CLUSTAL format seed alignment for MF_00537

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RR14_CHLRE       MAKKSMIQRELKRQKLVMKYATKRAALKEQIKQTTF---LKEKLSLHRKL-QQLPRNSSA
RR14_CHLVU       MAKKSMIERDRKRARLITKYAAKRKNLLVEIKTATS---LEDKFNLHRKL-QQLPRNSAP
RR14_MESVI       MAKKSMIEREKKRQKLVNKYAVKRKELKEQIKTSVS---FEERFKLQLEL-QKLPRNSSP
RR14_NEPOL       MAKKSMIERESKRAALVAKYATRRQALKAAIQKTKS---FDERLVLQHQL-QDLPVNSVP
RR14_GUITH       MAKKSMIERERKREELVSKYEKKRLELKSKLKKTAE---YEEKLEVYKKI-QEIPRNAFP
RR14_PORPU       MAKKNMIQREIKREKLEKKYYLKRLAIKEQLKKTTS---FAEKIELRQKL-QEMPRNSAP
RS14_SYNP6       MAKKAMVERDRKRKKLVEKYAAKREALKEQFAAATS---QSERLELHRKL-QQLPRNSAP
RS14_SYNY3       MAKKSMIERDKRRSRLVAKYAAKREALKEEFRQAET---LEDKLAVHQKL-QDLPRNSAP
RS14_NOSS1       MAKKSMIEREKKRAKLVEKYSEKREALLEEFRTTES---PLEKLEIHRQI-QQLPRNSAP
RR14_TRICV       MAKKSMIEREKKRIKLNNKYTPKRNTLLQAYRQTED---FQSRLDIHSKI-QKLPRNSAK
RR14_CYAPA       MAKKSMIERDKKRENLMNKYLVKRQQLKTRLNETDS---VEEKLLLNQEL-QKLPRNSAP
RR14_MARPO       MAKKSLIQREKKRQNLEKKYKILRNSLKKKI-TETS--SLDEKWEFQKKL-QSLPRNSAP
RR14_PHYPA       MAKKSLIEREKKRQKLEKKYQDFRHSIKKKI-KETS--SLDEKWEFQKQL-QALPRNSAP
RR14_ANTAG       MAKKSLIQREKKREKLKQKYQAFRKYLKEEM-SQTL--SIDKKWEIQKQL-QSLPRNSTP
RR14_ARATH       MAKKSLIYREKKRQKLEKKYHLIRRSLKKEI-SKIP--SLSEKWKIHGKL-QSLPRNSAP
RR14_LOTJA       MARKSLIQREKKRQKLEQKYHLIRRSSKKEI-SKVP--SLSEKWKIHGKL-ESLPRNSAP
RR14_EPIVI       MARKSLIQREKGRLKLENKYHFIRRSSKNEI-SKVP--SLSDKWEIYGKL-ESPPRNSAP
RR14_TOBAC       MARKSLIQREKKRQKLEQKYHSIRRSSKKEI-SKVP--SLSDKWEIYGKL-QSPPRNSAP
RR14_SPIOL       MARKSLIQREKKRRNLEQKYHLIRRSSKQEI-RKVT--SLSDKWEIHGKL-QSPPRNSAP
RR14_MAIZE       MAKKSLIQREKKRQKLEQKYHLIRRSSKKKIRSKVSPLSLSEKTKMQEKL-QSLPRNSAP
RR14_SACOF       MAKKSLIQREKKRHKLEQKYHLIRRSSKKKIRSKVSPLSLSEKTKMQEKL-QSLPRNSAP
RR14_SACHY       MAKKSLIQREKKRHKLEQKYHLIRRSLKKKIRSKVSPLSLSEKTKMQEKL-QSLPRNSAP
RR14_ORYNI       MAKKSLIQRERKRQKLEQKYHLIRRSSKKKIRSKVYPLSLSEKTKMREKL-QSLPRNSAP
RR14_ORYSA       MAKKSLIQRERKRQKLEQKYHLIRRSSKKKIRSKVYPLSLSEKTKMREKL-QSLPRNSAP
RR14_WHEAT       MAKKSLIQREKKRQKLEQKYHLIRQSLKKKIRSKVSPLSLSEKTKMREKL-QSLPRNSAP
RR14_PINTH       MARKSLIQREKKRQALERKYHLIRQSLEEKS--KVS--SLDDKWEIHRKL-QSSPRNSAP
RR14_ADICA       MAKKSLIEKENSKKKLVKKYNLLRQFLRREIKNSLR---IQDKLIISEKL-QSLPRNSAR
RR14_EUGLO       MSKKSIIEREKKRKSLVKKYKNLRNFIKKEIKNELN---FFEKIFLNFKL-QKFPRDSSP
RR14_EUGGR       MSKKSLIARQRKRIILVLIHSHNRYVYRTNGKDEKS---FEKKLRIYSFL-QKLPRNSLR
RR14_CYACA       MAKKSVIQRNINRLKLINKYSAQREAIKNEIKRTSK---VEKKISLYSNI-SRLPRDSSK
RR14_HELSJ       MAKKSLIVREYKKNILVNKYYKKRLLLKSQLNNTIN--STDCILKILNKL-QKLPKKSSP
RS14B_BACSU      MAKKSKVAKELKRQQLVEQYAGIRRELKE--------------KGDYEAL-SKLPRDSAP
RS14_BACLD       MAKKSKIAKEKKRQKLVEQYAELRKELKE--------------KGDYRAL-SKLPRDSAP
RS14_STAA3       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAA8       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAB       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAC       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAM       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAN       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAS       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAW       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAAR       MAKKSKIAKERKREELVNKYYELRKELKA--------------KGDYETL-RKLPRDSSP
RS14_STAEQ       MAKKSKIAKEQKRQELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAES       MAKKSKIAKEQKRQELVNKYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAHJ       MAKKSKIAKEMKREKLVNQYYELRKELKA--------------KGDYEAL-RKLPRDSSP
RS14_STAS1       MAKKSKIAKEQKREKLVAQYYELRKELKD--------------KGDYEAL-RKLPRDSSP
RS14_OCEIH       MAKKSKIAKERKRQQMVEKYAELRRELKA--------------KGDYEAI-RKLPRDSSP
RS14_BACSK       MAKKAKVQKELKRQELVAQYAEKRKELKE--------------KGDYVAL-AKLPRDSAP
RS14_STRP1       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRP3       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRP6       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRP8       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRPC       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRPD       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRPF       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRPM       MAKKSKIAKYQKQLQLIEQYADLRRDLKA--------------KGDYESL-RKLPRDSNP
RS14_STRA1       MAKKSKIAKFQKQQKLVEQYAELRRELKE--------------KGDYEAL-RKLPKDSNP
RS14_STRA3       MAKKSKIAKFQKQQKLVEQYAELRRELKE--------------KGDYEAL-RKLPKDSNP
RS14_STRA5       MAKKSKIAKFQKQQKLVEQYAELRRELKE--------------KGDYEAL-RKLPKDSNP
RS14_LACS1       MAKKSKIAKYRKQQMLVAKYAEIRKQLKV--------------NHDYESL-RKLPKDSNP
RS14_LACLA       MAKKSKIAKFKKQQKLVAQYQELRQELKK--------------EKNYEAL-RKLPKDSHP
RS141_ENTFA      MAKKSKIAKAKKQMAMIEKYADKRQELKA--------------AGDRTAL-AKLPRDSNP
RS142_ENTFA      MAKKSKIAKAKKQQAMIAKYAPIRQALKE--------------AGDYEGL-SKLPKDAHP
RS14_LACPL       MAKKSKIAKEKRIEATVAKYAERRQALKA--------------AGNYTEL-AKLPRNASP
RS14_LISIN       MAKKSKVAKHEHQQALVEQYAELRRTLKA--------------EGRFDEL-RKLPRDSSP
RS14_LISMO       MAKKSKVAKHERQQALVEQYAELRRTLKA--------------EGRYDEL-RKLPRDSSP
RS14_STRPN       MAKKSMVAREAKRQKIVDRYAEKRAALKA--------------AGDYEGL-SKLPRNASP
RS14_STRR6       MAKKSMVAREAKRQKIVDRYAEKRAALKA--------------AGDYEGL-SKLPRNASP
RS14_DEIRA       MANKSKLAKQKQREKTVEKYAAKRAELKA--------------AGDYYGL-TQLPRDASP
RS14_CHLMU       MAKKSAVAREVKRRKLVEANFQKRAELRKLAKSLSV--SEEERERAREAL-NKMKRDTSP
RS14_CHLTR       MAKKSAVAREVKRRKLVEANFQKRAELRKLAKSLSV--SEEERERAREAL-NKMRRDTSP
RS14_CHLPN       MAKKSSVAREAKRRRLVEANFKKRSDLRKIVKSLSV--SEEEKENARISL-NKMKRDTSP
RS14_MYCTU       MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSS--APEQRSTAQRAL-ARQPRDASP
RS14_MYCBO       MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSS--APEQRSTAQRAL-ARQPRDASP
RS14_MYCPA       MAKKSKIVKNDRRRATVARYAERRAELKEIIRSPRS--TPEQRTAAQNEL-AHQPRDASA
RS14_STRCO       MAKKSKIAKNEQRREIVARYAARRAELKEVLRRPSS--TEAERLAAQREL-RRQPRDASP
RS14_STRAW       MAKKSKIAKNDRRQETVARYATRRAELTEIIRRPST--PEAERRAAQQEL-RRQPRDASA
RS14_RHOJR       MAKKSKIAKNEQRKIVVARWAERRTELKETIRRPSS--SEDERAEARAAL-QRLPRDASP
RS14_LEIXX       MAKKSKIAKNEQRKVVVERYAAKRAELKKALVDPNG--TDESREAARLGL-QKLPRDASP
RS14_NOCFA       MAKKSKVARNEQRKQIVARYAARRAELKELIRKPST--PEADRAAAQAAL-QRLPRDASP
RS14_CUTAK       MAKKSKIVAQKKREKLVAQYAERRAELKAIMKCPTA--SLDERMEASRKL-SRLPRDSSP
RS14_MYXXD       MAKKSKVARNAQRKALVAKYAKRRAALKARIRDRTL--SYEERRAAQDAL-ASLPRDSNP
RS14_BRUME       MAKTSAVEKNKRREKLVKRHAVKRARLKAIVMDQGL--PLEERFRATIRL-AELPRNSAK
RS14_BRUSU       MAKTSAVEKNKRREKLVKRHAVKRARLKAIVMDQGL--PLEERFRATIRL-AELPRNSAK
RS14_RHIME       MAKTSAVEKNKRRRKLVANHAAKRAVLKAIIMNQSL--PIEERFKATLKL-AELPRDGSK
RS14_RHILO       MAKTSSVEKNNRRRKLADQYGPKRAALKAIIMDQSK--PMEERFRAQLKL-AALPRNSAK
RS14_RHOPA       MAKKSAIEKNNRRKKMTKNAAPKRARLKAIIADKSK--PMEERFAATLKL-AEMPRNSSA
RS14_CAUVC       MAKKSAVNRNEAVKALVKKFAEKRAALKAIANDETL--PLEERFEARLKL-AKLPRNSAA
RS14_RHORT       MAKISAVERNKKRERLTKRDAGKRAELKALIKDRAL--EPEDRFQAVLKL-AQLPRNGSK
RS14_RICCN       MAKVSSIKKNESRKKKSQSLHNKRLALKSKIYDKNI--SLEERFSLVMSL-AQLPRNSSS
RS14_RICPR       MAKVSSIQKNKSRQKKSQSLHNKRSELKSKIYDKSL--SLEQRFPLIIAL-AQLPRNSSS
RS14_WOLPM       MAKKSMIERNLRRIKLCDQYKEKREKLKSIINNKNL--SIVERFTAQNKLIKKLPRNSSK
RS14_ECOLI       MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNA--SDEDRWNAVLKL-QTLPRDSSP
RS14_SHIFL       MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNA--SDEDRWNAVLKL-QTLPRDSSP
RS14_ECO57       MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNA--SDEDRWNAVLKL-QTLPRDSSP
RS14_ECOL6       MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNA--SDEDRWNAVLKL-QTLPRDSSP
RS14_SALTY       MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNA--TDEDRWNAVLKL-QTLPRDSSP
RS14_SALTI       MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNA--TDEDRWNAVLKL-QTLPRDSSP
RS14_HAEIN       MAKQSMKARDVKRVKLAEKFYAKRVELKKIISDVNA--SDEDRWDAVLKL-QTLPRDSSP
RS14_PASMU       MAKQSMKARDVKRVKLAEKFYAKRAELKQIISDVNA--SDEDRWNAVLKL-QTLPRDSSP
RS14_YERPE       MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNS--SDEDRWDAVLKL-QSLPRDSSP
RS14_VIBCH       MAKQSMKAREEKRAKLVAQFAEKRATLKAIISDVNA--SEEDRWNAVLKL-QSLPRDSSR
RS14_BUCAI       MAKQSMKAREVKRVKLANKFYTQRHELKNIISNMSI--SEEERWNAVLKL-QSFPRDSSP
RS14_BUCAP       MAKQSMKAREVKRVKLANKFYAQRIALKNTITNLKL--SEEERWDAVLKL-QIFPRDSSP
RS14_BUCBP       MAKQSMKAREVKRIKLAKKFYSRREHLKSIISDLSV--LEQDRWKAVLKL-QTFPRDSSP
RS14_BAUCH       MTKQSIRAREFKRIILAKKFFAKRIKLKQIISNIHS--SSEERWNAIIKL-QQLPRDSSR
RS14_FRAT1       MAKKSMIQRELKREKLVAKYAQKRAEFKAIILDINS--TEEQIWEAQIKL-QKLPVNSSA
RS14_FRATH       MAKKSMIQRELKREKLVAKYAQKRAEFKAIILDINS--TEEQIWEAQIKL-QKLPVNSSA
RS14_FRATT       MAKKSMIQRELKREKLVAKYAQKRAEFKAIILDINS--TEEQIWEAQIKL-QKLPVNSSA
RS14_FRATO       MAKKSMIQRELKREKLVAKYAQKRAEFKAIILDINS--TEEQIWEAQIKL-QKLPVNSSA
RS14_PSEAE       MAKESMKNRELKRQLTVAKYAKKRAELKAIIANPNS--SAEERWNAQVAL-QKQPRDASA
RS14_XYLFA       MAKISMINRDLKRKRLAKKFADKRLSLKKVISSDAS--SYEEKIEASCKL-QKLPRDSSP
RS14_XYLFT       MAKISMINRDLKRKRLAKKFADKRLSLKKVISSYAS--SYEEKIEASCKL-QKLPRDSSP
RS14_NEIMA       MAKKALINRDLKRQALAKKYAAKRAAIKAVINDSNA--TEEERFEARLRF-QSIPRNAAP
RS14_NEIMB       MAKKALINRDLKRQALAKKYAAKRAAIKAVINDSNA--TEEERFEARLRF-QSIPRNAAP
RS14_RALSO       MAKLSLIEREKKRAKLVAKYAEKRAALEAIVADQSK--SEEERYEARLKL-QQLPRNANP
RS14_DECAR       MAKLALINREEKRRKLVAQYAKKRAALEAIITNVSL--SDEERYEARLKM-QALPRNSSP
                 *:.                    *                         :      .   

RR14_CHLRE       VRLHNRCMITGRPKGYFRDFGLSRHVLREMAHQGLLPGVCKSSW
RR14_CHLVU       VRSHNRCTITGRPRGYFRDFGLSRHVLREYALQGFLPGVVKASW
RR14_MESVI       TRLHNRCSVTGRPKGYYRDFGLSRHVLREMAHECLLPGVTKSSW
RR14_NEPOL       CRLHNRCTITGRPKGYYRDFGLSRHELRAMAHGCLLPGVTKASW
RR14_GUITH       SRLRNRCWVTGRSRGYYRDFGLSRHVLREMVHDCLLPGVTKSSW
RR14_PORPU       VRSRNRCWLTGRSRGYYRDFGLSRHVFREMSHECLLPGVTKSSW
RS14_SYNP6       NRVRNRCWVTGRPRGYYRDFGLCRNVLREMAHQGLLPGVVKSSW
RS14_SYNY3       NRRRNRCQVTGRPRSYYRDFGLCRNVLREWAHQGLLPGVTKSSW
RS14_NOSS1       NRRRNRCWVTGRPRGVYRDFGLSRNVLREWAHEGLLPGVVKSSW
RR14_TRICV       NRIRNRCWKTGRPRGFYRDFGVSRHVLREMAHSCLLPGVTKSSW
RR14_CYAPA       SRVRIRCWLTGRPRGNYRDFGVSRHVLREMAHQGLLPGVTKSSW
RR14_MARPO       TRLHRRCFLTGRPKANYRDFGLSRHLLREMAHACLLPGVTKSSW
RR14_PHYPA       TRLHRRCFLTGRPRANYRDFGLSRHVLREMAHACFLPGVTKSSW
RR14_ANTAG       TRIHRRCFLTGRPRANYRDFNLSRHILREMIHACLLPGVTKASW
RR14_ARATH       TRLHRRCFSTGRPRANYRDFGLSGHILREMVQACLLPGATRSSW
RR14_LOTJA       TRLHRRCFSTGRPRANYRDFGLSGHTLREMVHECLLPGATRSSW
RR14_EPIVI       TRLRRRCFYTGRPRANYRDFGLCGHILREMVNACLLPGATRSSW
RR14_TOBAC       TRLHRRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW
RR14_SPIOL       ARLHRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW
RR14_MAIZE       TRLHRRCFLTGRPRANYRDFGLSGHILREMVYACLLPGATRSSW
RR14_SACOF       TRLHRRCFLTGRPRANYRDFGLSGHILREMVYACLLPGATRSSW
RR14_SACHY       TRLHRRCFLTGRPRANYRDFGLSGHILREMVYACLLPGATRSSW
RR14_ORYNI       TRLHRRCFLTGRPRANYRDFGLSGHILREMVYACLLPGATRSSW
RR14_ORYSA       TRLHRRCFLTGRPRANYRDFGLSGHILREMVYACLLPGATRSSW
RR14_WHEAT       TRLHRRCFLTGRPRANYRHFGLSGHVLREMVYECLLPGATRSSW
RR14_PINTH       TRLHRRCSSTGRPRANYRDFGLSGHILREMAHACLLPGIKKSSW
RR14_ADICA       VRLRNRCSLTGRPRSNYRDFGFSRHVLREMAHTCVLPGVLKSSW
RR14_EUGLO       CRLHNRCYLTGRPRGYYRFFGLSRHIFRDMAHYGLLPGVTKSSW
RR14_EUGGR       CRLRNRCYVTGRSRGYFRTFGLSRHILRDMAHYGLLPGVTKASW
RR14_CYACA       VRLRSRCWVTGRGRSVYKNFGLSRHMFRFMASNGLLPGVVKSSW
RR14_HELSJ       TKLRNRCTLTGRARGVYSEYKISRFVFRNLALNGLLPGVFKASW
RS14B_BACSU      GRLHNRCMVTGRPRAYMRKFKMSRIAFRELAHKGQIPGVKKASW
RS14_BACLD       ARLHNRCEVTGRPRGYMRKFKMSRIAFRELAYKGQIPGVKKSSW
RS14_STAA3       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAA8       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAB       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAC       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAM       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAN       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAS       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAW       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAAR       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAEQ       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAES       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAHJ       TRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
RS14_STAS1       TRLTRRCKVTGRPRGVYRKFGMSRIALRDYAHKGQIPGVKKSSW
RS14_OCEIH       TRLTGRCEVTGRPRGYMRQFKMSRIAFREYAHKGQIPGVKKSSW
RS14_BACSK       SRLTRRCRKTGRPRGVLRDFELSRIAFRELAHKGQIPGVKKASW
RS14_STRP1       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP3       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP6       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRP8       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPC       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPD       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPF       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRPM       NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
RS14_STRA1       NRLKNRDLIDGRPHAYMRKFGMSRINFRNLAYKGQIPGIKKASW
RS14_STRA3       NRLKNRDLIDGRPHAYMRKFGMSRINFRNLAYKGQIPGIKKASW
RS14_STRA5       NRLKNRDLIDGRPHAYMRKFGMSRINFRNLAYKGQIPGIKKASW
RS14_LACS1       IRLKNRDEIDGRPRAYMRKFKMSRINFRELAHQGKIPGVHKASW
RS14_LACLA       NRMKMRDRIDGRPRAYMRKFGMSRVNFRKLAHEGKIPGVKKSSW
RS141_ENTFA      NRLRLRDQTDGRPRGYMRKFGMSRIKFRELAHQGLIPGVKKASW
RS142_ENTFA      SRLKLRDQTDGRPRGYMRKFGMSRIRFRELAHQGLIPGVKKASW
RS14_LACPL       VRIHRRDSLDGRPHAYLRKFGMSRLNFRRLAHAGQIPGVKKASW
RS14_LISIN       TRLHNRCELTGRPHGYMRKFGMSRIRFRELAHQGQLPGVKKASW
RS14_LISMO       SRLHNRCELTGRPHGYMRKFGMSRIRFRELAHQGQLPGVKKASW
RS14_STRPN       TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_STRR6       TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW
RS14_DEIRA       TRLHNRCEFTGRPRGYVRFFGVSRIVLREMAHRGELPGVKKASW
RS14_CHLMU       SRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVIKASW
RS14_CHLTR       SRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGDIPGVVKASW
RS14_CHLPN       TRLHNRCLLTGRPRGYLRKFAISRICFRQMASMGEIPGVIKASW
RS14_MYCTU       VRLRNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW
RS14_MYCBO       VRLRNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW
RS14_MYCPA       VRVRNRDAVDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKASW
RS14_STRCO       TRVRNRDQIDGRPRGYLRVFGLSRVNLREQAHAGHLPGVRKSSW
RS14_STRAW       TRVRNRDSVDGRPRGYHRAFGLSRVNLREQAHAGFLPGVRKSSW
RS14_RHOJR       VRLRNRDAADGRPRGHLRKFGLSRVRVREMAHRGELPGVHKSSW
RS14_LEIXX       IRVRNRDAVDGRPRGNLSKFGISRVRFRDMAHRGELPGITKSSW
RS14_NOCFA       VRLRNRDAADGRPRGHLRKFGLSRVRVREMAHRGELPGVHKSSW
RS14_CUTAK       VRLRNRDQVDGRPRGYVGKAGVSRARFREMAHRGELPGITKSSW
RS14_MYXXD       NRVTNRCALTGRPRGNLRRFGLSRIAFREKALRGEIPGVIKSSW
RS14_BRUME       VRIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_BRUSU       VRIRNRCEVSGRPRGYYRKLKMSRIALRQLGSLGQIPGVVKSSW
RS14_RHIME       TRIRNRCEVTGRPRAYYRKLRMSRIALRELGNLGKVPGVVKSSW
RS14_RHILO       IRIRNRCEVTGRPRAYYRKLKVSRIALRDLGNNGQIPGLVKSSW
RS14_RHOPA       TRIRNRCDLTGRPRSVYRLNKLSRIAIRDLGSRGLVLGLVKSSW
RS14_CAUVC       IRIRNRCEVTGRPRAYYRKLKMSRVALRELGSQGQIPGLVKSSW
RS14_RHORT       TRVHNRCELTGRPHSVYRKFKLGRIMLRDLASQGQIPGMVKSSW
RS14_RICCN       TRIRNRCELTGRPRGVTRKFGISRNKLRELIGRGLVPGVVKSSW
RS14_RICPR       TRIRNRCELTGRPRGVIRKFGISRNKLRELIGRGLVPGVVKASW
RS14_WOLPM       TKIRNRCALTGRPRGVYRKFGLCRIVLRDLCSFGQIPGVTKSSW
RS14_ECOLI       SRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SHIFL       SRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECO57       SRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_ECOL6       SRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALTY       SRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_SALTI       SRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_HAEIN       SRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_PASMU       SRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW
RS14_YERPE       SRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW
RS14_VIBCH       SRQRNRCNQTGRPHGFLRKFGLSRIKVREACMKGEIPGLRKASW
RS14_BUCAI       SRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMKGEIPGLKKASW
RS14_BUCAP       SRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMKGEIPGLKKASW
RS14_BUCBP       IRQRNRCSQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKSSW
RS14_BAUCH       SRQRNRCSQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLRKASW
RS14_FRAT1       SRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATH       SRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATT       SRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_FRATO       SRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW
RS14_PSEAE       SRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKASW
RS14_XYLFA       TRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDVPGLRKASW
RS14_XYLFT       TRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDIPGLRKASW
RS14_NEIMA       VRQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_NEIMB       VRQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW
RS14_RALSO       TRQRNRCSITGRPRGTFRKFGLARNKLREIAFKGEIPGLTKASW
RS14_DECAR       SRLRNRCQLTGRPRGVFRKFGLCRHKIRELAFNGEVPGVVKASW
                  :   *    ** :.      .    .*       : *  ::**