
SYN_BLOPB       PITAK--KHTMEYLREVSHLRPRTNTIGAVARIRDTLSQAIHNFLHKQGFIWIPTPIITA
SYN_BLOFL       PITTK--KHSMEYLRNVAHLRPRTHIFGAISRIRHVLFQSIHNLMNTKGFIWVPTPIITA
SYN_DESPS       PLQKK--RHSLEFLREISHLRPRTNAISAVARVRSRLSYAVHNFFQEKGFTQVHTPIITT
SYN_RHOBA       PLQKK--RHSFEKLREWSHLRARTNTLGAVMRVRNRISQSIHRFFDDEGFNYLHTPIITA
SYN_BACSU       PITPK--EHGTEFLMDHRHLWLRSKRQHAIMKIRNEIIRATYEFFNNEGFVKVDPPILTG
SYN_BACVZ       PITPK--EHGTEFLMDHRHLWLRSKRQHAIMKIRNEIIRATYEFFNKEGFVKVDPPILTG
SYN_BACLD       PITPK--EHGTEFLMDHRHLWLRSKRQHATMKIRNEIIRATYEFFNKEGFVKVDPPILTG
SYN_GEOTN       PITPK--EHGVEFLMDHRHLWLRSRRQHAIMKIRNELIRATYEFFNERGFVKVDAPILTG
SYN_ALKHC       PITPK--EHGTEFLMDHRHLWIRSRKQHAVLRIRNEIIRATYEFFHENGFVKVDPPILTG
SYN_BACSK       PITPK--QHGTEFLMDHRHLWLRSKRQHAIMKIRSQIIRSTYDFFSERGFTKLDSPILTG
SYN_STAES       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEIIRATYEFFNENGFTKIDPPILTA
SYN_STAEQ       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEIIRATYEFFNENGFTKIDPPILTA
SYN_STAHJ       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEIIRATYEFFNENGFTKIDPPILTA
SYN_STAAS       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAW       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAT       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAE       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAC       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAA3       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAA8       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAA2       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAN       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAM       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAA9       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAA1       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAB       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAAR       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTA
SYN_STAS1       PITPK--NHGTEFLMDHRHLWLRSKKQHAVMKIRNEIIRATYEFFNDNGFTKIDPPILTA
SYN_OCEIH       PITPK--EHGTEFLMDHRHLWLRSKKQHAVMKIRNEIIRSTYEYFNKEGFVKVDPPILTG
SYN_LISMF       PITPK--EHGTEFLMDHRHLWLRSNRQHAIMKIRNEIIRASYEFFNKEGFLKIDPPILTG
SYN_LISIN       PITPK--EHGTEFLMDHRHLWLRSNRQHAIMKIRNEIIRASYEFFNKEGFLKIDPPILTG
SYN_LISMO       PITPK--EHGTEFLMDHRHLWLRSNRQHAIMKIRNEIIRASYEFFNKEGFLKIDPPILTG
SYN_LISW6       PITPK--EHGTEFLMDHRHLWLRSNRQHAIMKIRNEIIRASYEFFNKEGFLKIDPPILTG
SYN_STRR6       PITPK--EHGTDFLMDNRHLWLRSRKQVAVLQIRNAIIYVTYEFFDKNGFMKFDSPILSG
SYN_STRP2       PITPK--EHGTDFLMDNRHLWLRSRKQVAVLQIRNAIIYVTYEFFDKNGFMKFDSPILSG
SYN_STRPN       PITPK--EHGTDFLMDNRHLWLRSRKQVAVLQIRNAIIYATYEFFDKNGFMKFDSPILSG
SYN_STRSV       PITPK--EHGTDFLMDNRHLWLRSRKQVAMMQIRNAIIYATYEFFDKNGFMKFDSPILSG
SYN_STRT1       PITPK--EHGTDFLMDNRHLWLRSRKQMAIQQIRNAIIYATYDFFDKNGFIKFDSPILSS
SYN_STRT2       PITPK--EHGTDFLMDNRHLWLRSRKQMAIQQIRNAIIYATYDFFDKNGFIKFDSPILSS
SYN_STRTD       PITPK--EHGTDFLMDNRHLWLRSRKQMAIQQIRNAIIYATYDFFDKNGFIKFDSPILSS
SYN_STRPC       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRPB       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRP1       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRPD       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRPM       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRPG       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRP3       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRP8       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRP6       PVTPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRPF       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYATYEFFDQNGFIKFDSPILSE
SYN_STRA5       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYSTYEFFDQNGFIKFDSPILSE
SYN_STRA3       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYSTYEFFDQNGFIKFDSPILSE
SYN_STRA1       PITPK--EHGTDFLMDNRHLWLRSRKQMAVMQIRNAIIYSTYEFFDQNGFIKFDSPILSE
SYN_STRS2       PITPK--EHGTDFLMDNRHLWLRSRKQVAIQQIRNAIIYATYEFFEKNGFIKFDSPILSG
SYN_STRSY       PITPK--EHGTDFLMDNRHLWLRSRKQVAIQQIRNAIIYATYEFFEKNGFIKFDSPILSG
SYN_STRMU       PITPK--EHGTDFLMDHRHLWLRSRKQMAIMQIRNAVIYASYEFFDQNGFVKFDSPILSG
SYN_LACLM       PITPK--EHGVEFLLDNRHLWLRSKRQMAMMQVRNAIIYASYDFFAKNGFIKFDSPILSG
SYN_LACLS       PITPK--EHGVEFLLDNRHLWLRSKRQMAMMQVRNAIIYASYDFFAKNGFIKFDSPILSG
SYN_LACLA       PITPK--EHGVEFLLDNRHLWLRSKRQMAMMQVRNAIIYASYDFFAKNGFIKFDSPILSG
SYN_ENTFA       PITPK--EHGTDFLMDHRHLWLRSSKQHAIMLVRNEIIRATYEFFNEQGFIKIDSPILTG
SYN_LACSS       PITPK--EHGIEFLLDHRHLWLRSKRPFAIMKIRNEIIRATYEFFNQEGFMKMDPPILTG
SYN_LACP3       PISPK--EHGIEFLLDHRHLWLRSKRQFAIQQIRNEMIRATFEFFNNEGFIKMDPPILTD
SYN_LACS1       PITPK--EHGTDFLMDHRHLWLRSKKQFAIMQIRNEMIRATYEFFNKEGFIKLDAPILTG
SYN2_LACPL      PITPK--EHGVDFLLDHRHLWLRSKRPWAIMNIRNEVIRGTYEFFNQEGFIKMDSPILTG
SYN1_LACPL      PITPK--DHGIDFLLDHRHLWLRSSRPNAIMRIRNEVIRAVYEFFNDRGFIKIDAPILTG
SYN_LIMRD       PIGNK--EHGIDFLLDNRHLWLRSRKPWALMRIRSRVKLATMEFFEKHGFTQFDAPELTG
SYN_LACJO       PIGNK--EHGVDFLLDNRHLWLRSKRPFAIMQIRNTMFKATVDFFEKEGFIKFDAPIFMH
SYN_LACGA       PIGNK--EHGVDFLLDNRHLWLRSKRPFAIMQIRNTMFKATVDFFEKEGFIKFDAPIFMH
SYN_LACH4       PIGNK--EHGIDFLLDHRHLWLRSKKPFAIMQIRNTMFKATVDFFEKEDFIKFDAPIFMH
SYN_LACDA       PITNK--EHGIDFLLDHRHLWLRSRRPFAIMQIRNRIFKATVDFFENEGFVKFDAPLLMH
SYN_THET8       PIGPK--EHGIDFLMDHRHLWLRHRRPFAVMRIRDELERAIHEFFGERGFLRFDAPILTP
SYN_THET2       PIGPK--EHGIDFLMDHRHLWLRHRRPFAVMRIRDELERAIHEFFGERGFLRFDAPILTP
SYN_DEIGD       PITPK--EHGIEFLLDHRHLWLRHRRPWAILRVRDCVERAIVEFFHQEGFIRFDAPFFTP
SYN_DESRM       PISHK--EHGVDFLMDRRHLWMRTPRQNAILRIRAEIEQAARDFFNQNDFTLVDSPIITP
SYN_PELTS       PISLK--EHGVDFLAERRHLWIRTPRQSAILRIRSELEKGCRDFFEERDFVLADAPIITP
SYN_SYMTH       PITKK--EHGTEFLMDHRHLWIRSNRQVAILRIRNEITMAIHQFLQENGFVLTESPILMG
SYN_ROSS1       PIQPK--EHGVEFLMEHRHLWIRSSKQHALLRIRAEIIAAAQEWLNDQGFVRFDTPILTP
SYN_ROSCS       PIQPK--EHGVEFLMEHRHLWVRSSKQHALLRIRAEIIAAAQEWLNAQGFVRFDTPILTP
SYN_CHLAA       PITPK--EHGVEFLMAHRHLWVRSAKQHAILRIRAEVIAAAQEWLNEQGFVRFDTPILTA
SYN_KORVE       PITPK--EHGIEFLMEHRHLWVRSQRQAAILRIRGEIVRSAHEFFDKQGFTLTEPPILTP
SYN_THEAC       PITKD---QGEEFLLDNRHLWLRSREFTSVLKIRSTIFRSFADFFYENGYYQVQTPFMVS
SYN_THEVO       PITKD---QGEEFLLDNRHLWLRSREFTSILKVRSTIFRSFADFFYDQGYYQVHTPFMVS
SYN_PYRHO       PIPENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVT
SYN_PYRFU       PIPENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVT
SYN_PYRAB       PIPENPEQASPELLLDYRHLHIRSPKVSAIMRVKETLIMAAREWLLREGWHEVFPPILVT
SYN_THEKO       PITKD---ASDEFLLDVRHLHLRSPKVAAIMKVKGTLMQAAREWLLQDGWYEVFPPILVT
SYN_LEPIN       PITPK--EHGIDFLISQRHLWLRSSKQLAILRVRDSLSFAIRKYFHERDFLLIDTPILTG
SYN_LEPIC       PITPK--EHGIDFLISQRHLWLRSSKQLAILRVRDNLSFAIRKYFHERDFLLIDTPILTG
                 :           :    ::  :         ::               :    .* .  

SYN_CLOB1       SDCEGAGEMFQLTTMDLNNIPKTEEG--------------KIDFSKD-----FFG---SP
SYN_CLOBH       SDCEGAGEMFQLTTMDLNNIPKTEEG--------------KIDFSKD-----FFG---SP
SYN_CLOBL       SDCEGAGEMFQLTTMDLNNIPKTEEG--------------KIDFSKD-----FFG---SP
SYN_CLOK5       SDCEGAGEMFRITTMDLNNVPKEEDN--------------SVDFSKD-----FFG---KE
SYN_CLOAB       SDAEGAGEMFQVTTLDLKNPPKNEEG--------------NIDFSKD-----FFG---KK
SYN_CLONN       SDCEGAGEMFRVTTLDMENPPKDEKG--------------NVDYKED-----FFG---KQ
SYN_CLOTE       SDCEGAGEMFRVTTLDLNNIPKNDEG--------------KIDFSQD-----FFD---KD
SYN_CLOPE       SDCEGAGEMFRVTTLDMMAPPIAEEG--------------GIDFSQD-----FFG---KE
SYN_BACAN       SDTEGAGEMFRVTTQDLNNVPKGEDG--------------QVDESKD-----FFG---KE
SYN_BACCZ       SDTEGAGEMFRVTTQDLNNVPKGEDG--------------QVDESKD-----FFG---KE
SYN_BACC1       SDTEGAGEMFRVTTQDLNNVPKGEDG--------------QVDESKD-----FFG---KE
SYN_BACHK       SDTEGAGEMFRVTTQDLNNVPKDEDG--------------QVDESKD-----FFG---KE
SYN_BACCR       SDTEGAGEMFRVTTQDLNNLPKGEDG--------------KVDESKD-----FFG---KE
SYN_BACCN       SDTEGAGEMFRVTTHDMNNLPKGEDG--------------QVDDSKD-----FFG---RE
SYN_ALKOO       SDAEGAGEMFRITTLDPKNPGLNEAG--------------EVDFTKD-----FFG---KE
SYN_ALKMQ       SDAEGAGEMFRVSTLDFKNIPLDEEQ--------------QVDFKKD-----FFG---KE
SYN_ACET2       SDAEGAGQMFKVTTLDINNPPRKEDG--------------TVDFSKD-----FFD---RE
SYN_DESHY       SDAEGAGEMFRVTTLDLDALPRTEEG--------------RIDYAKD-----FFG---KE
SYN_FUSNN       SDAEGAGEMFRITTLDLNKVPKKENG--------------EVDFSKD-----FFG---KS
SYN_UREP2       NDAEGAGETFSIQKF----------------------------DNEE-----FFG---KQ
SYN_UREPA       NDAEGAGETFSIQKF----------------------------DNEE-----FFG---KQ
SYN_MYCGE       NDCEGAGETFVIK------------------------------DSET-----FFN---KT
SYN_MYCPN       NDCEGAGETFELK------------------------------QGKE-----FFN---KT
SYN_MYCPE       NDAEGAGENFYVDSK----------------------------TVKN-----FFG---KN
SYN_MYCGA       NDSEGAGESFEVISP----------------------------NDPN-----YFG---KK
SYN_MYCCT       NDAEGAGEAFLVTTRE------------------------DADYEKD-----FFA---KK
SYN_MYCMS       NDAEGAGEAFLVTTRE------------------------DADYEKD-----FFG---KK
SYN_MESFL       NDAEGAGEQFVVTVNE------------------------DKDYAND-----FFG---KK
SYN_MYCPU       NDGEGAGETFIVDSE-----------------------------DKE-----PFFGNNVK
SYN_MYCMO       NDGEGAGESFVVDDE-----------------------------SKD-----FFF--NKK
SYN_MYCH7       NDGEGAGEVFIVDDE-----------------------------NKD-----FFN---KK
SYN_MYCH2       NDGEGAGEVFIVDDE-----------------------------NKD-----FFN---KK
SYN_MYCHJ       NDGEGAGEVFIVDDE-----------------------------NKD-----FFN---KK
SYN_AYWBP       NDGEGVGELFQITTLNLEVLPQTKNIPNAFKPVNENTSKKGIDYKKD-----FFG---KK
SYN_ONYPE       NDGEGAGELFQLTTLNLEALPQTKNIPNASKLADETISKNEIDYQKD-----FFG---KK
SYN_ACHLI       NDGEGAGAMFKVTTLDMNKPPRNED--------------SSIDYSKD-----FFG---RE
SYN_GEOSL       SDCEGAGELFRVTTLDPSAPPMADGA---------------VDFSQD-----FFA---AQ
SYN_GEOMG       SDCEGAGEMFRVTTLDPAAPPLLEGE---------------VDFSRD-----FFA---AQ
SYN_GEOUR       NDCEGAGELFRVTTLDMARPPLAAGE---------------VDYSGD-----FFA---QA
SYN_PELPD       SDCEGAGELFRVTTLDAASPPLLEGR---------------PDFGQD-----FFG---QK
SYN_BORBU       NDGEGAGEMFRVSTLKFNKLNNALSNI---------------DFKDD-----FFGK---E
SYN_BORBP       NDGEGAGEMFRVSTLKFNKPNNSLSNI---------------DFKDD-----FFGK---E
SYN_BORAP       NDGEGAGEMFRVSTLKFNKPNNDLGNI---------------DFKDD-----FFGK---E
SYN_NOSS1       SDCEGAGELFSVTSLDLKQIPRTENQG--------------IDYSQD-----FFAK---P
SYN_SYNY3       SDCEGAGDLFKVTTLDLQRVPKN-GEG--------------IDYSQD-----FFGK---Q
SYN_MICAN       NDCEGAGELFTVTSLDLKK-------P--------------ANFAED-----FFGK---R
SYN_THEEB       SDCEGAGELFTVTTLDLTQPPKTPEGK--------------IDFSQD-----FFGR---R
SYN_SOLUE       SDAEGAGSMFQVTTLDLQSP-----KP--------------ADFTGD-----FFGK---H
SYN_TREDE       SDCEGAGEMFHVTTFDIEETVKKALKEKKDPDSF------KIDYSQD-----FFGK---Q
SYN_TREPA       SDCEGAGELFRVTTFDPVRIAREAHAAGAAGNPY------ALTYADD-----FFGK---A
SYN_BACFN       SDCEGAGQMFQVTTMNLYDLKKDANGS--------------IVYDDD-----FFGK---Q
SYN_BACFR       SDCEGAGQMFQVTTMNLYDLKKDENGS--------------IVYDDD-----FFGK---Q
SYN_BACTN       SDCEGAGQMFQVTTMNLYDLKKDERGS--------------ISYDDD-----FFGK---Q
SYN_PHOV8       SDCEGAGQMFQVTTKNLYDLKKDENGA--------------IIYDDD-----FFGK---Q
SYN_PARD8       SDCEGAGQMFQVTTKNLYDLKKDENGS--------------IIYEDD-----FFGK---Q
SYN_PORGI       SDCEGAGQMFQVTTLNPDSLPRTEEGQ--------------VDYRKD-----FFGR---H
SYN_DESVV       SDCEGAGEMFRVTTLPVEGSPTPASGN---------------RYEND-----FFGK---E
SYN_DESVH       SDCEGAGEMFRVTTLPVEGSATPASGN---------------RYEND-----FFGK---E
SYN_DESAG       SDCEGAGEMFRVTTLPAVGASAPAEGS---------------VFDGD-----FFGK---E
SYN_LAWIP       SDCEGAGEMFRVTTAHSSNDSQSSD---------------------N-----FFGK---E
SYN_PARUW       SDCEGAGKMFQVTTLDQNNPARTPEGR--------------VDYTQD-----FFGK---P
SYN_ACTP2       SDTEGAGEMFRVSTLDLENLPRTEEGK--------------VDFSQD-----FFGKE---
SYN_HAEDU       SDTEGAGEMFRVSTLDLENLPRTEHGK--------------IDYSQD-----FFGKE---
SYN_HISS2       SDTEGAGEMFRVSTLDLENLPRTDKGA--------------VDFSQD-----FFGKE---
SYN_HAES1       SDTEGAGEMFRVSTLDLENLPRTDKGA--------------VDFSQD-----FFGKE---
SYN_PASMU       SDTEGAGEMFRVSTLDLENLPRDDKGA--------------VDFSQD-----FFGKE---
SYN_HAEIN       SDTEGAGEMFRVSTLDLENLPRSENGK--------------VDFSQD-----FFGKE---
SYN_HAEIG       SDTEGAGEMFRVSTLDLENLPRSENGK--------------VDFSQD-----FFGKE---
SYN_HAEIE       SDTEGAGEMFRVSTLDLENLPRSENGK--------------VDFSQD-----FFGKE---
SYN_MANSM       SDTEGAGEMFRVSTLDLENLPRDDKGA--------------VDFSQD-----FFGKE---
SYN_ACTSZ       SDTEGAGEMFRVSTLDLENLPRTQAGT--------------VDFNQD-----FFGKE---
SYN_YERPA       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_YERPN       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_YERP3       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_YERPE       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_YERPS       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_YERPP       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_YERE8       SDTEGAGEMFRVSTLDLENLPRTDTGA--------------VDFSED-----FFGKE---
SYN_SERP5       SDTEGAGEMFRVSTLDLENLPRTDKGA--------------VDFSQD-----FFGKE---
SYN_PECAS       SDTEGAGEMFRVSTLDMENLPRTEQGK--------------VDFSKD-----FFGKE---
SYN_PHOLL       ADTEGAGEMFRVSTLDLQNLPLTDKGE--------------VDFNQD-----FFGRE---
SYN_SALTI       SDTEGAGEMFRVSTLDLENLPRNDQGR--------------VDFDKD-----FFGKE---
SYN_SALPA       SDTEGAGEMFRVSTLDLENLPRNDQGR--------------VDFDKD-----FFGKE---
SYN_SALCH       SDTEGAGEMFRVSTLDLENLPRNDQGR--------------VDFDKD-----FFGKE---
SYN_SALTY       SDTEGAGEMFRVSTLDLENLPRNDQGR--------------VDFDKD-----FFGKE---
SYN_ECOLC       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_SHIF8       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_SHIFL       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECOL5       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECO24       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_SHIBS       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECOLI       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECOUT       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_SHISS       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECOHS       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECOL6       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ECO57       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_SHIDS       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_KLEP7       SDTEGAGEMFRVSTLDLENLPRNDQGK--------------VDFDKD-----FFGKE---
SYN_ENT38       SDTEGAGEMFRVSTLDLENLPRTPEGK--------------VDFDKD-----FFGKE---
SYN_SODGM       SDTEGAGEMFRVSTLDLENLPRTPDGK--------------VNYDED-----FFGKE---
SYN_BAUCH       FNCEGAGEMFRVSTLDLENLPYTSKGK--------------INYEKD-----FFGKE---
SYN_SHEHH       SDTEGAGEMFRVSTLDLENLPRTDKGT--------------VDYSED-----FFGKE---
SYN_SHEPA       SDTEGAGEMFRVSTLDLENLPRTDKGT--------------VDYAED-----FFGKE---
SYN_SHESH       SDAEGAGEMFRVSTLDMENLPRNDEGK--------------VDYSED-----FFGKE---
SYN_SHELP       SDCEGAGEMFRVSTLDLENLPRTDDGK--------------VDFSED-----FFGKE---
SYN_SHESM       SDCEGAGEMFRVSTLDMENLPRTSDGK--------------VDYDKD-----FFGKE---
SYN_SHESR       SDCEGAGEMFRVSTLDMENLPRTSDGK--------------VDYDKD-----FFGKE---
SYN_SHESA       SDCEGAGEMFRVSTLDMENLPRTSDGK--------------VDYDKD-----FFGKE---
SYN_SHEON       SDCEGAGEMFRVSTLDMENLPRTSDGK--------------VDYDKD-----FFGKE---
SYN_SHEB5       SDCEGAGEMFRVSTLDMENLPRTDAGK--------------VDYDKD-----FFGKE---
SYN_SHEB8       SDCEGAGEMFRVSTLDMENLPRTEAGK--------------VDYDKD-----FFGKE---
SYN_SHEB9       SDCEGAGEMFRVSTLDMENLPRTDAGK--------------VDYDKD-----FFGKE---
SYN_SHEPC       SDCEGAGEMFRVSTLDMENLPRTSEGK--------------VDYDKD-----FFGKE---
SYN_SHESW       SDCEGAGEMFRVSTLDMENLPRTSEGK--------------VDYDKD-----FFGKE---
SYN_SHEDO       SDCEGAGEMFRVSTLDMENLPRTDAGK--------------VDYDKD-----FFGKE---
SYN_SHEFN       SDCEGAGEMFRVSTLDMENLPRTAEGK--------------VDYDKD-----FFGKE---
SYN_SHEAM       SDCEGAGEMFRVSTLDMENLPRTDAGK--------------VDYDQD-----FFGKE---
SYN_VIBVY       SDCEGAGEMFRVSTLDLANLPRTESGD--------------VDFNED-----FFGKE---
SYN_VIBVU       SDCEGAGEMFRVSTLDLANLPRTESGD--------------VDFNED-----FFGKE---
SYN_VIBPA       SDAEGAGEMFRVSTLDMENLPRTDAGK--------------VDYNED-----FFGKE---
SYN_ALIF1       SDAEGAGEMFRVSTLDHANLPLDDKGN--------------VDYDKD-----FFGKE---
SYN_VIBCH       SDAEGAGEMFRVSTLDMENLPRTDAGK--------------VDYNQD-----FFGKE---
SYN_PHOPR       SDCEGAGEMFRVSTLDMANVPMTDAGE--------------VDYDKD-----FFGKE---
SYN_AERHH       SDTEGAGEMFRVSTLDMENLPRTPAGK--------------VDYDKD-----FFGKE---
SYN_PSET1       SDCEGAGEMFRVSTLDMQNLPLTDKGE--------------VDYSED-----FFGKE---
SYN_PSEA6       SDTEGAGEMFRVSTLDMMNVPTTEQGQ--------------VDFSQD-----FFGKE---
SYN_IDILO       SDCEGAGEMFRVSTLDMLNIPKTDKGE--------------VDYSED-----FFGKE---
SYN_COLP3       SDCEGAGEMFRVSTLDMENLPRNDEGK--------------VDYNKD-----FFGKE---
SYN_PSYIN       SDAEGAGEMFRVSTLDLENLPRNDTGA--------------IDYKKD-----FFGKE---
SYN_HAHCH       SDCEGAGELFRVSTLDMANLPKTDSGK--------------IDYSKD-----FFGKE---
SYN_XYLFT       SDAEGAGQMFRVSTLDLVNLPRTETGG--------------IDFSHD-----FFGKE---
SYN_XYLFA       SDAEGAGQMFRVSTLDLVNLPRTETGG--------------IDFSHD-----FFGKE---
SYN_XANC5       SDAEGAGQMFRVSTLDMVNLPRDASGN--------------VDFSRD-----FFGKE---
SYN_XANAC       SDAEGAGQMFRVSTLDMVNLPRDASGA--------------VDFSRD-----FFGKE---
SYN_XANOR       SDAEGAGQMFRVSTLDMVNLPRDATGN--------------VDFSRD-----FFGKE---
SYN_XANOM       SDAEGAGQMFRVSTLDMVNLPRDATGN--------------VDFSRD-----FFGKE---
SYN_XANC8       SDAEGAGQMFRVSSLDMVNLPRTAQGE--------------VDFSRD-----FFGKE---
SYN_XANCP       SDAEGAGQMFRVSSLDMVNLPRTAQGE--------------VDFSRD-----FFGKE---
SYN_MYXXD       SDAEGAGQMFRVSTLDAVNPPRTSDGK--------------IDWHKD-----FFGKE---
SYN_BUCAI       LNTEGAGEMFRVSTLDMENIPKNLDSS--------------VDFKKD-----FFGKE---
SYN_BUCAP       LNTEGTGEMFRVSTMDMRNIPKKINGS--------------VDFKKD-----FFGKE---
SYN_BUCBP       LNSEGAGDMFKVSILDLNNIPKNKNGK--------------INFKKD-----FFGKE---
SYN_WIGBR       LNTEGSGEMFKVSTFDFKKIPLNKNKL--------------INYRKD-----FFGKR---
SYN_BLOPB       CDTEGSSKMFCVSTSETQKILNNPNEK--------------LHHTHDTTYD-FFSKK---
SYN_BLOFL       SDTEGNSKMFYVSELLNN---SKKSQN--------------ICNSHQKIPELFFGKE---
SYN_DESPS       SDCEGAGEMFQVAATGKD--------------------------------GHFFGAP---
SYN_RHOBA       SDCEGAGEMFRVTTLNLEKLAGSNR-----------------PFDTK---QDFFQKP---
SYN_BACSU       SAPEGTTELFATKYFDED------------------------------------------
SYN_BACVZ       SAPEGTTELFATKYFDED------------------------------------------
SYN_BACLD       SAPEGTTELFATKYFDED------------------------------------------
SYN_GEOTN       SAPEGTTELFHTKYFDED------------------------------------------
SYN_ALKHC       SAPEGTTELFHTKYFDED------------------------------------------
SYN_BACSK       SSPEGTSELFHTKYFDED------------------------------------------
SYN_STAES       SAPEGTSELFHTKYFDED------------------------------------------
SYN_STAEQ       SAPEGTSELFHTKYFDED------------------------------------------
SYN_STAHJ       SAPEGTSELFHTKYFDED------------------------------------------
SYN_STAAS       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAW       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAT       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAE       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAC       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAA3       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAA8       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAA2       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAN       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAM       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAA9       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAA1       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAAB       SAPEGTSELFLTKYFDQD------------------------------------------
SYN_STAAR       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_STAS1       SAPEGTSELFHTKYFDQD------------------------------------------
SYN_OCEIH       SSAEGTTELFHTKYFDEE------------------------------------------
SYN_LISMF       SAPEGTTELFHTKYFDED------------------------------------------
SYN_LISIN       SAPEGTTELFHTKYFDED------------------------------------------
SYN_LISMO       SAPEGTTELFHTKYFEED------------------------------------------
SYN_LISW6       SAPEGTTELFHTKYFEED------------------------------------------
SYN_STRR6       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRP2       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRPN       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRSV       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRT1       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRT2       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRTD       NAAEDSTELFETDYFGTP------------------------------------------
SYN_STRPC       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRPB       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRP1       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRPD       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRPM       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRPG       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRP3       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRP8       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRP6       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRPF       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRA5       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRA3       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRA1       NAAEDSTELFETDYFGKP------------------------------------------
SYN_STRS2       NAAEDSTELFETDYFGQL------------------------------------------
SYN_STRSY       NAAEDSTELFETDYFGQL------------------------------------------
SYN_STRMU       NAAENTTDLFETDYFGEP------------------------------------------
SYN_LACLM       NAAENTTELFETDYFGNP------------------------------------------
SYN_LACLS       NAAENTTELFETDYFGNS------------------------------------------
SYN_LACLA       NAAENTTELFETDYFGNS------------------------------------------
SYN_ENTFA       SAPEGTTELFETDYFGQP------------------------------------------
SYN_LACSS       SAPEGTTELFHIEYFDND------------------------------------------
SYN_LACP3       SAPEGTTELFETDYFDKK------------------------------------------
SYN_LACS1       SAPEGTTELFHTEYFDRD------------------------------------------
SYN2_LACPL      SAPEGTTELFHTEYFDRD------------------------------------------
SYN1_LACPL      SAPEGTTELFKTDYFGQD------------------------------------------
SYN_LIMRD       SAPEGTTELFETDYFDRS------------------------------------------
SYN_LACJO       SAPEGTTQLFHVEYFNND------------------------------------------
SYN_LACGA       SAPEGTTQLFHVEYFNND------------------------------------------
SYN_LACH4       SAPEGTTQLFHVDYFDHD------------------------------------------
SYN_LACDA       SAPEGTTELFHIDYFNHD------------------------------------------
SYN_THET8       SAVEGTTELFEVELFDGEK-----------------------------------------
SYN_THET2       SAVEGTTELFEVELFDGEK-----------------------------------------
SYN_DEIGD       NAAEGTTELFEIDLFGEDK-----------------------------------------
SYN_DESRM       AACEGTTTLFELDYHG-EK-----------------------------------------
SYN_PELTS       TACEGTTNLFEIDYHG-EK-----------------------------------------
SYN_SYMTH       TAAEGGATLFETTYVNDEP-----------------------------------------
SYN_ROSS1       CAAEGTTNLFATPYFDLGT-----------------------------------------
SYN_ROSCS       CAAEGTTNLFATPYFDLGT-----------------------------------------
SYN_CHLAA       TAAEGTTNLFATDYFDLGK-----------------------------------------
SYN_KORVE       AACEGTSTLFPVDYFG-DP-----------------------------------------
SYN_THEAC       TAVEGGSTLFKVDFFGEP------------------------------------------
SYN_THEVO       TAVEGGSTLFKVDFFGEP------------------------------------------
SYN_PYRHO       GAVEGGATLFKLKYFDKY------------------------------------------
SYN_PYRFU       GAVEGGATLFKLKYFDKY------------------------------------------
SYN_PYRAB       GAVEGGATLFKLKYFDKV------------------------------------------
SYN_THEKO       GAVEGGATLFKLKYFDRY------------------------------------------
SYN_LEPIN       SVGESAGTLFSTEYFDLGN-----------------------------------------
SYN_LEPIC       SVGESAGTLFSTEYFDLGN-----------------------------------------
                   *.    *                                                  

SYN_CLOB1       ANLTVSGQLSAETFALAFRNVYTFGPTFRAENSNTARHASEFWMIEPEMAFAELTDYLDN
SYN_CLOBH       ANLTVSGQLSAETFALAFRNVYTFGPTFRAENSNTARHASEFWMIEPEMAFAELTDYLDN
SYN_CLOBL       ANLTVSGQLSAETFALAFRNVYTFGPTFRAENSNTARHASEFWMIEPEMAFAELTDYLDN
SYN_CLOK5       TNLTVSGQLSAETMALAFRNVYTFGPTFRAEDSNTSRHAAEFWMIEPEMAFAELKDYMDT
SYN_CLOAB       ANLTVSGQLSAETFALAFRNVYTFGPTFRAEESNTTRHAAEFWMIEPEMAFAELSDYLDT
SYN_CLONN       ANLTVSGQLEAEIYALAFRNVYTFGPTFRAENSNTARHASEFWMIEPEMAFAELKDYMDV
SYN_CLOTE       AKLTVSGQLSAESYALAFGNVYTFGPTFRAENSNTARHASEFWMIEPEMAFADLTDYMDV
SYN_CLOPE       TNLTVSGQLNAECFALAFRNIYTFGPTFRAENSNTVKHAAEFWMIEPEMAFADLIDDMEV
SYN_BACAN       TNLTVSGQLNAEAYALAFRDVYTFGPTFRAENSNTTRHAAEFWMVEPEIAFAELGDVMNL
SYN_BACCZ       TNLTVSGQLNAEAYALAFRDVYTFGPTFRAENSNTTRHAAEFWMVEPEIAFAELGDVMNL
SYN_BACC1       TNLTVSGQLNAEAYALAFRDVYTFGPTFRAENSNTTRHAAEFWMVEPEIAFAELGDVMNL
SYN_BACHK       TNLTVSGQLNAEAYALAFRDVYTFGPTFRAENSNTTRHAAEFWMVEPEIAFAELGDVMNL
SYN_BACCR       TNLTVSGQLNAEAYALAFRDVYTFGPTFRAENSNTTRHAAEFWMVEPEIAFAELGDVMNL
SYN_BACCN       TNLTVSGQLPAEAYALAFRDVYTFGPTFRAENSNTTRHAAEFWMVEPEIAFAELEDVMDL
SYN_ALKOO       TSLTVSGQLQGEAYALAFRNIYTFGPTFRAENSHTARHASEFWMIEPEIAFADLQDNMEL
SYN_ALKMQ       TSLTVSGQLAAEAYALAFKKVYTFGPTFRAENSNTARHASEFWMIEPEIAFADLQDNMEL
SYN_ACET2       TNLTVSGQLEGETYSMAFRNIYTFGPTFRAENSNTARHAAEFWMVEPEIAFADLEDDMEL
SYN_DESHY       TNLTVSGQLNAETYCMAFRNVYTFGPTFRAENSNTARHAAEFWMIEPEIAFADLQDDMEL
SYN_FUSNN       TNLTVSGQLNLETFCAAFRNVYTFGPTFRAEYSNTARHASEFWMVEPEIAFGDIFALMEL
SYN_UREP2       THLSVTGQLQAEAYAQAFGNVYTFGPTFRAEKSHTNRHLAEFWMIEPEMAFVDLKGMQDI
SYN_UREPA       THLSVTGQLQAEAYAQAFGNVYTFGPTFRAEKSHTNRHLAEFWMIEPEMAFVDLKGMQDI
SYN_MYCGE       TFLTVSGQFGAEAFAQAFKKVFTFGPTFRAEKSHTNRHLSEFWMIEPEIAFANLKDLMQL
SYN_MYCPN       TYLTVSGQFGAECYAQAFKKVFTFGPTFRAEKSHTSRHLSEFWMIEPEVAFANLKDLIKL
SYN_MYCPE       ASLTVSGQMHAEAYAQSYKRVYTFGPTFRAEKSNTNRHVSEFWMVEPEIAFCNLEQLMYL
SYN_MYCGA       ASLTVSGQFAAEAYAQGFKRVFTFGPTFRAEKSHTSKHLSEFWMIEPEVSLMDLDKLTIL
SYN_MYCCT       ASLTVSGQLHAEAFAQAFKKVYTFGPTFRAENSNTAKHAAEFWMIEPEVAFADLKDNIQL
SYN_MYCMS       ASLTVSGQLHAEAFAQAFKKVYTFGPTFRAENSNTAKHAAEFWMIEPEVAFADLKDNIQL
SYN_MESFL       ASLTVSGQLNGEAFAQAFKNIYTFGPTFRAENSHTTKHASEFWMIEPEVAFADINDNIQL
SYN_MYCPU       ATLGVTGQLHAEAYALGLQKVYTFAPTFRAENSNTKKHAAEFWMVEPEVAFFTLKELIQM
SYN_MYCMO       ATLGVTGQLHAEAYALGFSKVYTFAPTFRAENSNTTKHAAEFWMMEPEVAFFDLKDLIKM
SYN_MYCH7       TTLGVTGQLHAEAYALGFKKVYTFAPTFRAERSNTRRHAAEFWMIEPEVAFFTLEQIIEL
SYN_MYCH2       TTLGVTGQLHAEAYALGFKKVYTFAPTFRAERSNTRRHAAEFWMIEPEVAFFTLEQIIEL
SYN_MYCHJ       TTLGVTGQLHAEAYALGFKKVYTFAPTFRAERSNTRRHAAEFWMIEPEVAFFTLEQIIEL
SYN_AYWBP       VFLTVTGQLEAEAMALGLNKVYTFGPTFRSEKSNTTRHAAEFWMLEPEMAFCDLSQNLKV
SYN_ONYPE       VFLTATGQLEAEAMALGLNKVYTFGPTFRAEKSNTPRHAAEFWMLEPEMAFCNLSQNLKV
SYN_ACHLI       ANLTVTGQLEGEAYAHAFRNIYTFGPTFRAENSNTTTHASEFWMIEPEIAFADLNDNMEL
SYN_GEOSL       AGLTVSGQLEGELFAQAFSDIYTFGPTFRAENSNTPRHAAEFWMIEPEMAFADLRDDAAL
SYN_GEOMG       AGLTVSGQLEGELFAQAFSDIYTFGPTFRAENSNTPRHAAEFWMIEPEMAFADLMADAAL
SYN_GEOUR       TGLTVSGQLEGELFAQAFSDIYTFGPTFRAENSNTARHAAEFWMIEPELAFADLMADAAL
SYN_PELPD       TGLTVSGQLEGELFALAFSDIYTFGPTFRAENSNTPRHAAEFWMIEPEMAFADLADDAAL
SYN_BORBU       AFLSVTGQLHGEAYAMALSKIYTFGPTFRAENSNTTRHASEFWMIEPEMAFYKLNDNIAL
SYN_BORBP       AFLSVTGQLHGEAYAMALSKIYTFGPTFRAENSNTTRHASEFWMIEPEMAFYKLNDNISL
SYN_BORAP       AFLSVTGQLHGEAYAMALSKIYTFGPTFRAENSNTTRHASEFWMIEPEMAFYKLNDNITL
SYN_NOSS1       TYLTVSGQLEAEVMAMAFSNVYTFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDL
SYN_SYNY3       AYLTVSGQLEAEVMALAFQNVYTFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDRQW
SYN_MICAN       AYLTVSGQLQAEVMAMALSNVYTFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDQDL
SYN_THEEB       AYLTVSGQLEAEIMATAFTNVYTFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLRGDMEL
SYN_SOLUE       TYLTVSGQLEAEIFAHAFANVYTFGPTFRAENSNTPRHLAEFYMIEPEMAFCDLKDNQDL
SYN_TREDE       ANLTVSGQLEGETYATALSRIYTFGPTFRAENSNTSRHLAEFWMVEPEMSFFTIKENMEL
SYN_TREPA       ARLTVSGQLQGEAYALALTRIYTFGPTFRAENSNTSRHLSEFWMVEPEIAFARITDCMDV
SYN_BACFN       ASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPRHLAEFWMIEPEVAFNEIQENMDL
SYN_BACFR       ASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPRHLAEFWMIEPEVAFNEIQENMDL
SYN_BACTN       ASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPRHLAEFWMIEPEVAFNDIADNMDL
SYN_PHOV8       ASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPRHLAEFWMIEPEVAFNDITDNMDL
SYN_PARD8       ASLTVSGQLEGELAATALGQIYTFGPTFRAENSNTPRHLAEFWMIEPEVAFNDITDNMEL
SYN_PORGI       TSLTVSGQLEGEMAAMALGGIYTFGPTFRAENSNTPRHLAEFWMIEPEVAFLEIEDNMDL
SYN_DESVV       CNLTVSGQLEAETLALGLGKVYTFGPTFRAENSNTPRHAAEFWMIEPEVAFADLEEDMNL
SYN_DESVH       CNLTVSGQLEAETLALGLGKVYTFGPTFRAENSNTPRHAAEFWMIEPEVAFADLEEDMNL
SYN_DESAG       CSLTVSGQLEAEIMAQSLGKVYTFGPTFRAENSNTPRHAAEFWMVEPEMAFADLEDDMQL
SYN_LAWIP       CSLTVSGQLEAECLAMGLGKVYTFGPTFRAENSNTPRHAAEFWMVEPEMAFADLQDNMNL
SYN_PARUW       TYLTVSGQLNGEIYACALSDVYTFGPTFRAENSNTSRHLAEFWMIEPEMAFADLNDNMDC
SYN_ACTP2       SFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEFAFATLADNAKL
SYN_HAEDU       AFLTVSGQLNGESYACALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEFAFATLADNAKL
SYN_HISS2       SFLTVSGQLNGESYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEIAFATLADNAKL
SYN_HAES1       SFLTVSGQLNGESYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEIAFATLADNAKL
SYN_PASMU       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEIAFATLADNAKL
SYN_HAEIN       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLADNAKL
SYN_HAEIG       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLADNAKL
SYN_HAEIE       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLADNAKL
SYN_MANSM       SFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLADNAKL
SYN_ACTSZ       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEIAFATLADNAKL
SYN_YERPA       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_YERPN       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_YERP3       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_YERPE       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_YERPS       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_YERPP       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_YERE8       AFLTVSGQLNGETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFASLDDVAGL
SYN_SERP5       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMIEPEVAFADLEDIAEL
SYN_PECAS       AFLTVSGQLNGETYACALSNVYTFGPTFRAENSNTARHLAEFWMIEPEVAFASLDDVAAL
SYN_PHOLL       AFLTVSGQLNGEAYACALSKVYTFGPTFRAENSNTSRHLAEFWMLEPEIAFANLNDAATL
SYN_SALTI       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFADLEDNARL
SYN_SALPA       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFADLEDNARL
SYN_SALCH       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFADLEDNARL
SYN_SALTY       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFADLEDNARL
SYN_ECOLC       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_SHIF8       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_SHIFL       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECOL5       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECO24       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_SHIBS       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECOLI       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECOUT       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_SHISS       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECOHS       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECOL6       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_ECO57       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_SHIDS       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGL
SYN_KLEP7       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDVAGL
SYN_ENT38       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDVAGL
SYN_SODGM       AFLTVSGQLNGESYACALSKIYTFGPTFRAENSNTSRHLAEFWMAEPEVAFATLDDAAGL
SYN_BAUCH       AFLTVSGQLNGESYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFANLTDIAIL
SYN_SHEHH       SFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFANLDDAAKL
SYN_SHEPA       SFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFANLDDAAKL
SYN_SHESH       SFLTVSGQLNAETYASALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLDDVAGL
SYN_SHELP       SFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLNDVAGL
SYN_SHESM       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFATLSDIANL
SYN_SHESR       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFATLSDIASL
SYN_SHESA       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFATLSDIASL
SYN_SHEON       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFATLNDIAGL
SYN_SHEB5       AFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFANLNDIAGL
SYN_SHEB8       AFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFANLNDIAGL
SYN_SHEB9       AFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFANLNDIAGL
SYN_SHEPC       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFATLSDIAGL
SYN_SHESW       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFATLSDIAGL
SYN_SHEDO       SFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLDDAAKL
SYN_SHEFN       SFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLDDAAEL
SYN_SHEAM       AFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLNDIAGL
SYN_VIBVY       TFLTVSGQLNGEAYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLNDIAKL
SYN_VIBVU       TFLTVSGQLNGEAYACALSKIYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLNDIAKL
SYN_VIBPA       TFLTVSGQLNAEAYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFAELDDVAKL
SYN_ALIF1       TFLTVSGQLNAETYACALSKVYTFGPTFRAENSHTSRHLAEFWMVEPEVAFATLDDVAKL
SYN_VIBCH       TFLTVSGQLNAEAYACAISKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLNTVAKL
SYN_PHOPR       TFLTVSGQLNAETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLDDAAKL
SYN_AERHH       TFLTVSGQLNVETYACALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEVAFADLEDNAAL
SYN_PSET1       AFLTVSGQLNGETYASAMSKIYTFGPTFRAENSNTSRHLAEFWMVEPELAFADLEDIAKL
SYN_PSEA6       TFLTVSGQLNGETYATAMSKIYTFGPTFRAENSNTSRHLAEFWMIEPEVAFADLSDIAQL
SYN_IDILO       AFLTVSGQLNVESYACSLSKVYTFGPTFRAENSNTSRHLSEFWMVEPELAFATLDDVAGL
SYN_COLP3       TFLTVSGQLNVETYCNALSKVYTFGPTFRAENSNTTRHLAEFWMVEPEIAFADLSDAADL
SYN_PSYIN       TFLTVSGQLNAETYACALSKVYTFGPTFRAENSHTTRHLAEFWMVEPEIAFADLADAAQL
SYN_HAHCH       TFLTVSGQLNVEAYCLAMSKVYTFGPTFRAENSNTSRHLAEFWMIEPEIAFADLNDDADL
SYN_XYLFT       TFLTVSGQLNVEAYALALSKVYTFGPTFRAENSHTPRHLAEFWMIEPEIAFADLAEDARV
SYN_XYLFA       TFLTVSGQLNVEAYALALSKVYTFGPTFRAENSHTPRHLAEFWMIEPEIAFADLAEDARV
SYN_XANC5       TFLTVSGQLNVEAYCLALSKVYTFGPTFRAENSHTTRHLAEFWMIEPEIAFADLAEDARL
SYN_XANAC       TFLTVSGQLNVEAYCLALSKVYTFGPTFRAENSHTTRHLAEFWMIEPEIAFADLAEDARL
SYN_XANOR       TFLTVSGQLNVEAYCLALSKVYTFGPTFRAENSHTTRHLAEFWMIEPEIAFADLAEDARL
SYN_XANOM       TFLTVSGQLNVEAYCLALSKVYTFGPTFRAENSHTTRHLAEFWMIEPEIAFADLAEDARL
SYN_XANC8       TFLTVSGQLNVEAYCLALSKVYTFGPTFRAENSHTTRHLAEFWMIEPEIAFADLAEDARL
SYN_XANCP       TFLTVSGQLNVEAYCLALSKVYTFGPTFRAENSHTTRHLAEFWMIEPEIAFADLAEDARL
SYN_MYXXD       AYLTVSGQLNAEAYALAMSKVYTFGPTFRAENSNTTRHLAEFWMIEPEVAFADLNEDANL
SYN_BUCAI       SFLTVSGQLNLETYACSLSKVYTFGPTFRAENSNTGRHLAEFWMLEVESAFTDLNDISDF
SYN_BUCAP       SFLTVSGQLNLEAYACSLSKVYTFGPTFRAENSNTSRHLAEFWMLEIESSFCNLDEILIF
SYN_BUCBP       AFLTVSGQLTLETYACSLSKVYSFGPIFRAENSNTRRHLSEFWMLEVETAFSNLCDIIKF
SYN_WIGBR       TFLTVSGQLHIESYACSLSKVYTFGPTFRAENSNTSRHLAEFWMVEIEIAFAKLNDIILL
SYN_BLOPB       AFLTVSGQLNAEAYACALSKVYTFGPTFRAEYSNTNRHLAEFWMIEPEAAFMTLDDIIIL
SYN_BLOFL       AFLTVSGQLNVESYACALTKVYTFGPTFRAEHSNTNRHLAEFWMLEPEMAFTDLNIIIKI
SYN_DESPS       AGLTVSGQLQAEVYATALGDVYTFGPTFRAENSNTSRHLAEFWMIEPEMAFCDLQGDMEV
SYN_RHOBA       THLTVSGQLEAETYATALSRVYTFGPTFRAENSNTSRHLAEFWMVEPEAAFYDLNDNMQL
SYN_BACSU       AYLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTKRHLIEFWMIEPEMAFVEFEENLQV
SYN_BACVZ       AFLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTKRHLIEFWMIEPEMAFVEFEENLEV
SYN_BACLD       AYLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTKRHLIEFWMIEPEMAFVEFNENLEV
SYN_GEOTN       AYLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFYEFEDNLRL
SYN_ALKHC       AFLSQSGQLYMEAAALAFGRVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFVEFEESLEI
SYN_BACSK       AYLSQSGQLYAEAGAMALGRVFTFGPTFRAEKSKTRRHLIEFWMIEPEMAFVEHEESLEI
SYN_STAES       AFLSQSGQLYMEAAAMAHGRVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFTNHAESLEI
SYN_STAEQ       AFLSQSGQLYMEAAAMAHGRVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFTNHAESLEI
SYN_STAHJ       AFLSQSGQLYMEAAAMAHGRVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFTNHVESLEV
SYN_STAAS       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFINHAESLEI
SYN_STAAW       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAT       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAE       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAC       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAA3       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAA8       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAA2       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAN       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAM       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAA9       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAA1       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAB       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAAR       AFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEI
SYN_STAS1       AFLSQSGQLYMEAAAMAHGRVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFCEHAQSLEV
SYN_OCEIH       AYLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFVEHEESLQI
SYN_LISMF       AFLSQSGQLYMEAAAMAFGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFYKLEDSLQV
SYN_LISIN       AFLSQSGQLYMEAAAMAFGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFYKLEDSLQV
SYN_LISMO       AFLSQSGQLYMEAAAMAFGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFYKLEDSLQV
SYN_LISW6       AFLSQSGQLYMEAAAMAFGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFYKLEDSLQV
SYN_STRR6       AYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSYLTHDESLDL
SYN_STRP2       AYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSYLTHDESLDL
SYN_STRPN       AYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSYLTHDESLDL
SYN_STRSV       AYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSYLTHDESLDL
SYN_STRT1       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHDESLDL
SYN_STRT2       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHDESLDL
SYN_STRTD       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHDESLDL
SYN_STRPC       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRPB       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRP1       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRPD       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRPM       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRPG       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRP3       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRP8       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRP6       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRPF       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRA5       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRA3       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRA1       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRS2       AYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRSY       AYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSFLSHEESLDL
SYN_STRMU       AFLSQSGQLYLEAGAMAFGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYPFMSHEQSLDL
SYN_LACLM       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYPFVTHDESLDI
SYN_LACLS       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYPFVTHDESLDI
SYN_LACLA       AFLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYPFVTHDESLDI
SYN_ENTFA       AFLSQTGQLYAEAGAMAFGKVFTFGPTFRAEKSKTRRHLTEFWMIEPEMAYTTHEESLDI
SYN_LACSS       AYLTQSGQLYAEAGAMAFGKVFTFGPVFRAEKSKTRRHLTEFWMIEPEMAFMEQDESLEV
SYN_LACP3       AYLSQSGQLYAEAGAMAYGKVFTCGPVFRAEKSKTRRHLTEFWMIEPEMAFCHQEESLKV
SYN_LACS1       AYLSQSGQLYEEAGAMAYGKVFSFGPTFRAEKSKTRRHLIEFWMIEPEMAFMHQEESLEI
SYN2_LACPL      AYLSQSGQLYAEAGALAYGKVFTFGPTFRAEKSKTRRHLIEFWMIEPEMAFMHQEQSLEV
SYN1_LACPL      AYLSQSGQLYGEAGAMAFGKIFTFGPTFRAEKSKTRRHLTEFWQLEPEMAWMHQDESLEV
SYN_LIMRD       AFLSQSGQLYAEAGAMALGRVYTMGPTFRAEKSKTRRHLMEFWMIEPEMAWMHQDESLKI
SYN_LACJO       AYLSQSGQLYGEAGAMAYGKIFTFGPTFRAEESKGRRHMTEFWMMEPEMAWMHQDESLDI
SYN_LACGA       AYLSQSGQLYGEAGAMAYGKIFTFGPTFRAEESKGRRHMTEFWMMEPEMAWMHQDESLDI
SYN_LACH4       AYLSQSGQLYGEAGAMAFGKIFTFGPTFRAEESKGRRHMTEFWMMEPEMAWMHQDESLDL
SYN_LACDA       AYLSQSGQLYGEVGAEAFGKIFTFGPTFRAEASKTRRHLTEFWMMEPEMAWMHQDESLDL
SYN_THET8       AYLSQSGQLYAEAGALAFAKVYTFGPTFRAERSKTRRHLLEFWMVEPEVAFMTHEENMAL
SYN_THET2       AYLSQSGQLYAEAGALAFAKVYTFGPTFRAERSKTRRHLLEFWMVEPEVAFMTHEENMAL
SYN_DEIGD       AYLSQTGQLHAEAGALAFGKVYTFGPTFRAEKSKTRRHLLEFWMVEPEVAPATHQDNMDL
SYN_DESRM       AYLSQSGQLYNEASAMAVGRMYCFGPTFRAEKSKTRRHLMEFWMIEAEAAFFDFEDNMKL
SYN_PELTS       AYLSQSGQLYNEATAMALGRVYCFGPTFRAEKSKTRRHLMEFWMVEAEAAFFDFEDNIRL
SYN_SYMTH       AYLSQSGQLHVEATAMALGRVYTFGPTFRAEKSKTRRHLIEFWMVEPEAAYFTHEDNMRL
SYN_ROSS1       AYLGQTGQLYVEAGMMSFGKVYCFGPTFRAEKSKTRRHLTEFWMIEPEVAFALHEDNLAL
SYN_ROSCS       AYLGQTGQLYVEAGMMSFGKVYCFGPTFRAEKSKTRRHLTEFWMIEPEVAFALHDDNLAL
SYN_CHLAA       AYLAQTGQLYVEAGMMAFGKVYCFGPTFRAEKSKTRRHLTEFWMIEPEVAFADHEDNMRL
SYN_KORVE       AFLTQSGQLYIEATAMALGKVYSFGPTFRAEKSKTRRHLTEFWMVEPEVAFAELDDIMKL
SYN_THEAC       IYLNQSAQFYLETMIYSLEKVFTIAPSFRAEKSRTRRHLTEYWHAEAEVAWIDNNEMMDI
SYN_THEVO       IFLNQSAQFYLETMIYSLEKVFTIAPSFRAEKSRTRRHLTEYWHAEAEVAWIDNREMMDV
SYN_PYRHO       AYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKV
SYN_PYRFU       AYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKV
SYN_PYRAB       AYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKV
SYN_THEKO       AYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKV
SYN_LEPIN       AYLAQTGQLYLETAIFAHNKVFCYGPTFRAEKSKTRRHLTEFWMVEAEVAFATHAENLKL
SYN_LEPIC       AYLAQTGQLYLETAIFAHNKVFCYGPTFRAEKSKTRRHLTEFWMVEAEVAFATHAENLKL
                  *  :.*:  *    .   ::   * **:* *.   *  *::  : * .          

SYN_CLOB1       AEDMVKFVINYVMENAPEEMAFFNSFVDK--------------------------GLFDR
SYN_CLOBH       AEDMVKFVINYVMENAPEEMAFFNSFVDK--------------------------GLFDR
SYN_CLOBL       AENMVKFVINYVMENAPEEMAFFNSFVDK--------------------------GLFDR
SYN_CLOK5       AEELVKYIINYVLEKAPEEMAFFNSFIDK--------------------------SLFDR
SYN_CLOAB       AEEMVKYIINFVMENAPEEMEFFNTRIDK--------------------------GLFDR
SYN_CLONN       AEQMVKYIINYVRENAPEEMEFFNKFIDK--------------------------GLLER
SYN_CLOTE       AEEMVKYIINYVLENAPEEMNFFNSFIDK--------------------------DLFKR
SYN_CLOPE       AENMLKYVIKYVMDECPEEIAFFNQFVDK--------------------------GLLER
SYN_BACAN       TEDMLKYAMKYVLEHAPEEMEFFNSFVDK--------------------------TVLER
SYN_BACCZ       TEDMLKYAMKYVLEHAPEEMEFFNSFVDK--------------------------TVLER
SYN_BACC1       TEDMLKYAMKYVLEHAPEEMEFFNSFVDK--------------------------TVLER
SYN_BACHK       TEDMLKYAMKYVLEHAPEEMEFFNSFVDK--------------------------TVLER
SYN_BACCR       TEDMLKYAMKYVLEHAPEEMEFFNSFVDK--------------------------TVLER
SYN_BACCN       TEDMLKYAMKYVLEHAPEEMEFFNKFVDK--------------------------TVLER
SYN_ALKOO       AEEMLKYIINYVMENAPEEMEFFNSFVDK--------------------------GLLDR
SYN_ALKMQ       AEDMLKYMIRYVMEQAPEELEFFNQFVDK--------------------------GLIDR
SYN_ACET2       AEDMLKYIINYCLENAPEEMEFFNNFIDN--------------------------TLLDR
SYN_DESHY       AEEMMKYLISYVLEHAPEEMAFFNEFVDK--------------------------TLFDR
SYN_FUSNN       AEAMVKYIIKYVMDNCPEEMEFFNSFIEK--------------------------GLFDK
SYN_UREP2       VEDLVKHVIKAVLEKNQQELEFLAQRNDE--------------------------NLIKK
SYN_UREPA       VEDLVKHVIKAVLEKNQQELEFLAQRNDE--------------------------NLIKK
SYN_MYCGE       IQNLIKFLIKKVMENASDELNVLAKQFSN--------------------------DIISN
SYN_MYCPN       IESTVKTVIKQVMQKAKQELDFLEKQFDV--------------------------KLMER
SYN_MYCPE       IEEFVKYLIRFILKNCKDEMTFLNKLSNN--------------------------TLSEK
SYN_MYCGA       IEQCVKHAIYYLFDYAKPELEWCNENLEP--------------------------GLIDK
SYN_MYCCT       IQDMVKYIINYIFKHNRRELEFCNEHLED--------------------------GLIDK
SYN_MYCMS       IQDMVKYIINYIFKHNRRELEFCNEQLEN--------------------------GLIDK
SYN_MESFL       MQDMLKSVVGYVLEKNMTELEFLQEQLEP--------------------------GLIDK
SYN_MYCPU       SEEMLKYVIKKVLEKRRDELVFLDTHIKP--------------------------GLIQS
SYN_MYCMO       SDDMLRQVIKRTVEAHPHEFEFFEKN-KP--------------------------GLLKN
SYN_MYCH7       AVKLLQKVIKSVIIRNKDEFIFLEKAGDK--------------------------NLRKR
SYN_MYCH2       AVKLLQKVIKSVIIRNKDEFIFLEKAGDK--------------------------NLRKR
SYN_MYCHJ       AVKLLQKVIKSVIIRNKDEFIFLEKAGDK--------------------------NLRKR
SYN_AYWBP       AQEMLQFVISKCLEQNYQDIEFLDKTEKN--------------------------GLIEE
SYN_ONYPE       AQEMLQFVIAKCLEQNYQDIEFLDKTEKN--------------------------CLIEE
SYN_ACHLI       IERMVKYVTSYVLEHAKEEMAFFDKFVEK--------------------------GLLTK
SYN_GEOSL       AEDFFRYLCRHVLDNCAEDMAFFNEHVDR--------------------------GLLAR
SYN_GEOMG       AEEFFRYLCRHVLDACGEDMAFFNDHIDK--------------------------GLIAR
SYN_GEOUR       AEDFLKFLCRHVLDNCGEDMAFFNEQIDK--------------------------GLLER
SYN_PELPD       AEKFVRYLCRFALEECAEEMAFFDRQIEK--------------------------GLLER
SYN_BORBU       AEDLLKYLLSSILNECSQDMDFLENYIEK--------------------------GLIKK
SYN_BORBP       AEDLLKYLLSSILNECSQDMDFLENYIEK--------------------------GLIKK
SYN_BORAP       AEDLLKYLLSSILNECSQDMDFLENYIEK--------------------------GLIKK
SYN_NOSS1       AEAFLKHIFNHVLEKCPEDMEFFNQRIDN--------------------------TVLAT
SYN_SYNY3       AEEFLKYIFKFVLEKCPEDMEFFDQRIDN--------------------------TVLAT
SYN_MICAN       AEAFLKYIFKFVLENCPEDLQFFNERIDK--------------------------TVLST
SYN_THEEB       AEAFLQFVFRYVLDHCPEDMAFFQERIDH--------------------------SVMAT
SYN_SOLUE       AEAFLKSQVEYVVNACGPDLDFLAKWYDP--------------------------ELRKT
SYN_TREDE       AEEFIVYLLKWALEKCKEDLEFFDSRIKK--------------------------GLIEM
SYN_TREPA       AEEFLAYLLRAALKDCAQDIAFLDERAAQHARSARGDTPLAARSTARTPPVRTPGQLTRM
SYN_BACFN       AEEFIKYCVRWALDNCADDVKFLNDMFDK--------------------------GLIER
SYN_BACFR       AEEFIKYCVRWALDNCADDVKFLNDMFDK--------------------------GLIER
SYN_BACTN       AEEFIKYCVKWALDNCADDVKFLNDMFDK--------------------------GLIER
SYN_PHOV8       AEDFIKYCVQWALDNCYDDVKFLNDMFDK--------------------------GLIER
SYN_PARD8       AEEFIKYCVQWALDNCMEDIKFLNDMFDK--------------------------ELIAR
SYN_PORGI       AEEFIKYCVQWALDNCMDDISFLSEHFDK--------------------------ELIDR
SYN_DESVV       AEDMTRTVVRRILDRCAADLDLFNRFVDT--------------------------TLVER
SYN_DESVH       AEDMTRTVVRRILDRCAADLDLFNRFVDT--------------------------TLVER
SYN_DESAG       AEDMVKYVISHVMKHCAADLDLFCKFVDK--------------------------ELSAR
SYN_LAWIP       AEELTCEVIRKVLQCHIDDIMLLDKYVQP--------------------------GLIKA
SYN_PARUW       AEDYLKYILKYVLDNCQEDMEFFNKHVAT--------------------------DLISR
SYN_ACTP2       AEDMLKYVFKAVLEERKDDMQFFAKHIDK--------------------------DVITR
SYN_HAEDU       AEDMLKYVFKAVLEERKDDMQFFAKHIDK--------------------------EVITR
SYN_HISS2       AEDMLKYVFRAVLNEREDDLKFFEKHVDK--------------------------NVITR
SYN_HAES1       AEDMLKYVFRAVLNEREDDLKFFEKHVDK--------------------------NVITR
SYN_PASMU       AEDMLKYVFRAVLEERKDDLKFFEKHVDN--------------------------DVISR
SYN_HAEIN       AEDMLKYVFRAVLAERKDDLQFFEKHVDK--------------------------DVITR
SYN_HAEIG       AEDMLKYVFRAVLAERKDDLQFFEKHVDK--------------------------DVITR
SYN_HAEIE       AEDMLKYVFRAVLAERKDDLQFFEKHVDK--------------------------DVITR
SYN_MANSM       AEDMLKYVFNAVLKERMDDLKFFEKHIDK--------------------------DVINR
SYN_ACTSZ       AEDMLKYVFNAVLTERRDDLEFFSKHVDK--------------------------DVITR
SYN_YERPA       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_YERPN       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_YERP3       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_YERPE       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_YERPS       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_YERPP       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_YERE8       AEKMLKYVFQAVLNERADDMKFFAERVDK--------------------------DAVDR
SYN_SERP5       AEKMLKYVFQAVLNERMDDMQFFAERVDK--------------------------DAIDR
SYN_PECAS       AENLLKYVFQAVLNERADDMAFFAERVDK--------------------------EAVTR
SYN_PHOLL       AENMLKYVFKAALAERADDLQFFAERVDK--------------------------DVITR
SYN_SALTI       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAIAR
SYN_SALPA       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAIAR
SYN_SALCH       AEAMLKYVFNAVLEERADDMKFFAERVDK--------------------------DAIAR
SYN_SALTY       AEAMLKYVFNAVLEERADDMKFFAERVDK--------------------------DAIAR
SYN_ECOLC       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_SHIF8       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_SHIFL       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECOL5       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECO24       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_SHIBS       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECOLI       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECOUT       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_SHISS       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECOHS       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECOL6       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_ECO57       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_SHIDS       AEAMLKYVFKAVLEERADDMKFFAERVDK--------------------------DAVSR
SYN_KLEP7       AEAMLKYVFKAVLEERADDMQFFAERVDK--------------------------DAIDR
SYN_ENT38       AEAMLKYVFKAVLEERADDMKFFAERVDS--------------------------DAVAR
SYN_SODGM       AEAMLKYVFQAVLTERADDMQFFAERIDK--------------------------EAINR
SYN_BAUCH       AEKMLKYIFNAILIERVDDINFFAEQINK--------------------------NIIKR
SYN_SHEHH       AEDMLKYCFKAVLEERRDDLEFFAQRVEK--------------------------TAIER
SYN_SHEPA       AEDMLKYCFKAVLEERRDDLEFFAQRVEK--------------------------TAIER
SYN_SHESH       AEQMLKFCFKAVLEERRDDLEFFAQRVDK--------------------------TVIDR
SYN_SHELP       AERMLKYCFRAVLNERRDDLEFFAQRVDK--------------------------TVIER
SYN_SHESM       AEGMLKYAFNAVLAERMDDLQFFAQHVDK--------------------------TVIER
SYN_SHESR       AEGMLKYAFDAVLAERMDDLQFFAQHVDK--------------------------TVIER
SYN_SHESA       AEGMLKYAFNAVLAERMDDLQFFAQHVDK--------------------------TVIER
SYN_SHEON       AEGMLKYAFNAVLTERMDDLQFFAQHVDK--------------------------TVIER
SYN_SHEB5       AEAMLKYAFNAVLTERMDDLTFFAQHVDK--------------------------TVIDR
SYN_SHEB8       AEAMLKYAFNAVLTERMDDLTFFAQHVDK--------------------------TVIDR
SYN_SHEB9       AEAMLKYAFNAVLTERMDDLTFFAQHVDK--------------------------TVIDR
SYN_SHEPC       AEAMLKYAFNAVLTERMDDLQFFAQHVDK--------------------------TVIER
SYN_SHESW       AEAMLKYAFNAVLTERMDDLQFFAQHVDK--------------------------TVIER
SYN_SHEDO       AEDMLKYAFNAVLNERMDDLSFFNERVDK--------------------------TVIER
SYN_SHEFN       AEKMLKFAFSAVLEERMDDLNFFNERVDK--------------------------TVIER
SYN_SHEAM       AESMLKYCFNAVLQERMDDMKFFAERVDG--------------------------SVIDR
SYN_VIBVY       AEDMLKYVFAAVLEERRDDLEFFASRIDK--------------------------DVINR
SYN_VIBVU       AEDMLKYVFAAVLEERRDDLEFFASRIDK--------------------------DVINR
SYN_VIBPA       AEDMLKYVFKAVLEERRDDLEFFAQRIDK--------------------------QAITR
SYN_ALIF1       AEDMLKYVFEAVLAERRDDLEFFASRIDK--------------------------QAITR
SYN_VIBCH       AEDMLKYVFKAVLAERRDDLEFFNDRINN--------------------------EVIAR
SYN_PHOPR       AEDMLKYVFKAVLEERRDDLEFFAQRINK--------------------------EAITR
SYN_AERHH       AEAMLKYVFNAVLAERRDDLEFFAQHVDK--------------------------DAIGR
SYN_PSET1       AEQMLKYVFKAVLEERRDDMEFFAQRVEK--------------------------TAITR
SYN_PSEA6       SEDLLKYVFKAVLAERADDMAFFAQRINK--------------------------DAITR
SYN_IDILO       AEAMLKYVFKAVLEERPDDMAFFAERINS--------------------------DAISR
SYN_COLP3       AEEMLKYVFKAVLEERPDDMAFFQQRVDK--------------------------TVLDR
SYN_PSYIN       AEDMLKYVFNAVLTERADDMAFFAQRVDK--------------------------EAITR
SYN_HAHCH       AERFLKHMFKVVLDERSDDMAFFAERINP--------------------------DVVSR
SYN_XYLFT       AEQFLKFLFKTVLEERDDDLAFITERVEK--------------------------TTISK
SYN_XYLFA       AEQFLKFLFKTVLEERTDDLAFITERVEK--------------------------TTISK
SYN_XANC5       AEQFLKYLFRAVLDERGDDLAFLAERVDK--------------------------NAITK
SYN_XANAC       AEQFLKYLFRAVLDERGDDLAFLAERVDK--------------------------NAIAK
SYN_XANOR       AEQFLKYVFRAVLDERGDDLAFLAERVDK--------------------------NAISK
SYN_XANOM       AEQFLKYVFRAVLDERGDDLAFLAERVDK--------------------------KAISK
SYN_XANC8       AEQFLKYLFRAVLDERGDDLAFLAERVDK--------------------------NAISK
SYN_XANCP       AEQFLKYLFRAVLDERGDDLAFLAERVDK--------------------------NAISK
SYN_MYXXD       AERFLKHVFKAVLNDCAPDLKFFEERVQK--------------------------GVIER
SYN_BUCAI       AECMLKYVCKSLLKKCITDINFLENYTNS--------------------------NIVDR
SYN_BUCAP       SEDMLKYICKSLLKYCINDIKFLKNYIDN--------------------------DIINR
SYN_BUCBP       SENMLKYAIGIILDKCVIDINFFRENVDE--------------------------KIFCR
SYN_WIGBR       AYNLLSNIFKKVLNKCLNDLIFLEKKLNI--------------------------NIIKK
SYN_BLOPB       AESLLKNIIRILLEKRSDDIKYLVDKINK--------------------------NIITI
SYN_BLOFL       ADSLLKDIVQTILEQCINDIEYCASHIKEY-------------------------NLIKR
SYN_DESPS       AEEMLKYVLADVLEHCVTDMNLFDKFISK--------------------------GIIER
SYN_RHOBA       AERFLKRVFSDCLSHCGEDMDFFNERIEK--------------------------GKIDQ
SYN_BACSU       QENYVSFIVQSVLKNCKIELNTLG-RDTSK------------------------------
SYN_BACVZ       QENYVAYIVQSVLEHCKIELNTLG-RDTSK------------------------------
SYN_BACLD       QENYVSFIVQSVLENCKIELNTLG-RDTSK------------------------------
SYN_GEOTN       QEEYVSYLVQSVLSRCQLELGRLG-RDVTK------------------------------
SYN_ALKHC       QENYVAYIVQSVLKHCAIELKTLG-RDTSV------------------------------
SYN_BACSK       QEQYVAHLAKAVLDHCQLELKQLG-RDVTK------------------------------
SYN_STAES       QEQYVSHIVQSVLNHCQLELKALD-RDTTK------------------------------
SYN_STAEQ       QEQYVSHIVQSVLNHCQLELKALD-RDTTK------------------------------
SYN_STAHJ       QEQYVSHVVKSVLKNCQLELKALD-RDTSK------------------------------
SYN_STAAS       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAW       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAT       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAE       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAC       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAA3       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAA8       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAA2       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAN       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAM       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAA9       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAA1       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAB       QEQYVTHVVKSVLENCKLELKILE-RDTSK------------------------------
SYN_STAAR       QEQYVTHVVKSVLENCKLELKMLE-RDTSK------------------------------
SYN_STAS1       QEQYVTHVVKSVLNHCKLELKALD-RDTSK------------------------------
SYN_OCEIH       QENYVSHIVQSVLTNCKLELSVLD-RDLSK------------------------------
SYN_LISMF       QENYVAFLVKAVLDNCRLELDRLG-RDVSH------------------------------
SYN_LISIN       QENYVAFLVKAVLDNCRLELDRLG-RDVSH------------------------------
SYN_LISMO       QENYVAFLVKAVLDNCRLELDRLG-RDVSH------------------------------
SYN_LISW6       QENYVAYLVKAVLDNCRLELDRLG-RDVSH------------------------------
SYN_STRR6       QEAYVKALLQGVLDRAPQALETLE-RDTEL------------------------------
SYN_STRP2       QEAYVKALLQGVLDRAPQALETLE-RDTEL------------------------------
SYN_STRPN       QEAYVKALLQGVLDRAPQALETLE-RDTEL------------------------------
SYN_STRSV       QEAYVKALIQGVLDRAPQALETLE-RDVEL------------------------------
SYN_STRT1       QEAYVKALIQGAIDRAPQALEILE-RDVDL------------------------------
SYN_STRT2       QEAYVKALIQGAIDRAPQALEILE-RDVDL------------------------------
SYN_STRTD       QEAYVKALIQGAIDRAPQALEILE-RDVDL------------------------------
SYN_STRPC       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRPB       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRP1       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRPD       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRPM       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRPG       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRP3       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRP8       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRP6       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRPF       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRA5       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRA3       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRA1       QEAYVKALIQGVLDRAPQALDILE-RDVEA------------------------------
SYN_STRS2       QEAYVKALIQGVIDRAPQALETLE-RDVDA------------------------------
SYN_STRSY       QEAYVKALIQGVIDRAPQALETLE-RDVDA------------------------------
SYN_STRMU       QEAYVKTLIQGVLDRAPQALGILE-RDTDL------------------------------
SYN_LACLM       QEAYVKALIQGVLDNAAYALETLE-RDTSM------------------------------
SYN_LACLS       QEAYVKALIQGVLDNAAYALETLE-RDTSM------------------------------
SYN_LACLA       QEAYVKALIQGVLDNAAYALETLE-RDTSM------------------------------
SYN_ENTFA       QEAYVKHLIKSVLKNQQYPLDVLE-RDTAL------------------------------
SYN_LACSS       QEKYVAYLVQNVIDHCAYELKLLD-RDIDQ------------------------------
SYN_LACP3       QERYVAYLVQSVLDNCAYPLHLLD-RDPEV------------------------------
SYN_LACS1       QERYVAYLVQSVLDNCQYPLQILG-RDTEV------------------------------
SYN2_LACPL      QERYIAFLVQGVIDHCQYALDILG-RDVET------------------------------
SYN1_LACPL      QEQLVAYLGQAVIDHCPHELAVLD-RDVAT------------------------------
SYN_LIMRD       QEQYIAYLVQDLIDHCARELEMVG-RSVES------------------------------
SYN_LACJO       QERYLAYMVKQVLENNEYELKILG-RDPEK------------------------------
SYN_LACGA       QERYLAYMVKQVLENNEYELRILG-RDPEK------------------------------
SYN_LACH4       QERYLAYMVKQVLDKNEYELKILG-RDPEK------------------------------
SYN_LACDA       QERFLSYVVGQVLEHCEYELSILG-RDVDK------------------------------
SYN_THET8       QEELVSFLVARVLERRSRELEMLG-RDPKA------------------------------
SYN_THET2       QEELVSFLVARVLERRSRELEMLG-RDPKA------------------------------
SYN_DEIGD       QERLVSFLVRRVLEECAAELAVLG-RDVAK------------------------------
SYN_DESRM       QEEMVYFIVQRVLERRRQDLELLG-RDISK------------------------------
SYN_PELTS       QEELVSYLVRRVLENNKKELELLR-RDTGR------------------------------
SYN_SYMTH       QEEMVTYVVRRVLERRSKELQLIG-RDTTL------------------------------
SYN_ROSS1       QERFVSAIVQRVLERRADDLATLE-RDTKP------------------------------
SYN_ROSCS       QEQFVSAIVQRVLERRADDLATLE-RDTKP------------------------------
SYN_CHLAA       QEEFVSAIVARVLERRRDDLQTLE-RDTTL------------------------------
SYN_KORVE       AEDFITHIVKSVLERRRDDLKTIE-RDLSK------------------------------
SYN_THEAC       EERMIYYIVSRVTEDNEDELKMLN-RDPEV------------------------------
SYN_THEVO       EENMIYYIIQRVIEENYDDLKLLG-RDPEA------------------------------
SYN_PYRHO       EEELVSYMVQRTLELRKKEIEMFR-DDLTT------------------------------
SYN_PYRFU       EEELVSYMVQRTLELRKKEIEMFR-DDLTT------------------------------
SYN_PYRAB       EEELVSYMVQRTLELRKKEIEMFR-DDLTT------------------------------
SYN_THEKO       EEELVSYMVQRTLELRKKEIELYRKDDIKT------------------------------
SYN_LEPIN       QEDFVKTVIKETVQNSFQDLKVLE-RDPAP------------------------------
SYN_LEPIC       QEDFVKTVIKETVQNSFQDLKVLE-RDPAP------------------------------
                                   .                                        

SYN_CLOB1       LDNVVN-SDFKRITYTEAVELLQKSGV--------KFDYE-VEWGIDLQTEHERYLTEQI
SYN_CLOBH       LDNVVN-SDFKRITYTEAVELLQKSGV--------KFDYE-VEWGIDLQTEHERYLTEQI
SYN_CLOBL       LDNVVN-SDFKRITYTEAVELLQKSGG--------KFDYE-VEWGIDLQTEHERYLTEQI
SYN_CLOK5       LNNVVN-SEFGRITYTEAVDILQKSGA--------SFQYP-VEWGIDLQTEHERYLTEKV
SYN_CLOAB       LHNVVN-SEFGRITYTEAVDILEKSGE--------KFEYP-VKWGIDLQTEHERYLTDKV
SYN_CLONN       LDNVVN-SDFARISYTEAVEILQKSGA--------EFEYP-VEWGIDLQTEHERYLTEQI
SYN_CLOTE       LDNVVN-SEFKRITYTEAVDLLQKSGE--------KFQYP-VEWGIDLQTEHERYITEKI
SYN_CLOPE       LNHVVN-SEFGKVTYTEAVKLLQESGK--------EFEYP-VEWGIDLQTEHERYLTEQI
SYN_BACAN       MNNVIN-SDFGRITYTEAIKVLQESGA--------DFKYP-VEWGIDLQTEHERYLSEEI
SYN_BACCZ       MNNVIN-SDFGRITYTEAIKVLQESGA--------DFKYP-VEWGIDLQTEHERYLSEEI
SYN_BACC1       MNNVIN-SDFGRITYTEAIKVLQESGA--------DFKYP-VEWGIDLQTEHERYLSEEI
SYN_BACHK       MNNVIN-SDFGRITYTEAIKVLQESGA--------DFKYP-VEWGIDLQTEHERYLSEEI
SYN_BACCR       MNNVIN-SDFGRITYTEAIKVLQESGA--------DFKYP-VEWGIDLQTEHERYLSEEI
SYN_BACCN       MNNVIN-SDFGRITYTEAIKVLQESGA--------DFKYP-VEWGIDLQTEHERYLSEQV
SYN_ALKOO       LNNVAT-SDFGRVTYTEAIEILQKSGE--------TFEYP-VAWGTDLQTEHERYLTEKV
SYN_ALKMQ       LNHVAN-SEFGKVTYTEAVKMLQESGE--------EFEYP-VEWGHDLQTEHERYLTEKV
SYN_ACET2       LNNIVS-SDFAHVTYTEAIDILSKADQ--------KFEYP-VKWGNDLQTEHERYLTEKV
SYN_DESHY       LDNIVN-SDFGRLTYTEAIEILQKEKE--------RFEFP-VEWGADLQTEHERFLTEQI
SYN_FUSNN       LNNVLN-NDFGRVTYTEAIEILEKSGK--------KFEFP-VKWGIDLQSEHERYLAEEY
SYN_UREP2       LQKVVE-SKFERIEYKDAVKILADAVK-----NGHQFENNEIFFGMDLGSEHERYMCETY
SYN_UREPA       LQKVVE-SKFERIEYKDAVKILADAVK-----NGHQFENNEIFFGMDLGSEHERYMCETY
SYN_MYCGE       LKTIISTKKFPIIEYSKALAILKESSDT----KKTNFELNDFSFGIDLKTEHERFLCEQY
SYN_MYCPN       LKQITSTKNFHVLEYTKALEILKTAQAS----GQANFEVQDFNFGLDLKTEHERFLCEQH
SYN_MYCPE       LLNAIS-HPFEKITYKKAIAILKSDVAN----KKVKFENESIYFGMDLNSEHEKYLCEKV
SYN_MYCGA       LNNVIN-NDFPRVEYREVIEILKKAVA-----EGVEFEVKDIHFGMDLKSEHERYICEKV
SYN_MYCCT       LNSVRN-SEFKVTTYTEAIEILKQAVA-----NGHKFEVSDIEFGLDLGTEHERYICEQV
SYN_MYCMS       LNNVRN-SEFKVTTYTEAIEILKQAVK-----DGHKFEVSDIEFGLDLGTEHERYICEQV
SYN_MESFL       ITGIVN-VEFKVNTYEEVLKTLQDAID-----KGHKFEENNIHFGLDLGTEHERFICEEV
SYN_MYCPU       LEDFLE-SNLEIIEYRKVIEILEKNKV--------FFEEQNIEFGMDLKTEHERFIAEKY
SYN_MYCMO       LNLFLN-NKLSILEYREAIKILEKVKD--------RFEDKNIFFGKDLATEHEKYLAEKH
SYN_MYCH7       LLQFCD-SQVTQISYEKAIELLLEHQE--------KFEEKDLFFGCDLKTEHERFLTEEI
SYN_MYCH2       LLQFCD-SQVTQISYEKAIELLLEHQE--------KFEEKDLFFGCDLKTEHERFLTEEI
SYN_MYCHJ       LLQFCD-SQVTQISYEKAIELLLEHQE--------KFEEKDLFFGCDLKTEHERFLTEEI
SYN_AYWBP       LQNIAEEKEFLTVKYEQALEILQKSNT--------KFENP-LFYGVDLATEHEKYLTEKH
SYN_ONYPE       LKNISEEKEFLTVKYEQALEILQKSNT--------KFENP-LFYGADLATEHEKYLTETH
SYN_ACHLI       LDNLLK-SSFKRITHEEAINILLKSNH--------KFENQ-PKHGEDLAKEHERYLTEKA
SYN_GEOSL       VEQVAG-SSFAMMEYGVAIEHLKRAAV--------PFEYP-VEWGLDLQTEHERYLTEQV
SYN_GEOMG       VEQVAN-SSFAIMEYGEAIERLKKATV--------TFEYP-VEWGLDLQTEHERYLTEQV
SYN_GEOUR       VRAVAD-SSFAVMEYTEAITHLKKAKV--------PFAFP-VEWGLDLQSEHERYITEKV
SYN_PELPD       VRRVAE-ADFVRMEYDEAIQRLQRSGV--------TFSYP-VEWGLDLQTEHERYITEKI
SYN_BORBU       LENVIN-SNFEVITYTKAIEILEN--------SKKNFEIK-PYWGIDLQTDHERYLTEET
SYN_BORBP       LENVIN-SNFEVITYTKAIEILES--------SKKNFEIK-PCWGIDLQTDHERYLTEEI
SYN_BORAP       LENVIN-SNFEVITYTKAIEILES--------SKKNFEIK-PYWGIDLQTEHERFLTEET
SYN_NOSS1       AENIIN-NQFERLTYTDAIKLLEK--------ADVKFEYP-VSWGLDLQSEHERYLAEQL
SYN_SYNY3       ADNIIN-NEFAWLTYSEAIKLLEK--------ADQKFEYP-VAWGVDLQSEHERYLAETV
SYN_MICAN       AENIVN-SEFGRITYSEAIELLEK--------ADRQFEFP-VEWGVDLQSEHERYLAEEL
SYN_THEEB       AEQMAT-QPFAHLSYSEAIQVLEK--------SGRAFEFP-VAWGLDLQSEHERYLAEEY
SYN_SOLUE       LDGLMN-ASFERITYTEAIDLLQR--------SGRSFEFP-TQWGSDMQSEHERYLTEEV
SYN_TREDE       LKNVVN-TPFTRLTYTEAIAELEK--------HIDRFEFK-PYWGCDLQSEHERFLTEEV
SYN_TREPA       LEDVAR-APATRLTYTEAIKLLEN--------SGRSFEFP-VRWGCDLQSEHECFLTEEV
SYN_BACFN       LEGVLK-EDFVRLPYTEGIKILEEAVA-----KGHKFEFP-VYWGVDLASEHERYLVEDH
SYN_BACFR       LEGVLK-EDFVRLPYTEGIKILEEAVA-----KGHKFEFP-VYWGVDLASEHERYLVEDH
SYN_BACTN       LQGVLK-DDFVRLPYTDGIKILEDAVA-----KGHKFEFP-VYWGVDLASEHERYLVEEH
SYN_PHOV8       LQGVLK-EEFVRLPYTEGIKILEEAVV-----KGHKFEFP-VYWGVDLASEHERYLVEEH
SYN_PARD8       LEGVLK-DSFVRLPYTEGIKILEEAVA-----KGHKFEFP-VYWGVDLASEHERFLVEDH
SYN_PORGI       LKFVLE-KPFVRLAYTEGIRILEEAVK-----NGVKFEFP-IYWGADLASEHERYLVEVH
SYN_DESVV       LRQIAD-EPFARCSYTEAIELLLK--------SGKKFEYP-VSFGLDLQTEHERYLAEEH
SYN_DESVH       LRQIAD-EPFARCSYTEAIELLLK--------SGKKFEYP-VSFGLDLQTEHERYLAEEH
SYN_DESAG       LENILA-HPFARVSYTEAIEILKA--------SGRKFEYP-AEWGADLQTEHERYLAEEH
SYN_LAWIP       LENIIA-KPFIRCSYHDAITILLS--------SHKDFEFP-VTFGLDLQSEHEKYLTEEY
SYN_PARUW       LEHVIN-TSFERASYTYAVRILEK--------ADKKFEYP-VKWGLDLQSEHERFLAEEF
SYN_ACTP2       LENFIA-APFAQVDYTDAIEILLKSGK--------EFEFP-VSWGIDLSSEHERFLAEEY
SYN_HAEDU       LENFIA-APFAQVDYSDAIEILLKSGK--------KFEFP-VAWGVDLSSEHERFLAEEH
SYN_HISS2       LKDFIN-SDFAQIDYTDAIDILLKSGK--------AFEFP-VSWGIDLSSEHERYLAEEY
SYN_HAES1       LKDFIN-SDFAQIDYTDAIDILLKSGK--------AFEFP-VSWGIDLSSEHERYLAEEY
SYN_PASMU       LENFIN-SDFAQIDYTDAIEVLLQSGK--------KFEFP-VSWGIDLSSEHERYLAEEH
SYN_HAEIN       LENFVN-SDFAQIDYTDAIDVLLKSGK--------KFEFP-VSWGIDLSSEHERFLAEEY
SYN_HAEIG       LENFVN-SDFAQIDYTDAIDVLLKSGK--------KFEFP-VSWGIDLSSEHERFLAEEY
SYN_HAEIE       LENFVN-SDFAQIDYTDAIDVLLKSGK--------KFEFP-VSWGIDLSSEHERFLAEEY
SYN_MANSM       LERFVA-SDFAQIDYTDAIDVLLKSGK--------KFEFP-VSWGIDLSSEHERYLAEEH
SYN_ACTSZ       LEHFVN-SPFAQIDYTDAIDVLVKSGK--------KFEFP-VSWGIDLSSEHERYLAEEH
SYN_YERPA       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEKH
SYN_YERPN       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEKH
SYN_YERP3       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEKH
SYN_YERPE       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEKH
SYN_YERPS       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEKH
SYN_YERPP       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEKH
SYN_YERE8       LQRFVT-SDFAQVDYTDAIEILLASGQ--------KFEND-VSWGIDLSSEHERYLAEQH
SYN_SERP5       LQRFVT-SDFAQVDYTEAVEILIASGQ--------TFENP-VSWGIDLSSEHERYLAEKH
SYN_PECAS       LEKFVS-SDFAQVDYTDAVEILLNCGQ--------QFENP-VYWGVDLSSEHERYLAEQH
SYN_PHOLL       LEKFIN-SDFAQIDYTSAIEILQNCGQ--------KFENP-VFWGVDLSSEHERYLAEKH
SYN_SALTI       LERFVS-TDFAQVDYTDAVAILERCGK--------TFENP-VFWGVDLSSEHERYLAEEH
SYN_SALPA       LERFVS-TDFAQVDYTDAVAILERCGK--------TFENP-VFWGVDLSSEHERYLAEEH
SYN_SALCH       LERFVS-TDFAQVDYTEAVAILERCGK--------TFENP-VFWGVDLSSEHERYLAEEH
SYN_SALTY       LERFVS-TDFAQVDYTDAVAILERCGK--------TFENP-VFWGVDLSSEHERYLAEEH
SYN_ECOLC       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_SHIF8       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_SHIFL       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECOL5       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECO24       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_SHIBS       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECOLI       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECOUT       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_SHISS       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECOHS       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECOL6       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_ECO57       LERFIE-ADFAQVDYTEAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_SHIDS       LERFIE-ADFAQVDYTDAVTILENCGR--------KFENP-VYWGVDLSSEHERYLAEEH
SYN_KLEP7       LQRFIT-ADFAQVDYTDAVTILENCGK--------QFENP-VYWGVDLSSEHERYLAEEH
SYN_ENT38       LERFVS-ADFAQVDYTDAVAILEKCGE--------KFENP-VYWGVDLSSEHERYLAEKH
SYN_SODGM       LKQFIS-ADFAQVDYTKAVEILQNCGQ--------TFENP-VSWGIDLSSEHERYLAEKH
SYN_BAUCH       LEQFIS-SNFAQIDYTEAIDILQNCKQ--------KFDHT-VFWGMDLFAEHERYLADKH
SYN_SHEHH       LEAFVS-SDFAQIDYTDAIEILKACDK--------DFEYD-VEWGIDLHSEHERYLAEEH
SYN_SHEPA       LENFVT-SDFAQIDYTDAIEILKACDK--------DFEYD-VEWGIDLHSEHERYLAEEH
SYN_SHESH       LESFVS-SDFAQVDYTDAVEILKSCGK--------KFEYP-VEWGIDLQSEHERYLAEEH
SYN_SHELP       LESFVN-SDFAQVDYTDAIEILKSCGK--------KFEFD-VEWGIDLQSEHERYLAEEH
SYN_SHESM       LQSFVS-SDFAQVDYTDAVEILQKCGR--------EFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHESR       LQSFVS-SDFAQVDYTDAVEILQKCGR--------EFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHESA       LQSFVS-SDFAQVDYTDAVDILQKCGR--------EFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHEON       LQSFVS-SDFAQVDYTDAVEILQKSGR--------EFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHEB5       LQSFVS-SDFAQVDYTDAVEILQNCGR--------TFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHEB8       LQSFVS-SDFAQVDYTDAVEILQNCGR--------TFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHEB9       LQSFVS-SDFAQVDYTDAVEILQNCGR--------TFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHEPC       LQSFVS-SDFAQVDYTDAVDILQKCGK--------TFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHESW       LQSFVS-SDFAQVDYTDAVDILQKCGK--------TFEFP-VSWGIDLSSEHERYLAEEH
SYN_SHEDO       LQAFVS-SDFAQVDYTDAVEILKNCGK--------KFEFA-VEWGIDLQSEHERYLAEEH
SYN_SHEFN       LQAFVS-SDFAQVDYTDAVEILKNCGK--------KFEFA-VEWGIDLQSEHERYLAEEH
SYN_SHEAM       LQSFVS-SDFAQVDYTDAVEILQNCGK--------TFEYP-VEWGIDLQSEHERYLAEEH
SYN_VIBVY       LEQFVS-SDFAQVDYTDAIQILLDSGR--------EFEFP-VEWGIDMSSEHERFLAEEH
SYN_VIBVU       LEQFVS-SDFAQVDYTDAIQILLDSGR--------EFEFP-VEWGIDMSSEHERFLAEEH
SYN_VIBPA       LEQFVS-SDFAQVDYTDAIQILLDSGR--------EFEFP-VEWGIDMSSEHERFLAEEH
SYN_ALIF1       LEQFVS-SDFAQVDYTDAIQILKDSGR--------DFEFD-VEWGIDMSSEHERYLAEEH
SYN_VIBCH       LEQFVE-SDFAQVDYTDAIEILKNCGK--------TFEFP-VEWGIDLASEHERFLAEEH
SYN_PHOPR       LEQFVT-SDFAQVDYTDAIQILQDSGR--------KFEFD-VEWGIDMSSEHERYLAEEH
SYN_AERHH       LERFVA-SDFAQIDYTDAIEVLKNCGK--------KFEFP-VSWGIDLSSEHERYLAEEH
SYN_PSET1       LEEFVE-KDFAQVDYTEAVEILKACGK--------KFEYA-VEWGVDLQSEHERYLAEEH
SYN_PSEA6       LEKVIE-QDFVRMDYTDAIEILQNCGK--------KFEFP-VSWGVDLSSEHERYLAEEH
SYN_IDILO       LEAIVN-NDFVHMDYTDAIEILKNCDR--------KFEYA-VEWGVDLQSEHERYLAEEH
SYN_COLP3       LNSVIN-TDFVRLDYTDAITILENCGK--------KFENQ-VSWGVDLNSEHERYLAEEH
SYN_PSYIN       LEKIVS-SEFVRMDYTDAIEILQNCGK--------EFEFP-VAWGVDLQSEHERYLAEVH
SYN_HAHCH       LENMVD-KEFVRIDYSEAIKILQNCGK--------KFEYP-VQWGLDLQSEHERYLAETH
SYN_XYLFT       LEGFIN-SPFERIEYTDAIKLLERSGK--------KFDFP-VEWGLDLQTEHERWLTEKH
SYN_XYLFA       LEGFIK-SPFERIEYTDAIKLLERSGK--------KFDFP-VEWGLDLQTEHERWLTEKH
SYN_XANC5       LEAFIN-APFEQIDYTEAVKLLQNSGK--------KFDFP-VEWGLDLQTEHERWLTEEH
SYN_XANAC       LEAFIN-APFEQIDYTDAVKLLQNSGK--------KFDFP-VEWGLDLQTEHERWLTEEH
SYN_XANOR       LEAFIN-APFEQIDYTDAVKLLQHAGK--------TFDFP-VEWGLDLQTEHERWLTEEH
SYN_XANOM       LEAFIN-APFEQIDYTDAVKLLQHAGK--------TFDFP-VEWGLDLQTEHERWLTEEH
SYN_XANC8       LEAFIN-APFEQIDYTEAVKLLQNSGK--------KFDFP-VEWGLDLQTEHERWLTEEH
SYN_XANCP       LEAFIN-APFEQIDYTEAVKLLQNSGK--------KFDFP-VEWGLDLQTEHERWLTEEH
SYN_MYXXD       MEKFIN-SSFERIDYTEAVEILKKAKK--------KFEFE-PEWGKDLQTEHERYLTEEH
SYN_BUCAI       LEKFLL-VDFVRIDYVEVINILLDSKI--------KFNNS-VFLGIDLSSEHERFLVENY
SYN_BUCAP       LKKFLS-VNFIRINYKDAIDILLNSKK--------KFDNV-VSFGVDLNAEHERFLVEKH
SYN_BUCBP       LKDFSS-KQFFQIEYKEAINILIKSNR--------FDHKV-MFIGMELSSDHERFLVEEY
SYN_WIGBR       LKNFIE-KKLIEVEYCEAIRILKNCEK--------NFRIQ-LKWGMDLSSEHERYLSDLY
SYN_BLOPB       LENFSE-IKFNHIEYTEAIKLLEICNR--------KFNNP-IHWGTDLFSEHEKYLSEEY
SYN_BLOFL       LENFLH-SKIIHIEYTDAIKLLSSCDK--------TFNNT-IYWGMDLFSEHEKYLSEEY
SYN_DESPS       LQSVLA-HDFARVTYTEAVDQLLASGQ--------KFDFA-VKWGIDLQSEHERYLTEQV
SYN_RHOBA       LKSVIE-KPFEHMTYTDAVERLLACDE--------KFEYP-VNWGTDLQAEHERYLT-SV
SYN_BACSU       -LEQ-IKAPFPRITYDEAIEFLKEKG------------FDDIEWGDDFGAPHETAIAEHY
SYN_BACVZ       -LEQ-IKAPFPRITYDKAIEFLKEKG------------FDDIEWGDDFGAPHETAIAESY
SYN_BACLD       -LEL-IKAPFPRITYDEAIQFLKEKG------------FDDIEWGDDFGAPHETAIAESY
SYN_GEOTN       -LEL-VKPPFPRLTYDEAIKLLHDKG------------FTDIEWGDDFGAPHETAIAESF
SYN_ALKHC       -LES-IQAPFPRISYDDAIKFLHEKG------------FDDIEWGDDFGAPHETAIAEHF
SYN_BACSK       -LEA-IKAPFPRITYDEALDLLKEKG------------FDDISWGDDFGSPHETAIAEHF
SYN_STAES       -LEK-VATPFPRISYDDAIEFLKKEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAEQ       -LEK-VATPFPRISYDDAIEFLKKEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAHJ       -LEK-VSAPFPRISYDDAIKFLKEEG------------FNDIEWGEDFGAPHETAIANHY
SYN_STAAS       -LEK-VATPFPRISYDDAIEFLKSEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAW       -LEK-VATPFPRISYDDAIEFLKSEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAT       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAE       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAC       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAA3       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAA8       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAA2       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAN       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAM       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAA9       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAA1       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAB       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAAR       -LEK-VATPFPRISYDDAIEFLKAEG------------FDDIEWGEDFGAPHETAIANHY
SYN_STAS1       -LEK-VTTPFPRITYADAVIFLKEQG------------FDDIEWGEDFGAPHETAIANHY
SYN_OCEIH       -LEK-IKAPFPRISYDEAIDMLKEKG------------FDDIEWGEDFGAPHETAIAESY
SYN_LISMF       -LEK-MVAPFPRITYTEAIERLHELG------------FDDIVWGDDFGAPHETAIADSF
SYN_LISIN       -LEK-MVAPFPRITYTEAIERLHELG------------FDDIVWGDDFGAPHETAIADSF
SYN_LISMO       -LEK-MVAPFPRITYTEAIERLHELG------------FDDIVWGDDFGAPHETAIADSF
SYN_LISW6       -LEK-MVAPFPRITYTEAIERLHELG------------FDDIVWGDDFGAPHETAIADSF
SYN_STRR6       -LKRYIAEPFKRITYDQAIDLLQEHEND------EDADYEHLEHGDDFGSPHETWISNHF
SYN_STRP2       -LKRYIAEPFKRITYDQAIDLLQEHEND------EDADYEHLEHGDDFGSPHETWISNHF
SYN_STRPN       -LKRYIAEPFKRITYDQAIDLLQEHEND------EDADYEHLEHGDDFGSPHETWISNHF
SYN_STRSV       -LKRYIAEPFKRVSYDEAIDLLQAHEND------EDADYEHLEHGDDFGSPHETWISNHF
SYN_STRT1       -LKKYIAEPFKRVSYDEAIDLLQAHEND------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRT2       -LKKYIAEPFKRVSYDEAIDLLQAHEND------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRTD       -LKKYIAEPFKRVSYDEAIDLLQAHEKD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRPC       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRPB       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRP1       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRPD       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRPM       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRPG       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRP3       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRP8       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRP6       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRPF       -LKRYITEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRA5       -LKRYIAEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRA3       -LKRYIAEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRA1       -LKRYIAEPFKRVSYDDAITLLQEHEAD------EDTDYEHLEHGDDFGSPHETWISNYF
SYN_STRS2       -LKRYIAEPFKRVAYDDAITLLQEHEAD------KDTDYEHIEHGDDFGSPHETWISNYF
SYN_STRSY       -LKRYIAEPFKRVAYDDAITLLQEHEAD------KDTDYEHIEHGDDFGSPHETWISNYF
SYN_STRMU       -LRKYIAQPFKRVSYDDAITLLQEHEED------EDTDYEHIEHGDDFGSPHETWISNYF
SYN_LACLM       -LQKYIDTPFKRVSYDDAIDLLQAHEND------EDTDYEHVEHGDDFGSPHETWISNYY
SYN_LACLS       -LQKYIDTPFKRVSYDDAIDLLQAHEND------DDTDYEHVEHGDDFGSPHETWISNYY
SYN_LACLA       -LQKYIDTPFKRVSYDAAIDLLQAHEND------EDTDYEHVEHGDDFGSPHETWISNYY
SYN_ENTFA       -LEKYVSEPFKRITYDDAIELLQKEE--------ANNDYDHIEWGEDFGSPHETFISNYY
SYN_LACSS       -LKKYTQTPYPRISYDKAVEMLQAAD-------------FDIKWGDDFGAPDETYLSDQF
SYN_LACP3       -LKQYTKLPYPRITYKQAIKMLQDAG-------------MDVKYGDDFGSPEETYLSDQF
SYN_LACS1       -LKRYTELPYPRISYDEAIELLQQSGK-----------FPDVKWGEDFGSPEETYLAEHF
SYN2_LACPL      -LKKYTKLPYPRISYDEAIELLKEND-------------FDVDWGVDFGSPEETFLADHF
SYN1_LACPL      -LQKYTKLPFPRVSYDDAITLLQANG-------------FDVDWGVDFGSPEETFLAEHF
SYN_LIMRD       -LKPFTELPYPRITYKEAIEILQKGG-------------FDVEYGADFGSPEETYLADQF
SYN_LACJO       -LRPTTEGNFTRLSYDDAIKMLQEAG-------------RDIKWGDDFGAPDEGYISEQF
SYN_LACGA       -LRPTTEGNFTRLPYDDAIKMLQEAG-------------RDIKWGDDFGAPDEGYISEQF
SYN_LACH4       -LRPTTEGNFVRLPYDDAVKMLQDAG-------------RDFKWGDDFGAPDEGYISEQY
SYN_LACDA       -LRPAAEGNYTRLSYDDAVKMLQEAG-------------KDFKWGDDFGAPDEAFLSEQF
SYN_THET8       -LEPAAEGHYPRLTYKEAVALVNRIAQE-------DPEVPPLPYGEDFGAPHEAALSRRF
SYN_THET2       -LEPAAEGHYARLTYKEAVALVNRIAQE-------DPEVPPLPYGEDFGAPHEAALSRRF
SYN_DEIGD       -LQPAAEGNYPRVTYTEALDIIRRHIAEGDLPPNVQPDVQPVEWGDDLGAPHETILGFHF
SYN_DESRM       -LEA-IKLPFPRLSYTEAVELLKSKG-------------EAFEWGEDFGAPHETIISENF
SYN_PELTS       -LTG-VTPPFPRMSYTDAVDFLNSKG-------------VDFKWGDDFGAPHETMISEHF
SYN_SYMTH       -LEK-VEPPFPRITYTEAVEMLKKLHKP-------GDEWEPIEWGEDFGAPHETVLTQQF
SYN_ROSS1       -LER-CVPPFPRITYDEALKLIAERHAD-------VEGCTPLEWGEDLGAPHETLIASLF
SYN_ROSCS       -LER-CVPPFPRITYDEALRLIAERYAE-------VEGCTPLEWGEDLGAPHETLIASMF
SYN_CHLAA       -LEQ-VRPPFPRITYDEAIELIAAHQGE-------VEGADPLPWGEDFGAPHETLIASKF
SYN_KORVE       -LEN-IDTPFPRISYDEAVQMLQEGHAK-------GELESRFEWGGDLGSPDETYISSKF
SYN_THEAC       -LKA-MKPPFPRIRYSEIIKVANSIG-------------LPLKYGDDLGADEERQITMKY
SYN_THEVO       -LRA-MKPPFPRVKYSDIIKVANEIG-------------MQLKYGDDLGADEERQITMRY
SYN_PYRHO       -LKN-TEPPFPRISYDEAIDILQSKG-------------VNVEWGDDLGADEERVLTEEF
SYN_PYRFU       -LKN-TEPPFPRISYDEAIDILQSKG-------------INVQWGDDLGADEERVLTEEF
SYN_PYRAB       -LKN-TEPPFPRISYDEAIEILQSKG-------------VKIEWGDDMGADEERVLTQEF
SYN_THEKO       -LKN-AVPPFPRISYDEAIDILQSKG-------------VNIEWGEDMGADEERVLTEEF
SYN_LEPIN       -LLAYLEKDFPVIDYTKALEILQSKG-------------EDIVWGDDINSEREQLLTVEF
SYN_LEPIC       -LLAYLEKDFPVIDYTKALEILQSKG-------------EDIVWGDDINSEREQILTVEF
                              :   :                         * ::    *  :    

SYN_CLOB1       F-KKPVFVTDYPKDIKAFYMRLNDDGK--TVAAADLLVPGVGEIIGGSQREERLDVLEKR
SYN_CLOBH       F-KKPVFVTDYPKDIKAFYMRLNDDGK--TVAAADLLVPGVGEIIGGSQREERLDVLEKR
SYN_CLOBL       F-KKPVFVTDYPKDIKAFYMRLNDDGK--TVAAADLLVPGVGEIIGGSQREERLDVLEKR
SYN_CLOK5       F-EKPIFVTDYPKAIKAFYMRENEDGK--TVAAADLLVPGVGEIVGGSQREERLSVLEKR
SYN_CLOAB       F-KKPLFVTDYPKDIKAFYMRINDDNK--TVAAADLLVPGVGEIIGGSQREERLAVLEKR
SYN_CLONN       Y-KKPVFVTDYPKDIKAFYMRMNDDNK--TVAAADLLVPGIGEIIGGSQREERLDILEAR
SYN_CLOTE       F-GKPVFVTDYPKDIKAFYMRLNEDNK--TVAAADLLVPGVGEIIGGSQREERLDVLEER
SYN_CLOPE       F-KKPVFVTDYPKDIKAFYMRLNEDGK--TVAAMDCLVPGIGEIIGGSQREERLDVLKAR
SYN_BACAN       F-KRPVFVTDYPKDIKAFYMRLNDDGK--TVAATDLLVPGIGELIGGSQREERMDVLVDR
SYN_BACCZ       F-KRPVFVTDYPKDIKAFYMRLNDDGK--TVAATDLLVPGIGELIGGSQREERMDVLVDR
SYN_BACC1       F-KRPVFVTDYPKDIKAFYMRLNDDGK--TVAATDLLVPGIGELIGGSQREERMDVLVDR
SYN_BACHK       F-KRPVFVTDYPKDIKAFYMRLNDDGK--TVAATDLLVPGIGELIGGSQREERMDVLVDR
SYN_BACCR       F-KRPVFVTDYPKDIKAFYMRLNEDGK--TVAATDLLVPGIGELIGGSQREERMDVLVDR
SYN_BACCN       F-KRPVFVTDYPKDIKAFYMRMNDDGK--TVAATDLLVPGIGELIGGSQREERMDVLVDR
SYN_ALKOO       F-KKPVFVTDYPKDIKAFYMKLNEDGK--TVAAMDLLVPGIGEIIGGSQREDNLALLEER
SYN_ALKMQ       F-KKPVFVMDYPKDIKAFYMRMNDDNK--TVAAMDLLVPGIGEIIGGSQREERLDVLTDR
SYN_ACET2       F-KKPVFVTDYPKDIKAFYMRLNDDNK--TVAAMDLLVPGVGEIIGGSQREERLDYLENR
SYN_DESHY       F-KKPVFVVDYPKDIKAFYMRLNDDQK--TVAAMDLLVPGVGEIIGGSQREERLDYLEKR
SYN_FUSNN       F-KKPVFVTDYPKDIKAFYMKLNEDNK--TVRAMDLLAPGIGEIIGGSQREDNYELLTKR
SYN_UREP2       H-QGPVFLQNYPKDIKAFYMKLNDDQQ--TVASTDLLIPGVGELVGGSQREDSYEKLLKR
SYN_UREPA       H-QGPVFLQNYPKDIKAFYMKLNDDQQ--TVASTDLLIPGVGELVGGSQREDSYEKLLKR
SYN_MYCGE       FQNQPLFVINYPKELKAFYMKTNTDNK--TVAAVDLLLPKIGEICGGSERESDLNQLKNR
SYN_MYCPN       FHNQPVFVINYPKDFKAFYMKQNADGR--TVGAVDLLFPQIGEICGGSEREGNLEKLVER
SYN_MYCPE       F-NKPLFIYDYPAEIKAFYMKMNADGT--TVGACDLLMPGIGEIVGGSERESDYTKLVKK
SYN_MYCGA       F-KRPVFVINYPKDVKAFYMKLNDDNQ--TVAATDLLAPGIGEICGGSQREDSYNKLLTR
SYN_MYCCT       N-KAPTFVTNYPKEIKAFYMKQNEDNK--TVAAVDLLVPGIGELVGGSQREDNYEKLIKR
SYN_MYCMS       N-KAPTFVTNYPKEIKAFYMKQNDDNK--TVAAVDLLVPGIGELVGGSQREDNYEKLIKR
SYN_MESFL       N-KCPTFVINYPKDIKSFYMKQNDDGK--TVAAVDLLVPGIGELCGGSEREANLDKILER
SYN_MYCPU       A-KGPVGVINYPKKLKAFYMYQNDDNE--TVAAFDLLVPGIGELVGGSQRENRYEKLEQR
SYN_MYCMO       I-QGPVAVINYPKSFKAFYMFQNEDNE--TVAAYDLLVPGIGEVIGGSKRETRYEKLVQR
SYN_MYCH7       F-HMPVVIINYPKNLKAFYMHQNEDGQ--TVAAFDLLVPGIGELIGGSQREVRYEKLLAR
SYN_MYCH2       F-HMPVVIINYPKNLKAFYMHQNEDGQ--TVAAFDLLVPGIGELIGGSQREVRYEKLLAR
SYN_MYCHJ       F-HMPVVIINYPKNLKAFYMHQNEDGQ--TVAAFDLLVPGIGELIGGSQREVRYEKLLAR
SYN_AYWBP       F-KKPVFIVDWPKEIKAFYMKNNPDQK--TVAAMDLLFPRVGELIGGSQREENLSVLIEK
SYN_ONYPE       F-KKPVFIVDWPKEIKAFYMKNNPDQK--TVAAMDLLVPRVGELIGGSQREENLSVLIEK
SYN_ACHLI       F-HGPVFVKDWPKDIKAFYMRLNDDQK--TVAAVDLLVPGSGELVGGSQREERLDVLLKR
SYN_GEOSL       V-GGPVFVVNYPQEIKAFYMRRNDDGR--TVAAMDLLVPKVGEIIGGSQREERYDLLESR
SYN_GEOMG       V-GGPVFVINYPKHIKAFYMRVNDDNK--TVAAMDLLVPKVGEIIGGSQREERLPVLEGR
SYN_GEOUR       V-GGPVFLVNYPKDIKAFYMRQNDDGK--TVAAMDLLVPKVGEIIGGSQREERLDLLLER
SYN_PELPD       V-GGPAFILNYPRDIKAFYMRSNPDNR--TVAAMDLLVPKVGEIIGGSQREERLDVLEAR
SYN_BORBU       F-KKPVVVIDYPKNFKAFYMKANKDNK--TVKGMDILVPKIGEIIGGSEREDDLQKLENR
SYN_BORBP       F-KKPIAVIDYPKNFKAFYMKINKDNK--TVKGMDILVPRIGEIIGGSEREDDLQKLENR
SYN_BORAP       F-KKPVVVIDYPKNFKAFYMKINKDNK--TVKGMDVLVPKIGEIIGGSEREDNLQKLENR
SYN_NOSS1       F-KKPVIVTDYPAQIKAFYMRLSDDEK--TVRAMDVLAPKIGEIIGGSQREERLDVLERR
SYN_SYNY3       F-KRPTIVTDYPKDIKAFYMRLNDDGK--TVAAMDILAPKIGEIIGGSQREERLDILTQR
SYN_MICAN       F-KKPVIVTNYPKTIKAFYMRLDDNNK--TVSAMDILAPKIGEIIGGSQREERLDVLIQR
SYN_THEEB       C-QRPVIVYDYPAAIKAFYMRLNDDGK--TVAAMDILAPKIGEIIGGSQREERFDVLQER
SYN_SOLUE       F-NKPVIVTDYPKDIKAFYMRGNDDGK--TVAAMDVLAPRIGEIIGGSQREERHDVLLQR
SYN_TREDE       Y-KGPVIVTNYPKEIKSFYMKLNEDGK--TVRAMDVLVPGLGEIIGGSEREENLDILQGR
SYN_TREPA       F-HGPVIVYDYPKEIKAFYMKLNADGT--TVRSMDLLVPGLGEIMGGSEREEQFEVLCAR
SYN_BACFN       F-KRPVILTDYPKEIKAFYMKQNEDGK--TVRAMDVLFPKIGEIIGGSERESDYNKLMTR
SYN_BACFR       F-KRPVILTDYPKEIKAFYMKQNEDGK--TVRAMDVLFPKIGEIIGGSERESDYNKLMMR
SYN_BACTN       F-KRPVILTDYPKEIKAFYMKQNEDGK--TVRAMDVLFPKIGEIIGGSEREADYNKLMTR
SYN_PHOV8       F-KRPVILTDYPKEIKAFYMKQNEDGK--TVRAMDVLFPKIGEIIGGSEREADYDKLMTR
SYN_PARD8       F-KRPVILTDYPKEIKAFYMKQNEDGK--TVRAMDVLFPKIGEIIGGSEREADYDKLMTR
SYN_PORGI       F-KTPVIMTDYPKEIKSFYMKLNDDGK--TVRGMDVLFPKIGEIIGGSEREADYDKLVAR
SYN_DESVV       F-GKPVIVYNYPKEIKAFYMRLNDDGR--TVAAMDVLVPRIGELIGGSQREERLDVLEAR
SYN_DESVH       F-GKPVIVYNYPKEIKAFYMRLNDDGR--TVAAMDVLVPRIGELIGGSQREERLDVLEAR
SYN_DESAG       F-KKPVAVYDYPKEIKAFYMRLNDDGK--TVAAMDLLVPRIGELVGGSQREERLDVLEAR
SYN_LAWIP       F-KHPVIIFDYPKEIKAFYMRQNDDEE--TVAAMDLLVPRIGELIGGSQREERLDNLLSR
SYN_PARUW       F-GKPVILTDYPKDIKAFYMRTNEDNK--TVAAMDVLVPKVGEIIGGSQREERLSVLESK
SYN_ACTP2       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDTR
SYN_HAEDU       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLAVLDSR
SYN_HISS2       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEVLDKR
SYN_HAES1       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEVLDKR
SYN_PASMU       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDKR
SYN_HAEIN       F-KSPVVVKNYPKDIKAFYMRLNDDEK--TVAAMDVLAPGIGEIIGGSQREERLEVLDKR
SYN_HAEIG       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEVLDKR
SYN_HAEIE       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEVLDKR
SYN_MANSM       F-KSPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_ACTSZ       F-KSPVVVKNYPKGIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDKR
SYN_YERPA       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_YERPN       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_YERP3       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_YERPE       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_YERPS       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_YERPP       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_YERE8       F-KAPVVVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_SERP5       F-KAPVVVKNYPKDIKAFYMRMNDDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDQR
SYN_PECAS       F-KAPVVVKNYPKDIKAFYMRMNDDGK--TVAAMDVLAPGIGEIIGGSQREERLAALDSR
SYN_PHOLL       F-QAPVVVKNYPKDIKAFYMRMNDDGK--TVAALDVLAPGIGEIIGGSQREERLDMLDKR
SYN_SALTI       F-KAPVVVKNYPKEIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_SALPA       F-KAPVVVKNYPKEIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_SALCH       F-KAPVVVKNYPKEIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_SALTY       F-KAPVVVKNYPKEIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_ECOLC       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_SHIF8       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_SHIFL       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECOL5       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECO24       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_SHIBS       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECOLI       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECOUT       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_SHISS       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECOHS       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECOL6       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_ECO57       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDER
SYN_SHIDS       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDVR
SYN_KLEP7       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_ENT38       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_SODGM       F-KAPVVVKNYPKDIKAFYMRMNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDRLDQR
SYN_BAUCH       F-QAPVVVTNYPKDIKAFYMRINDDGK--TVAAMDVLAPGIGEIIGGSQREERLAKLDQR
SYN_SHEHH       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDAR
SYN_SHEPA       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDAR
SYN_SHESH       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDAR
SYN_SHELP       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDTR
SYN_SHESM       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHESR       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHESA       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHEON       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHEB5       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHEB8       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHEB9       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHEPC       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHESW       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDMR
SYN_SHEDO       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDAR
SYN_SHEFN       F-KAPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGAQREERLDVLDAR
SYN_SHEAM       F-KAPVVVKNYPKDIKAFYMRLNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_VIBVY       F-KAPVIVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_VIBVU       F-KAPVIVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_VIBPA       F-KAPVIVKNYPKDIKAFYMRMNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_ALIF1       F-KAPVIVKNYPKDIKAFYMRQNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDILDAR
SYN_VIBCH       F-KAPVIVKNYPKDIKAFYMRMNEDGK--TVAAMDVLAPGIGEIIGGSQREERLDILDAR
SYN_PHOPR       F-KAPVVVKNYPKDIKAFYMRMNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEHLDKR
SYN_AERHH       F-KSPVVVKNYPKDIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_PSET1       F-KAPVVIKNYPRDIKAFYMRQNEDGK--TVAAMDIVAPGIGEIIGGSQREERLDILDAR
SYN_PSEA6       V-GAPIIMQNYPKDIKAFYMRINDDNK--TVAAMDVLAPGIGEIIGGSQREERLDVFDRR
SYN_IDILO       V-GAPIILKNYPRDIKAFYMRQNEDGK--TVAAMDVLAPGIGEIIGGSAREERLDILDQR
SYN_COLP3       F-NGPVVLQNYPKDIKSFYMRLNDDGK--TVAAMDILAPGIGEIIGGSQREERLDVLDSR
SYN_PSYIN       V-GAPVILQNYPKDIKAFYMKLNADGK--TVAAMDVLAPGIGEIIGGSQREEDLVALDKR
SYN_HAHCH       V-GAPVIVMNYPKEIKAFYMRLNDDDK--TVAAMDVLAPGIGEIIGGSQREDRLDVLDAR
SYN_XYLFT       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEMLDIR
SYN_XYLFA       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLEMLDIR
SYN_XANC5       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_XANAC       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_XANOR       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_XANOM       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_XANC8       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_XANCP       I-GRPVVVTNYPEHIKAFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDAR
SYN_MYXXD       V-GRPVVVMNYPEAIKSFYMRLNDDGK--TVAAMDVLAPGIGEIIGGSQREERLDVLDQR
SYN_BUCAI       F-KIPVIVKNYPKELKAFYMRLNNDKK--TVAAIDILVPNVGELIGGSQREERIAILDER
SYN_BUCAP       F-KAPVVIINYPKELKAFYMRLNDDKK--TVAAMDLLVPGIGELIGGSQREERISVLDLR
SYN_BUCBP       F-KFPLVITNYPKSLKAFYMRVNDDNK--TVSAMDVLVPGVGEIIGGSEREERLNVLDRR
SYN_WIGBR       Y-KSHIVIKNYPKEIKAFYMRLNKDKK--TVAAADILLPGIGEIIGGSEREDRLEYLDSM
SYN_BLOPB       F-KSPVIIKNFPKNIKAFYMRLNDDNK--TVASMDILVPGIGEIIGGSQREERLSKLDQR
SYN_BLOFL       F-QSPIVIKNHPKNIKAFYMRLNDDNK--TVSSMDILVPGIGEIIGGSQREERLSILDKR
SYN_DESPS       Y-KRPLIVTDYPAAIKPFYMRMNEDGK--TVAAMDILVPGIGELVGGSQREERYDLLAER
SYN_RHOBA       V-GGPVILTDYPSSIKPFYMRVSDDGK--TVAAMDVLVPGVGEIIGGSQREERLDVLQRR
SYN_BACSU       D--KPVFITRYPTSLKPFYMQPASDREDVVLCADLIAPEGYGEIIGGSERIHDMELLESR
SYN_BACVZ       D--KPVFITHYPTSLKPFYMQPAKDRDDVVLCADLIAPEGYGEIIGGSERVHDMDLLEER
SYN_BACLD       D--KPVFITHYPTSLKPFYMQPAPDREDVVLCADLIAPEGYGEIIGGSERIHDLELLEAR
SYN_GEOTN       D--KPVFITHYPTSLKPFYMQPDPNRPDVVLCADLIAPEGYGEIIGGSERIHDYELLKQR
SYN_ALKHC       D--KPVFITHYPTSLKPFYMEPDPNRDDVVLCADLIAPEGYGEIIGGSQRISDYDLLKKR
SYN_BACSK       D--KPVFITRYPRSLKPFYMQPAPDRDDVVLCADLIAPEGYGEIIGGSERIHDYDLLKQE
SYN_STAES       D--LPVFITNYPTKIKPFYMQPNPDNEDTVLCADLIAPEGYGEIIGGSERINDLELLEQR
SYN_STAEQ       D--LPVFITNYPTKIKPFYMQPNPDNEDTVLCADLIAPEGYGEIIGGSERINDLELLEQR
SYN_STAHJ       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERINDLELLEQR
SYN_STAAS       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAW       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAT       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAE       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAC       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAA3       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAA8       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAA2       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAN       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAM       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAA9       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAA1       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAB       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAAR       D--LPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQR
SYN_STAS1       D--LPVFITNYPTKIKPFYMQPNPENEDTVLCADLIAPEGYGEIIGGSERINDLELLEER
SYN_OCEIH       D--MPVFITNYPKDIKAFYMKPHPDRSDVVLCADLIAPEGYGEIIGGSQRIDDLELMEQR
SYN_LISMF       E--KPVFITHYPKAIKPFYMPEDPENDQVVLCADMIAPEGYGEIIGGSERIHDLETLQAR
SYN_LISIN       E--KPVFITHYPKAIKPFYMPEDPENDQVVLCADMIAPEGYGEIIGGSERIHDLETLQAR
SYN_LISMO       E--KPVFITHYPKAIKPFYMPEDPENDQVVLCADMIAPEGYGEIIGGSERIHDLETLQAR
SYN_LISW6       E--KPVFITHYPKAIKPFYMPEDPENNQVVLCADMIAPEGYGEIIGGSERIHDLETLQAR
SYN_STRR6       G--VPTFVMNYPAAIKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREEDYDALVAK
SYN_STRP2       G--VPTFVMNYPAAIKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREEDYDALVAK
SYN_STRPN       G--VPTFVMNYPAAIKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREEDYDALVAK
SYN_STRSV       G--VPTFVVNYPAAIKAFYMKPVPGNPDRVLCADLLAPEGYGEIIGGSMREEDYDALVAK
SYN_STRT1       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAK
SYN_STRT2       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAK
SYN_STRTD       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAK
SYN_STRPC       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRPB       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRP1       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRPD       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRPM       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRPG       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRP3       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRP8       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRP6       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRPF       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDTLVAK
SYN_STRA5       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAK
SYN_STRA3       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAK
SYN_STRA1       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDDYDALVAK
SYN_STRS2       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRSY       G--VPTFVVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAK
SYN_STRMU       G--IPTFVVNYPASLKAFYMKPVPGNPDRVLCADLLAPEGYGEIIGGSERETDYNTLLAK
SYN_LACLM       G--VPTFIVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSERETDYDLLLKK
SYN_LACLS       G--VPTFIVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSERETDYDLLLKK
SYN_LACLA       G--VPTFIVNYPASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSERETDYDLLLKK
SYN_ENTFA       G--VPTFILNYPKAIKAFYMKPHPTREDVVICADLIAPEGYGEIIGGSERATDYDYLKEK
SYN_LACSS       E--QPVFILNYPKAIKPFYMKPHPTRDDVYLCADLLAPEGYGEIIGGSERETDFDKLEAE
SYN_LACP3       D--QPVFVLNYPKTIKPFYMLTDPEDDQQYVCADMLAPEGYGEIIGGSERETDYDTLKNA
SYN_LACS1       S--KPVFVMNYPKAIKPFYMKPHPTRDDVVICADMLAPEGYGEIIGGSERATDPKYLEEQ
SYN2_LACPL      D--QPVFVLNYPKAIKPFYMKPHPTRDDVVICADLLAPEGYGEIIGGSERATDYNYLLDQ
SYN1_LACPL      D--QPVFVLNYPKAIKAFYMQAHPTRDDVVIAADLLAPEGYGEIIGGSERSTDYDYLKER
SYN_LIMRD       Q--KPVFILNYPKEIKAFYMPEDPEDSRQVICADLLAPEGYGEIIGGSERSYDYEYITNK
SYN_LACJO       D--RPVFIVNYPTTIKPFYMKKNPDNPKEYLCADVIAPEGYGEIFGGSEREGNYEILKQQ
SYN_LACGA       D--RPVFIVNYPTTIKPFYMKKNPDNPKEYLCADVIAPEGYGEIFGGSEREGNYEILKKQ
SYN_LACH4       D--RPVFIVNYPTSIKPFYMKKNPDNPKEYLCADVIAPEGYGEIFGGSEREGNYEVLEQQ
SYN_LACDA       D--RPFFIVNYPVAIKPFYMKKNPENPLTYLCADVEAPEGYGEIMGGSEREADYDTLKAQ
SYN_THET8       D--RPVFVERYPARIKAFYMEPDPEDPELVLNDDLLAPEGYGEIIGGSQRIHDLELLRRK
SYN_THET2       D--RPVFVERYPARIKAFYMEPDPEDPELVLNDDLLAPEGYGEIIGGSQRIHDLELLRRK
SYN_DEIGD       D--RPVIVERYPAAIKAFYMQPDPADPRLALCDDMIAPEGYGEIIGGSERIHDYTLLKAR
SYN_DESRM       E--SPVFIHRYPTEIKAFYMKPDPEDGRVVLGADLIAPEGYGEMIGGGQRIDDLQLLEQR
SYN_PELTS       G--LPVFIHRFPVDIKAFYMKPDPENPDVVLGADLLAPEGYGEIIGGGQRIDELELLKKR
SYN_SYMTH       E--KPVFVEKFPVKVKAFYMQPDPENPDVVLGADLLAPEGYGEIIGGSQRIHDPELLKRR
SYN_ROSS1       D--RPVFVERFPSAIKAFYMEPDPQRPEVALCADLLAPEGYGEIIGGSQRIHDPALLERR
SYN_ROSCS       D--RPVFVERFPSAIKAFYMEPDPNRPEVALCADLLAPEGYGEIIGGSQRIHDAALLERR
SYN_CHLAA       D--RPVFVERFPSAVKAFYMQPDPERPEVALCADLLAPEGYGEIIGGSQRIHDPILLEQR
SYN_KORVE       D--RPVMIHRYPVEVKAFYMEPDPNNSKVALCVDVLAPEGYGEVIGGSQRMGSYEKLLAR
SYN_THEAC       D--RPIFVTNYPKDLKPFYMPVDPENPGEVLNHDMLAPEGYGEIIGGSQRIWNYDELMQR
SYN_THEVO       C--KPVFVTNYPKELKPFYMPQDPDNPSEVLNHDLLAPEGYGEIIGGSQRIWDYKELMQR
SYN_PYRHO       D--RPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNR
SYN_PYRFU       D--RPFFVYGYPKQIKAFYMKEDPNDPRKVLAADMLAPEGYGEIIGGSQREDDYEKLLNR
SYN_PYRAB       D--RPFFVYGYPKHIKAFYMKEDPNDPRKVLAADMLAPEGYGEIIGGSEREDNYDKLVQR
SYN_THEKO       E--SPFFVYGYPKHIKAFYMKEDPEDPRKVLAADMLAPEGYGEIIGGSQREDDYDKLVQR
SYN_LEPIN       G--GPVFIQKYPREAKAFYMKVNPEDPRTVLNADLIAPDGVGEIIGGSEREENYENIVQR
SYN_LEPIC       G--GPVFIQKYPREAKAFYMKVNPEDPRTVLNADLIAPDGVGEIIGGSEREENYENIVQR
                       :   *   *.***          :          **: **. *      :   

SYN_CLOB1       MEE---LNLNKE--DYWWYLELRKYGETKHSGYGLGFERILMYITGMTNIRDVIPFPRTP
SYN_CLOBH       MEE---LNLNKE--DYWWYLELRKYGETKHSGYGLGFERILMYITGMTNIRDVIPFPRTP
SYN_CLOBL       MEE---LNLNKE--DYWWYLELRKYGETKHSGYGLGFERILMYITGMTNIRDVIPFPRTP
SYN_CLOK5       ISE---FGLNKE--DYWWYLELRKYGETKHSGFGLGFERILMYITGMSNIRDVIPFPRTP
SYN_CLOAB       MEE---LNLNKE--DYWWYLELRKYGETKHSGYGLGFERMIMYLTGISNIRDVIPFPRTT
SYN_CLONN       MAE---LGLEKE--DYWWYLELRKYGETKHAGYGLGFERMIMYLTGMGNIRDVIPFPRTP
SYN_CLOTE       MKE---FDLNEK--DYWWYLELRKYGSAKHSGFGLGFERILMYMTGISNIRDVIPFPRTP
SYN_CLOPE       MAE---LNLNEE--DYWWYLELRKYGETVHSGFGLGFERLIMYITGMANIRDVIPFPRTT
SYN_BACAN       IKE---LGMNEE--DYWWYLELRKYGGTKHAGFGLGFERFLMYITGMANIRDVIPFPRTP
SYN_BACCZ       IKE---LGMNEE--DYWWYLELRKYGGTKHAGFGLGFERFLMYITGMANIRDVIPFPRTP
SYN_BACC1       IKE---LGMNEE--DYWWYLELRKYGGTKHAGFGLGFERFLMYITGMANIRDVIPFPRTP
SYN_BACHK       IKE---LGMNEE--DYWWYLELRKYGGTKHAGFGLGFERFLMYITGMANIRDVIPFPRTP
SYN_BACCR       IKE---LGMNEE--DYWWYLELRKYGGTKHAGFGLGFERFLMYITGMANIRDVIPFPRTP
SYN_BACCN       IKE---LGMKEE--DYWWYLELRKYGGTKHAGFGLGFERFLMYITGMGNIRDVIPFPRTP
SYN_ALKOO       MDA---MGLDKE--EYWWYLELRKYGSARHAGYGLGFERAIMYLTGMSNIRDVISFPRTP
SYN_ALKMQ       MKQ---MGLDEE--EYWWYLELRKYGGVKHAGYGLGFERAIMYLTGMANIRDVISYPRTP
SYN_ACET2       MKE---LGLKME--DYWWYLDLRRYGSTRHAGFGLGFERAIMYITGMSNIRDVIPFPRTV
SYN_DESHY       MAE---LGLHKE--DYSWYLDLRKYGGTRHAGYGLGFERVIMYLTGISNIRDVVAFPRTV
SYN_FUSNN       MKE---LGLNEE--DYEFYLDLRRFGSFPHSGYGLGFERMMMYLTGMQNIRDVIPFPRTP
SYN_UREP2       CQE---LKMPIE--SLQWYLDLRRFGYYMSSGFGIGFERLVMYVTGVNNIKDTIPFPRSH
SYN_UREPA       CQE---LKMPIE--SLQWYLDLRRFGYYMSSGFGIGFERLVMYVTGVNNIKDTIPFPRSH
SYN_MYCGE       CQS---LNIDTK--SLNWYLDMRKWGYFASAGFGLGFDRLLAYICGLENIRDAIPFPRVH
SYN_MYCPN       CQA---MQIDTQ--TLNWYLDMRKWGYFASAGFGLGFDRLLAYICGLENIRDAIPFPRAH
SYN_MYCPE       CTK---ANMKVE--DIEWYLALRKYGYHKSAGFGLGFERFLMYVTECENVKDTIPFPRSY
SYN_MYCGA       CLE---LDIDPEFNNLQWYLDLRKYGYYRSAGFGLGFERLLMYVTGCDNIRDAIPFPRFH
SYN_MYCCT       CKE---VNIDID--QLEWYNNLRLYGYYKSAGFGLGFERLIMYITGASNIRDVIPFPRTP
SYN_MYCMS       CKE---VNIDID--QLEWYNNLRLYGYYKSAGFGLGFERLVMYITGASNIRDVIPFPRTP
SYN_MESFL       CEF---YGINPE--ELDWYIGLRKYGFYKSAGFGLGFERLIMYITGASNIRDVIPFPRTP
SYN_MYCPU       IQE---LNIDQK--DIQWYLDLRKYGYSGSAGFGLGLERLVMYITGIDNIRDSIPFPRTP
SYN_MYCMO       VKD---LKINQE--DLQWYLDLRRFGQASSAGFGLGFERLIMYITGTENIRDTIPFPRTP
SYN_MYCH7       MNE---LNMNIE--EFQWYLDLRKYGNPGSSGFGLGFERLLMYITGIENIRDVIPFPRTN
SYN_MYCH2       MNE---LNMNIE--EFQWYLDLRKYGNPGSSGFGLGFERLLMYITGIENIRDVIPFPRTN
SYN_MYCHJ       MSE---LNMNIE--EFQWYLDLRKYGNPGSSGFGLGFERLLMYITGIENIRDVIPFPRTS
SYN_AYWBP       MNQ---MKISQK--DLEWYLDLRRFGGCIHSGFGLGFERLLIFLTGLDNIRDVIAFPRTY
SYN_ONYPE       MNQ---MKIPQK--DLEWYLDLRRFGGCIHSGFGLGFERLLIFLTGLDNIRDVIAFPRTY
SYN_ACHLI       MED---MHVPVK--DLDWYLDLRRYGGVQTSGFGLGFERYLIYVTGVENIRDVIPFPRTP
SYN_GEOSL       MRE---GGIAPE--SLWWYLDSRRWGSTPHAGFGLGFERLIMYLTGMENIRDVIPFPRTP
SYN_GEOMG       MAE---VGVNPE--GLWWYLDSRRWGSTPHAGFGLGFERLIMYLTGMENIRDVIPFPRTP
SYN_GEOUR       MAQ---MGINED--GLWWYLDSRRWGSCPHAGFGLGFERLLMYLTGMENIRDVIPFPRTP
SYN_PELPD       MAE---LGIARE--PLWWYLESRRWGSCPHAGFGLGFERLVMYLSGMENIRDVIPFPRTP
SYN_BORBU       IKE---LNLNIE--HLNWYLDLRRFGSAPHSGFGLGLERLVQYSTGISNIRDSIPFPRTP
SYN_BORBP       IKE---LNLNIE--HLNWYLDLRRFGSTPHSGFGLGLERLVQYTTGISNIRDSIPFPRTP
SYN_BORAP       IKE---LNLSIE--HLNWYLDLRRFGSTPHSGFGLGLERFVQYSTGISNIRDSIPFPRTP
SYN_NOSS1       VLA---QGMQPE--DLWWYLDLRRYGTVPHAGFGLGFERLVQFITGMGNIRDVIPFPRTP
SYN_SYNY3       MQE---QGVPEE--DLWWYLDLRRYGSVPHAGFGLGFERIVQFMTGMANIRDVIPFPRTP
SYN_MICAN       MQE---QGMNPD--DLWWYLDLRRYGSVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTP
SYN_THEEB       IVT---QGLDPA--PYWWYLDLRRYGSVPHAGFGLGFERLVQFMTGMDNIRDVIPFPRTP
SYN_SOLUE       IREMAAHGLREE--AYWWYLDLRRFGGVEHAGFGMGFERMLMYLTGMKNIRDVIPFPRTP
SYN_TREDE       IKE---LGLREE--DYWWYLDLRRYGTVPHSGFGLGFERLLLYVTGMGNIRDVIPFPRAP
SYN_TREPA       IRA---SGFDPH--DYRWYTDLRRFGTAPHAGFGLGFERLLQYVTGLGNIRDVIPFPRTP
SYN_BACFN       IEE---MHIPMK--DMWWYLDTRKFGTCPHSGFGLGFERLLLFVTGMSNIRDVIPFPRTP
SYN_BACFR       IEE---MHIPMK--DMWWYLDTRKFGTCPHSGFGLGFERLLLFVTGMSNIRDVIPFPRTP
SYN_BACTN       IEE---MHIPMK--DMWWYLDTRKFGTCPHSGFGLGFERLLLFVTGMSNIRDVIPFPRTP
SYN_PHOV8       IQE---LGIPMK--DMWWYLDTRKFGSCPHSGFGLGFERLLLFVTGMTNIRDVIPFPRTP
SYN_PARD8       IDE---LGIPMK--DMWWYLDTRRFGTVPHSGFGLGFERLLLFVTGMANIRDVIPFPRTP
SYN_PORGI       ANE---MGVPEK--DIWWYLDSRRYGTAPHSGFGLGFERLLLFVTGMSNIRDVIPFPRTP
SYN_DESVV       INE---MGQNLE--DYWWYLDLRRFGSVPHAGFGMGFERLLMLLTGITNIRDVIPFPRTP
SYN_DESVH       INE---MGQNLE--DYWWYLDLRRFGSVPHAGFGMGFERLLMLLTGITNIRDVIPFPRTP
SYN_DESAG       IKE---LGQNPD--DYWWYLELRKFGTAPHAGFGMGFERLLMLLTGIGNIRDVIPFPRTP
SYN_LAWIP       IRE---LGQSIE--EYWWYLDLRRFGTVPHAGFGLGFERLVMLLTGVSNIRDVLPFPRTP
SYN_PARUW       LKE---FNLPAE--EYWWYLELRKFGSVPHSGFGAGFERLVQFTTGMENIRDVIPFPRHP
SYN_ACTP2       MVE---MGLNPE--DYWWYRDLRKYGTVPHSGFGLGFERLIVYVTGLQNIREVIPFPRAP
SYN_HAEDU       MIE---MGLNPE--DYWWYRDLRKYGTVPHAGFGLGFERLIVYVTGLQNIREVIPFPRAP
SYN_HISS2       IAE---MGLKAE--DYWWYRDLRRYGTVPHAGFGLGFERLIVYVTGVQNIRDVIPFPRTP
SYN_HAES1       IAE---MGLKAE--DYWWYRDLRRYGTVPHAGFGLGFERLIVYVTGVQNIRDVIPFPRTP
SYN_PASMU       MIE---MGLNPE--DYWWYRDLRRYGTVPHAGFGLGFERLIVYVTGVQNIRDVIPFPRSP
SYN_HAEIN       MEE---MGLNPD--DYWWYRDLRKYGSVPHSGFGLGFERLIVYVTGVQNIRDVIPFPRAP
SYN_HAEIG       MEE---MGLNPD--DYWWYRDLRKYGSVPHSGFGLGFERLIVYVTGVQNIRDVIPFPRAP
SYN_HAEIE       MEE---MGLNPD--DYWWYRDLRKYGSVPHSGFGLGFERLIVYVTGVQNIRDVIPFPRAP
SYN_MANSM       MAE---MGLNPE--DYWWYRDLRKYGTVPHSGFGLGFERLIVYVTGLQNIREVIPFPRTP
SYN_ACTSZ       MVE---MGLKPE--DYWWYRDLRKYGTVPHSGFGLGFERLIVYVTGVQNIRDVIPFPRSP
SYN_YERPA       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_YERPN       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_YERP3       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_YERPE       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_YERPS       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_YERPP       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_YERE8       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLISYVTGVQNVRDVIPFPRTP
SYN_SERP5       LEA---MGLNKE--DYWWYRDLRRYGTVPHAGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_PECAS       LEE---MGLNKE--DYWWYRDLRRYGTIPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_PHOLL       LEE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLVAYVTGVPNVRDVIPFPRTP
SYN_SALTI       MAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SALPA       MAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SALCH       MAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SALTY       MAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECOLC       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SHIF8       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SHIFL       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECOL5       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECO24       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SHIBS       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECOLI       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECOUT       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SHISS       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECOHS       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECOL6       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ECO57       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_SHIDS       MLE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_KLEP7       MAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTP
SYN_ENT38       MEE---MGLNPA--DYSWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIAFPRTP
SYN_SODGM       LAE---MGLNKD--DYWWYRDLRRYGTVPHSGFGLGFERLIVYVTGMQNIRDVIPFPRSP
SYN_BAUCH       LAD---RGLNIE--DYWWYRDLRSYGTVPHSGFGLGLERLMIYITGMHNIRDVIPFPRNP
SYN_SHEHH       LAE---MELSQE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRSP
SYN_SHEPA       LAE---MELSQE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRSP
SYN_SHESH       LEE---MNLSKE--DYWWYRDMRRYGTVPHSGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHELP       LDE---MGLSKE--DYWWYRDLRRYGTVPHSGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHESM       LEE---MDLNKE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHESR       LEE---MDLNKE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHESA       LEE---MDLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHEON       LEE---MDLNKE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHEB5       LAE---MDLNQE--DYWWYRDMRRYGTVPHAGFGLGFERLVSYVTGVNNIRDVIPFPRAP
SYN_SHEB8       LAE---MDLNQE--DYWWYRDMRRYGTVPHAGFGLGFERLVSYVTGVNNIRDVIPFPRAP
SYN_SHEB9       LAE---MDLNQE--DYWWYRDMRRYGTVPHAGFGLGFERLVSYVTGVNNIRDVIPFPRAP
SYN_SHEPC       LAE---MDLNKE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHESW       LAE---MDLNKE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVSNIRDVIPFPRAP
SYN_SHEDO       LAE---MELSQE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVNNIRDVIPFPRAP
SYN_SHEFN       LAE---MDLSQE--DYWWYRDLRRYGTVPHSGFGLGFERLVSYVTGVNNIRDVIPFPRAP
SYN_SHEAM       LEE---MNLSKE--DYWWYRDLRRYGTVPHAGFGLGFERLVSYVTGVGNIRDVIPFPRAP
SYN_VIBVY       MVE---MGIDPE--HMNWYRDLRRYGTVPHAGFGLGFERLVSYVTGMGNVRDVIPFPRTP
SYN_VIBVU       MVE---MGIDPE--HMNWYRDLRRYGTVPHAGFGLGFERLVSYVTGMGNVRDVIPFPRTP
SYN_VIBPA       MRE---MGIDPE--HMSWYRDLRRYGTVPHAGFGLGFERLVSYVTGMGNVRDVIPFPRTP
SYN_ALIF1       MIE---MGIDPE--HMSWYRDLRRYGTVPHAGFGLGFERLVSYVTGMGNVRDVIPFPRTP
SYN_VIBCH       MRE---FGIDPE--HMDWYRDLRRYGTVPHAGFGLGFERLVSYVTGMGNVRDVIPFPRTP
SYN_PHOPR       IAE---MGIDAS--HIEWYRDLRRYGTVPHSGFGLGFERLVTYVTGMQNIRDVIPFPRAP
SYN_AERHH       LAE---MGLNKE--DYWWYRDLRRYGTVPHSGFGLGFERLVVYVTGMGNVRDVIPFPRTP
SYN_PSET1       LDE---MGLNKD--DYSWYRDLRKYGTVPHSGFGLGFERLVAYVTGMGNVRDVIAFPRTK
SYN_PSEA6       LAE---MGLDQE--DYSWYRDLRRYGTVPHSGFGLGFERLVAYVTGMQNVRDVIAFPRTP
SYN_IDILO       IDE---MNLPKE--EYGFYRDLRRYGTVPHAGFGLGFERLVAYVTGVQNIRDVIPFPRAP
SYN_COLP3       LEE---MGLDIA--DYGWYRDLRRYGTVPHSGFGLGFERLVAYATGMQNVRDVIPFPRTP
SYN_PSYIN       FDE---MGINKE--DYSWYRDLRKYGTVPHAGFGLGFERLVSYVTGVQNIRDVIAFPRAP
SYN_HAHCH       IGD---MHH-KE--ELWWYRDLRRYGSVPHAGFGLGFERLIAYVTGMENVRDVIPFPRTP
SYN_XYLFT       MAQ---FGLDPA--HYQWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_XYLFA       MAQ---FGLDPT--HYQWYRDFRRYGSVPHAGFGLGFERLMVYVCGLSNIRDAIPYPRAP
SYN_XANC5       MAQ---FGLDKE--HYSWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_XANAC       MAQ---FGLDKE--HYSWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_XANOR       MAQ---FGLDKE--HYSWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_XANOM       MAQ---FGLDKE--HYSWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_XANC8       MAQ---FGLDKE--HYSWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_XANCP       MAQ---FGLDKE--HYSWYRDFRRYGSVPHAGFGLGFERLVVYVCGLSNIRDAIPYPRAP
SYN_MYXXD       IQK---FGLKPE--SYQWYRDLRRYGSVPHAGFGLGFERLIVYMCGLQNIRDAIPYPRVP
SYN_BUCAI       LLE---LGLKKE--DYWWYRDLRRYGTVPHSGFGMGFERLISYFTGITNIRDLIPFPRTV
SYN_BUCAP       LSE---LGLRKE--DYWWYRDLRRYGTVHHSGFGMGFERLISYITGISNIRDIIPFPRTV
SYN_BUCBP       FFE---LNLNKE--DYWWYRDLRKYGTIPHSGFGLGFERLLSYILGIKNIRDVCPFPRTA
SYN_WIGBR       IKE---KRLIHK--NYEWYRDLRKYGTVPHSGFGLGIERLISYVTGLKNIRDVIPFPRSS
SYN_BLOPB       LQE---NCLTQE--NYWWYRDLRRYGTVPHSGFGLGFERLMIYVTGIKNIRDVIPFPRTS
SYN_BLOFL       LLE---NNLKTE--CYWWYRDLRRYGTVPHSGFGLGFERLIIYITGLTNIRDAVPFPRTI
SYN_DESPS       MEA---AGLDLE--EYGWYLDLRKYGTVPHAGFGLGFERLVQFVTGMANIREVIPFPRTP
SYN_RHOBA       MAE---GGLDES--EYWWYVDLRRYGTVPHAGFGLGLERAVQYVTGMANIRDVIPFPRTP
SYN_BACSU       LKE---HGLDSD--AYKWYAELRKYGSVPHSGFGLGLERTVAWISGAPHVRETIPFPRLL
SYN_BACVZ       LKE---HGLDSD--AYKWYAELRQYGSVPHSGFGLGLERTVAWISGAPHVRETIPFPRLL
SYN_BACLD       LKE---HGLESD--AYQWYAELRKYGSVPHSGFGLGLERTVAWICGSPHVRETIPFPRLL
SYN_GEOTN       LEE---HHLPLE--AYEWYLDLRKYGSVPHSGFGLGLERTVAWICGVEHVRETIPFPRLL
SYN_ALKHC       LEE---HDLSLD--AYAWYLDLRKYGSVPHSGFGLGLERTVGWISGAGHVRETIPFPRLL
SYN_BACSK       LEK---HNLPLD--AYGWYLDLRKYGSVPHSGFGLGLERTVAWLSGTEHVRETIPFPRLL
SYN_STAES       INE---HELDEE--SYSYYLDLRRYGSVPHSGFGLGLERTVAWISGVEHVRETSPFPRLL
SYN_STAEQ       INE---HELDEE--SYSYYLDLRRYGSVPHSGFGLGLERTVAWISGVEHVRETSPFPRLL
SYN_STAHJ       IDE---HQLDAE--SYNYYLDLRRYGSVPHSGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAS       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAW       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAT       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAE       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAC       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAA3       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAA8       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAA2       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAN       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAM       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAA9       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAA1       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAB       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAAR       VKE---HGLDEE--AYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLL
SYN_STAS1       LSQ---FELDAE--SYSYYLDLRRYGSVPHSGFGLGLERTVAWLSGVEHVRETAPFPRLL
SYN_OCEIH       YEE---HGLTGP--AYQWYLELRKYGSVPHSGFGLGLERTVAWLSGVEHVRETIPFPRLL
SYN_LISMF       MED---FDLDQE--AYSWYLDLARYGSVPHSGFGLGLERTVAWISGTEHVRETIPFPRLL
SYN_LISIN       MED---FDLDQE--AYSWYLDLARYGSVPHSGFGLGLERTVAWISGTEHVRETIPFPRLL
SYN_LISMO       MED---FDLDQE--AYSWYLDLARYGSVPHSGFGLGLERTVAWISGTEHVRETIPFPRLL
SYN_LISW6       MED---FDLDQE--AYSWYLDLARYGSVPHSGFGLGLERTVAWISGTEHVRETIPFPRLL
SYN_STRR6       MDE---LGMDRT--EYEFYLDLRKYGTVPHGGFGIGIERMVTFAAGTKHIREAIPFPRML
SYN_STRP2       MDE---LGMDRT--EYEFYLDLRKYGTVPHGGFGIGIERMVTFAAGTKHIREAIPFPRML
SYN_STRPN       MDE---LGMDRT--EYEFYLDLRKYGTVPHGGFGIGIERMVTFAAGTKHIREAIPFPRML
SYN_STRSV       MND---LGMDTT--EYEFYLDLRKYGTVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRT1       MEE---LGMDRS--EYEFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRT2       MEE---LGMDRS--EYEFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRTD       MEE---LGMDRS--EYEFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRPC       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRPB       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRP1       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRPD       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRPM       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRPG       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRP3       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRP8       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRP6       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRPF       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRA5       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRA3       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRA1       MDE---LGMDKS--EYDFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRS2       MDE---LGMDKS--EYEFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRML
SYN_STRSY       MDE---LGMDKS--EYEFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPTFV
SYN_STRMU       IKE---NGLNPD--DYAFYLDLRQYGSVPHCGFGLGLERMVTFVAGTKHIREAIPFPRML
SYN_LACLM       IAD---FGLDPK--DYDWYLELRKFGSVPHAGFGLGLERMVTFVAGTEHIREAIPFPRMI
SYN_LACLS       IAD---FGLDPK--DYDWYLELRKFGSVPHAGFGLGLERMVTFVAGTEHIREAIPFPRMI
SYN_LACLA       IAD---FGLDPK--DYDWYLELRKFGSVPHAGFGLGLERMVTFVAGTEHIREAIPFPRMI
SYN_ENTFA       VAE---FGLSEE--EYSWYLDLRKYGSVPHSGFGLGLERAVTFITGNEHIREAIPFPRML
SYN_LACSS       IKS---MGLDIE--EYQWYLDLRRYGSVPHSGFGLGLERAITWICGIDHLREAIPFPRMI
SYN_LACP3       IEH---AGLDLD--EYEWYLDLRKYGSVPHSGFGLGLERAITWVCKLDHLREAIPFPRMI
SYN_LACS1       IIK---AGLDVK--DYEWYLDLRRYGSVPHSGFGLGLERAVTWITGEDHIREAIPFPRLL
SYN2_LACPL      IKQ---AGLNPD--DYAWYLDLRKYGSVPHAGFGLGLERFLTWITAEDHVRETIPFPRLL
SYN1_LACPL      LLA---SGQDLQ--DYEWYLDLRKYGSVPHSGFGMGLERFLAWITLQDHVRETIPFPRML
SYN_LIMRD       LEE---NGLSKE--DYGWYDDLRKYGSIPHSGFGMGLERFLAWITLQDHIRETIPFPRML
SYN_LACJO       IEE---AGLNLE--DYQWYLDLRKFGGVPHSGFGMGFERTIAWICKLDHIREAIPFPRLI
SYN_LACGA       IEE---AGLNLE--DYQWYLDLRKFGGVPHSGFGMGFERTIAWICKLDHIREAIPFPRLI
SYN_LACH4       IID---AGLNLE--DYQWYLDLRKFGGVPHSGFGMGFERTIAWVCHLDHIREAIPFPRLI
SYN_LACDA       IEE---AGLNLD--DYSWYLDLRKYGSVPHSGFGMGFERVIAWICKLDHVREAVPFPRMI
SYN_THET8       IQE---FGLPEE--VYDWYLDLRRFGSVPHSGFGLGLERTVAWICGLAHVREAIPFPRMY
SYN_THET2       IQE---FGLPEE--VYDWYLDLRRFGSVPHSGFGLGLERTVAWICGLAHVREAIPFPRMY
SYN_DEIGD       IEG---EGLPLS--AFDWYLDLRRFGSVPHAGFGMGLERVIAWITGIDHIREAIPFPRML
SYN_DESRM       LEE---HKLPKE--AFEWYLDLRRYGSVPHSGFGLGLERTVAWICKLDHVRETIPYPRML
SYN_PELTS       LVQ---HKLPEE--AFEWYLDLRRYGSVPHSGFGLGLERLLAWICGIEHIREAIPFPRML
SYN_SYMTH       FEE---HGLDMN--TYGWYYDLRRFGSVPHSGFGLGIERTVAWICGLEHVRETIPFPRLL
SYN_ROSS1       IRE---YGLNVD--DYQWYIDLRRYGSVPHSGFGMGIERATAWIAGTHHIRETIPFPRML
SYN_ROSCS       IRE---YGLNVD--DYRWYIDLRRYGSVPHSGFGMGIERATAWIGGTHHIRETIPFPRML
SYN_CHLAA       IRE---HGLRIE--DYEWYLDLRRYGTVPHSGFGMGIERVVAWITGTRHIRETIPFPRQL
SYN_KORVE       IHE---HQLPEE--SFKWYLDLRKFGGVPHSGFGMGIERAVAWICGLDHVRETIPFARTL
SYN_THEAC       IRE---ANLDES--AYYWYVDLRKYGSVPHSGFGLGLDRLAMWIMHLDNIREAIPYPRTI
SYN_THEVO       IRE---AGLDES--AYYWYIDLRKYGSVPHSGFGLGMDRLAMWIMHLDNIREAIPYPRTI
SYN_PYRHO       ILE---EGMDPK--DYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTP
SYN_PYRFU       ILE---EGMDPK--DYEWYLDLRKYGSVPHSGFGLGVERLVAWVLKLDHIRWASLFPRTP
SYN_PYRAB       IKE---EGMDPK--DYEWYLDLRKYGSVPHSGFGLGVERLVAWVLKLDHIRWATLFPRTP
SYN_THEKO       ILE---EGMKPE--DYEWYLDLRKYGSVPHSGFGLGLERLVAWVLKLDHVRWATLFPRTP
SYN_LEPIN       LKE---EKLPVE--SYDWYLDLRKYGSVPHSGFGLGSERLIAWICGLAHVRECIPFPRMM
SYN_LEPIC       LKE---EKLPVE--SYDWYLDLRKYGSVPHSGFGLGSERLIAWICGLAHVRECIPFPRMM
                                 :*     :*     *:* * :*         :::    :.   

SYN_CLOB1       GSAEF-------------------------------------------------------
SYN_CLOBH       GSAEF-------------------------------------------------------
SYN_CLOBL       GSAEF-------------------------------------------------------
SYN_CLOK5       GSAEF-------------------------------------------------------
SYN_CLOAB       GSAEF-------------------------------------------------------
SYN_CLONN       GVSEF-------------------------------------------------------
SYN_CLOTE       GSAEF-------------------------------------------------------
SYN_CLOPE       GTAEF-------------------------------------------------------
SYN_BACAN       GSSEF-------------------------------------------------------
SYN_BACCZ       GSSEF-------------------------------------------------------
SYN_BACC1       GSSEF-------------------------------------------------------
SYN_BACHK       GSSEF-------------------------------------------------------
SYN_BACCR       GSSEF-------------------------------------------------------
SYN_BACCN       GSAEF-------------------------------------------------------
SYN_ALKOO       KSAEF-------------------------------------------------------
SYN_ALKMQ       KSAEF-------------------------------------------------------
SYN_ACET2       HSAEF-------------------------------------------------------
SYN_DESHY       KNADF-------------------------------------------------------
SYN_FUSNN       NNAEF-------------------------------------------------------
SYN_UREP2       GQIEF-------------------------------------------------------
SYN_UREPA       GQIEF-------------------------------------------------------
SYN_MYCGE       GTINF-------------------------------------------------------
SYN_MYCPN       GSINY-------------------------------------------------------
SYN_MYCPE       GSLDF-------------------------------------------------------
SYN_MYCGA       GQLDF-------------------------------------------------------
SYN_MYCCT       KNLLF-------------------------------------------------------
SYN_MYCMS       KNLLF-------------------------------------------------------
SYN_MESFL       KTLLY-------------------------------------------------------
SYN_MYCPU       NNLKM-------------------------------------------------------
SYN_MYCMO       KNMKM-------------------------------------------------------
SYN_MYCH7       KNILM-------------------------------------------------------
SYN_MYCH2       KNILM-------------------------------------------------------
SYN_MYCHJ       KNILM-------------------------------------------------------
SYN_AYWBP       HNLVF-------------------------------------------------------
SYN_ONYPE       HNLVF-------------------------------------------------------
SYN_ACHLI       KNILF-------------------------------------------------------
SYN_GEOSL       RHAEF-------------------------------------------------------
SYN_GEOMG       RHAEF-------------------------------------------------------
SYN_GEOUR       RHAEF-------------------------------------------------------
SYN_PELPD       RHAEF-------------------------------------------------------
SYN_BORBU       KNLYF-------------------------------------------------------
SYN_BORBP       KNLYF-------------------------------------------------------
SYN_BORAP       KNLYF-------------------------------------------------------
SYN_NOSS1       QNAEF-------------------------------------------------------
SYN_SYNY3       MNAEF-------------------------------------------------------
SYN_MICAN       LSADF-------------------------------------------------------
SYN_THEEB       GNAEF-------------------------------------------------------
SYN_SOLUE       GNAEF-------------------------------------------------------
SYN_TREDE       KLAEF-------------------------------------------------------
SYN_TREPA       RTADF-------------------------------------------------------
SYN_BACFN       RNADF-------------------------------------------------------
SYN_BACFR       RNADF-------------------------------------------------------
SYN_BACTN       RNADF-------------------------------------------------------
SYN_PHOV8       RNAEF-------------------------------------------------------
SYN_PARD8       NNAEF-------------------------------------------------------
SYN_PORGI       NNAEF-------------------------------------------------------
SYN_DESVV       GNLEF-------------------------------------------------------
SYN_DESVH       GNLEF-------------------------------------------------------
SYN_DESAG       RHLEF-------------------------------------------------------
SYN_LAWIP       GYLEF-------------------------------------------------------
SYN_PARUW       GKADF-------------------------------------------------------
SYN_ACTP2       RNANF-------------------------------------------------------
SYN_HAEDU       RNANF-------------------------------------------------------
SYN_HISS2       RNANF-------------------------------------------------------
SYN_HAES1       RNANF-------------------------------------------------------
SYN_PASMU       RNANF-------------------------------------------------------
SYN_HAEIN       RNANF-------------------------------------------------------
SYN_HAEIG       RNANF-------------------------------------------------------
SYN_HAEIE       RNANF-------------------------------------------------------
SYN_MANSM       RNANF-------------------------------------------------------
SYN_ACTSZ       RNANF-------------------------------------------------------
SYN_YERPA       RNASF-------------------------------------------------------
SYN_YERPN       RNASF-------------------------------------------------------
SYN_YERP3       RNASF-------------------------------------------------------
SYN_YERPE       RNASF-------------------------------------------------------
SYN_YERPS       RNASF-------------------------------------------------------
SYN_YERPP       RNASF-------------------------------------------------------
SYN_YERE8       RNASF-------------------------------------------------------
SYN_SERP5       RNATF-------------------------------------------------------
SYN_PECAS       RNASF-------------------------------------------------------
SYN_PHOLL       RSANF-------------------------------------------------------
SYN_SALTI       RNASF-------------------------------------------------------
SYN_SALPA       RNASF-------------------------------------------------------
SYN_SALCH       RNASF-------------------------------------------------------
SYN_SALTY       RNASF-------------------------------------------------------
SYN_ECOLC       RNASF-------------------------------------------------------
SYN_SHIF8       RNASF-------------------------------------------------------
SYN_SHIFL       RNASF-------------------------------------------------------
SYN_ECOL5       RNASF-------------------------------------------------------
SYN_ECO24       RNASF-------------------------------------------------------
SYN_SHIBS       RNASF-------------------------------------------------------
SYN_ECOLI       RNASF-------------------------------------------------------
SYN_ECOUT       RNASF-------------------------------------------------------
SYN_SHISS       RNASF-------------------------------------------------------
SYN_ECOHS       RNASF-------------------------------------------------------
SYN_ECOL6       RNASF-------------------------------------------------------
SYN_ECO57       RNASF-------------------------------------------------------
SYN_SHIDS       RNASF-------------------------------------------------------
SYN_KLEP7       RNATF-------------------------------------------------------
SYN_ENT38       RNASF-------------------------------------------------------
SYN_SODGM       RNANF-------------------------------------------------------
SYN_BAUCH       RQASF-------------------------------------------------------
SYN_SHEHH       KSANF-------------------------------------------------------
SYN_SHEPA       KSANF-------------------------------------------------------
SYN_SHESH       KSASF-------------------------------------------------------
SYN_SHELP       KSANF-------------------------------------------------------
SYN_SHESM       RTANF-------------------------------------------------------
SYN_SHESR       RTANF-------------------------------------------------------
SYN_SHESA       RTANF-------------------------------------------------------
SYN_SHEON       RTANF-------------------------------------------------------
SYN_SHEB5       RTANF-------------------------------------------------------
SYN_SHEB8       RTANF-------------------------------------------------------
SYN_SHEB9       RTANF-------------------------------------------------------
SYN_SHEPC       RTANF-------------------------------------------------------
SYN_SHESW       RTANF-------------------------------------------------------
SYN_SHEDO       RSASF-------------------------------------------------------
SYN_SHEFN       RSASF-------------------------------------------------------
SYN_SHEAM       RSANF-------------------------------------------------------
SYN_VIBVY       RNANF-------------------------------------------------------
SYN_VIBVU       RNANF-------------------------------------------------------
SYN_VIBPA       RSANF-------------------------------------------------------
SYN_ALIF1       RSANF-------------------------------------------------------
SYN_VIBCH       RSASF-------------------------------------------------------
SYN_PHOPR       RSANF-------------------------------------------------------
SYN_AERHH       RTAEF-------------------------------------------------------
SYN_PSET1       GSATY-------------------------------------------------------
SYN_PSEA6       GNANY-------------------------------------------------------
SYN_IDILO       KSAEF-------------------------------------------------------
SYN_COLP3       NNAAF-------------------------------------------------------
SYN_PSYIN       GSADF-------------------------------------------------------
SYN_HAHCH       DNAQF-------------------------------------------------------
SYN_XYLFT       GSAEF-------------------------------------------------------
SYN_XYLFA       SSAEF-------------------------------------------------------
SYN_XANC5       GSAEF-------------------------------------------------------
SYN_XANAC       GSAEF-------------------------------------------------------
SYN_XANOR       GSAEF-------------------------------------------------------
SYN_XANOM       GSAEF-------------------------------------------------------
SYN_XANC8       GSAEF-------------------------------------------------------
SYN_XANCP       GSAEF-------------------------------------------------------
SYN_MYXXD       GSAAF-------------------------------------------------------
SYN_BUCAI       NNAYF-------------------------------------------------------
SYN_BUCAP       KNADF-------------------------------------------------------
SYN_BUCBP       YKADF-------------------------------------------------------
SYN_WIGBR       KNASF-------------------------------------------------------
SYN_BLOPB       KNINF-------------------------------------------------------
SYN_BLOFL       NSINF-------------------------------------------------------
SYN_DESPS       GFAPC-------------------------------------------------------
SYN_RHOBA       GNAEF-------------------------------------------------------
SYN_BACSU       NRLYP-------------------------------------------------------
SYN_BACVZ       NRLYP-------------------------------------------------------
SYN_BACLD       NRLYP-------------------------------------------------------
SYN_GEOTN       NRLYP-------------------------------------------------------
SYN_ALKHC       NRLYP-------------------------------------------------------
SYN_BACSK       NRLYP-------------------------------------------------------
SYN_STAES       NRLYP-------------------------------------------------------
SYN_STAEQ       NRLYP-------------------------------------------------------
SYN_STAHJ       NRLYP-------------------------------------------------------
SYN_STAAS       NRLYP-------------------------------------------------------
SYN_STAAW       NRLYP-------------------------------------------------------
SYN_STAAT       NRLYP-------------------------------------------------------
SYN_STAAE       NRLYP-------------------------------------------------------
SYN_STAAC       NRLYP-------------------------------------------------------
SYN_STAA3       NRLYP-------------------------------------------------------
SYN_STAA8       NRLYP-------------------------------------------------------
SYN_STAA2       NRLYP-------------------------------------------------------
SYN_STAAN       NRLYP-------------------------------------------------------
SYN_STAAM       NRLYP-------------------------------------------------------
SYN_STAA9       NRLYP-------------------------------------------------------
SYN_STAA1       NRLYP-------------------------------------------------------
SYN_STAAB       NRLYP-------------------------------------------------------
SYN_STAAR       NRLYP-------------------------------------------------------
SYN_STAS1       NRLYP-------------------------------------------------------
SYN_OCEIH       NRLYP-------------------------------------------------------
SYN_LISMF       NRLYP-------------------------------------------------------
SYN_LISIN       NRLYP-------------------------------------------------------
SYN_LISMO       NRLYP-------------------------------------------------------
SYN_LISW6       NRLYP-------------------------------------------------------
SYN_STRR6       HRIKP-------------------------------------------------------
SYN_STRP2       HRIKP-------------------------------------------------------
SYN_STRPN       HRIKP-------------------------------------------------------
SYN_STRSV       HRIKP-------------------------------------------------------
SYN_STRT1       HRIKP-------------------------------------------------------
SYN_STRT2       HRIKP-------------------------------------------------------
SYN_STRTD       HRIKP-------------------------------------------------------
SYN_STRPC       HRIRP-------------------------------------------------------
SYN_STRPB       HRIRP-------------------------------------------------------
SYN_STRP1       HRIRP-------------------------------------------------------
SYN_STRPD       HRIRP-------------------------------------------------------
SYN_STRPM       HRIRP-------------------------------------------------------
SYN_STRPG       HRIRP-------------------------------------------------------
SYN_STRP3       HRIRP-------------------------------------------------------
SYN_STRP8       HRIRP-------------------------------------------------------
SYN_STRP6       HRIRP-------------------------------------------------------
SYN_STRPF       HRIRP-------------------------------------------------------
SYN_STRA5       HRIKP-------------------------------------------------------
SYN_STRA3       HRIKP-------------------------------------------------------
SYN_STRA1       HRIKP-------------------------------------------------------
SYN_STRS2       HRLHP-------------------------------------------------------
SYN_STRSY       APLASVIQSSIFPFITSTYEETPFPFSQVQIFSSLLDLVWPSLITVGTSWPITKIKRKNC
SYN_STRMU       HRIEP-------------------------------------------------------
SYN_LACLM       NRIQP-------------------------------------------------------
SYN_LACLS       NRIQP-------------------------------------------------------
SYN_LACLA       NRIQP-------------------------------------------------------
SYN_ENTFA       NRIYP-------------------------------------------------------
SYN_LACSS       NRIKP-------------------------------------------------------
SYN_LACP3       NRLKP-------------------------------------------------------
SYN_LACS1       NRIYP-------------------------------------------------------
SYN2_LACPL      NRIYP-------------------------------------------------------
SYN1_LACPL      HRIYP-------------------------------------------------------
SYN_LIMRD       NRLNP-------------------------------------------------------
SYN_LACJO       NRMQP-------------------------------------------------------
SYN_LACGA       NRMQP-------------------------------------------------------
SYN_LACH4       NRMQP-------------------------------------------------------
SYN_LACDA       NRMQP-------------------------------------------------------
SYN_THET8       TRMRP-------------------------------------------------------
SYN_THET2       TRMRP-------------------------------------------------------
SYN_DEIGD       TRMVP-------------------------------------------------------
SYN_DESRM       YRVYP-------------------------------------------------------
SYN_PELTS       YRMCP-------------------------------------------------------
SYN_SYMTH       NRLHP-------------------------------------------------------
SYN_ROSS1       YRMYP-------------------------------------------------------
SYN_ROSCS       YRMYP-------------------------------------------------------
SYN_CHLAA       YRIYP-------------------------------------------------------
SYN_KORVE       HRIYP-------------------------------------------------------
SYN_THEAC       RRTKP-------------------------------------------------------
SYN_THEVO       RRTKP-------------------------------------------------------
SYN_PYRHO       ARLYP-------------------------------------------------------
SYN_PYRFU       ARLYP-------------------------------------------------------
SYN_PYRAB       ARIYP-------------------------------------------------------
SYN_THEKO       SRLYP-------------------------------------------------------
SYN_LEPIN       ERLYP-------------------------------------------------------
SYN_LEPIC       ERLYP-------------------------------------------------------
                                                                            

SYN_CLOB1       -----
SYN_CLOBH       -----
SYN_CLOBL       -----
SYN_CLOK5       -----
SYN_CLOAB       -----
SYN_CLONN       -----
SYN_CLOTE       -----
SYN_CLOPE       -----
SYN_BACAN       -----
SYN_BACCZ       -----
SYN_BACC1       -----
SYN_BACHK       -----
SYN_BACCR       -----
SYN_BACCN       -----
SYN_ALKOO       -----
SYN_ALKMQ       -----
SYN_ACET2       -----
SYN_DESHY       -----
SYN_FUSNN       -----
SYN_UREP2       -----
SYN_UREPA       -----
SYN_MYCGE       -----
SYN_MYCPN       -----
SYN_MYCPE       -----
SYN_MYCGA       -----
SYN_MYCCT       -----
SYN_MYCMS       -----
SYN_MESFL       -----
SYN_MYCPU       -----
SYN_MYCMO       -----
SYN_MYCH7       -----
SYN_MYCH2       -----
SYN_MYCHJ       -----
SYN_AYWBP       -----
SYN_ONYPE       -----
SYN_ACHLI       -----
SYN_GEOSL       -----
SYN_GEOMG       -----
SYN_GEOUR       -----
SYN_PELPD       -----
SYN_BORBU       -----
SYN_BORBP       -----
SYN_BORAP       -----
SYN_NOSS1       -----
SYN_SYNY3       -----
SYN_MICAN       -----
SYN_THEEB       -----
SYN_SOLUE       -----
SYN_TREDE       -----
SYN_TREPA       -----
SYN_BACFN       -----
SYN_BACFR       -----
SYN_BACTN       -----
SYN_PHOV8       -----
SYN_PARD8       -----
SYN_PORGI       -----
SYN_DESVV       -----
SYN_DESVH       -----
SYN_DESAG       -----
SYN_LAWIP       -----
SYN_PARUW       -----
SYN_ACTP2       -----
SYN_HAEDU       -----
SYN_HISS2       -----
SYN_HAES1       -----
SYN_PASMU       -----
SYN_HAEIN       -----
SYN_HAEIG       -----
SYN_HAEIE       -----
SYN_MANSM       -----
SYN_ACTSZ       -----
SYN_YERPA       -----
SYN_YERPN       -----
SYN_YERP3       -----
SYN_YERPE       -----
SYN_YERPS       -----
SYN_YERPP       -----
SYN_YERE8       -----
SYN_SERP5       -----
SYN_PECAS       -----
SYN_PHOLL       -----
SYN_SALTI       -----
SYN_SALPA       -----
SYN_SALCH       -----
SYN_SALTY       -----
SYN_ECOLC       -----
SYN_SHIF8       -----
SYN_SHIFL       -----
SYN_ECOL5       -----
SYN_ECO24       -----
SYN_SHIBS       -----
SYN_ECOLI       -----
SYN_ECOUT       -----
SYN_SHISS       -----
SYN_ECOHS       -----
SYN_ECOL6       -----
SYN_ECO57       -----
SYN_SHIDS       -----
SYN_KLEP7       -----
SYN_ENT38       -----
SYN_SODGM       -----
SYN_BAUCH       -----
SYN_SHEHH       -----
SYN_SHEPA       -----
SYN_SHESH       -----
SYN_SHELP       -----
SYN_SHESM       -----
SYN_SHESR       -----
SYN_SHESA       -----
SYN_SHEON       -----
SYN_SHEB5       -----
SYN_SHEB8       -----
SYN_SHEB9       -----
SYN_SHEPC       -----
SYN_SHESW       -----
SYN_SHEDO       -----
SYN_SHEFN       -----
SYN_SHEAM       -----
SYN_VIBVY       -----
SYN_VIBVU       -----
SYN_VIBPA       -----
SYN_ALIF1       -----
SYN_VIBCH       -----
SYN_PHOPR       -----
SYN_AERHH       -----
SYN_PSET1       -----
SYN_PSEA6       -----
SYN_IDILO       -----
SYN_COLP3       -----
SYN_PSYIN       -----
SYN_HAHCH       -----
SYN_XYLFT       -----
SYN_XYLFA       -----
SYN_XANC5       -----
SYN_XANAC       -----
SYN_XANOR       -----
SYN_XANOM       -----
SYN_XANC8       -----
SYN_XANCP       -----
SYN_MYXXD       -----
SYN_BUCAI       -----
SYN_BUCAP       -----
SYN_BUCBP       -----
SYN_WIGBR       -----
SYN_BLOPB       -----
SYN_BLOFL       -----
SYN_DESPS       -----
SYN_RHOBA       -----
SYN_BACSU       -----
SYN_BACVZ       -----
SYN_BACLD       -----
SYN_GEOTN       -----
SYN_ALKHC       -----
SYN_BACSK       -----
SYN_STAES       -----
SYN_STAEQ       -----
SYN_STAHJ       -----
SYN_STAAS       -----
SYN_STAAW       -----
SYN_STAAT       -----
SYN_STAAE       -----
SYN_STAAC       -----
SYN_STAA3       -----
SYN_STAA8       -----
SYN_STAA2       -----
SYN_STAAN       -----
SYN_STAAM       -----
SYN_STAA9       -----
SYN_STAA1       -----
SYN_STAAB       -----
SYN_STAAR       -----
SYN_STAS1       -----
SYN_OCEIH       -----
SYN_LISMF       -----
SYN_LISIN       -----
SYN_LISMO       -----
SYN_LISW6       -----
SYN_STRR6       -----
SYN_STRP2       -----
SYN_STRPN       -----
SYN_STRSV       -----
SYN_STRT1       -----
SYN_STRT2       -----
SYN_STRTD       -----
SYN_STRPC       -----
SYN_STRPB       -----
SYN_STRP1       -----
SYN_STRPD       -----
SYN_STRPM       -----
SYN_STRPG       -----
SYN_STRP3       -----
SYN_STRP8       -----
SYN_STRP6       -----
SYN_STRPF       -----
SYN_STRA5       -----
SYN_STRA3       -----
SYN_STRA1       -----
SYN_STRS2       -----
SYN_STRSY       KIIFP
SYN_STRMU       -----
SYN_LACLM       -----
SYN_LACLS       -----
SYN_LACLA       -----
SYN_ENTFA       -----
SYN_LACSS       -----
SYN_LACP3       -----
SYN_LACS1       -----
SYN2_LACPL      -----
SYN1_LACPL      -----
SYN_LIMRD       -----
SYN_LACJO       -----
SYN_LACGA       -----
SYN_LACH4       -----
SYN_LACDA       -----
SYN_THET8       -----
SYN_THET2       -----
SYN_DEIGD       -----
SYN_DESRM       -----
SYN_PELTS       -----
SYN_SYMTH       -----
SYN_ROSS1       -----
SYN_ROSCS       -----
SYN_CHLAA       -----
SYN_KORVE       -----
SYN_THEAC       -----
SYN_THEVO       -----
SYN_PYRHO       -----
SYN_PYRFU       -----
SYN_PYRAB       -----
SYN_THEKO       -----
SYN_LEPIN       -----
SYN_LEPIC       -----