CLUSTAL format seed alignment for MF_00539

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL27_NOSS1      --------------MAHKKGTGSTRNGRDSNAQRLGVKRFGGQAVIAGNILVRQRGTKFH
RL27_SYNE7      --------------MAHKKGTGSTRNGRDSNAQRLGVKKFGGEVVRSGSIIVRQRGTKFH
RL27_SYNY3      --------------MAHKKGTGSTRNGRDSNAQRLGVKRYGGQTVTAGSIIVRQRGTQVH
RL27_HELPY      --------------MAHKKGQGSTQNNRDSAGRRLGVKKFGSEFVRAGNIIVRQRGTKMH
RL27_HELPJ      --------------MAHKKGQGSTQNNRDSAGRRLGVKKFGSEFVRAGNIIVRQRGTKIH
RL27_CAMJE      --------------MAHKKGQGSTQNNRDSIGRRLGVKKFGGEFVRAGNIIIRQRGTATH
RK27_GUITH      --------------MAHKKGSGSTRNGRDSNAQRLGVKKYGGEYVIAGNILIRQRGTNVK
RK27_PORPU      --------------MAHKKGSGSTRNGRDSNSKRLGVKKYGGEQVTAGNILIRQRGTKVK
RK27_TRICV      --------------MAHKKGAGSTKNGRDSNAKRLGVKRFGGQRVKAGNILVRQRGMKFT
RL27_BURPS      --------------MAHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRMH
RL27_RALSO      --------------MAQKKGGGSTRNGRDSESKRLGVKVYGGQAINAGGIIIRQRGTRTH
RL27_PASMU      --------------MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFH
RL27_HAEIN      --------------MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFH
RL27_SALTY      --------------MAHKKAGGSTRNGRDSEAKRLGVKRFGGEAVLAGSIIVRQRGTKFH
RL27_ECOLI      --------------MAHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFH
RL27_YERPE      --------------MAHKKAGGSTRNGRDSESKRLGVKRFGGEAVLAGSIIVRQRGTKFH
RL27_VIBCH      --------------MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKFH
RL27_NEIMA      --------------MASKKAGGSTRNGRDSEAKRLGVKAYGNELIPAGSIIVRQRGTKFH
RL27_PSEAE      --------------MAHKKAGGSTRNGRDSESKRLGVKLFGGQAVKAGNILVRQRGTKFH
RL27_DEIRA      --------------MAHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFK
RL27_XYLFA      --------------MAHKKGVGSSRNGRDSNPKYLGVKLFGGQAIEAGNIIIRQRGTQFH
RL27_BRUME      --------------MAHTKKGGSSRNGRDSESKRLGVKKFGGEAVLAGNIIVRQRGTKWH
RL27_RHIME      --------------MAHKKAGGSSRNGRDSESKRLGVKKFGGEAVIPGNIIVRQRGTKWH
RL27_RHILO      --------------MAHKKAGGSSRNGRDSHSKRLGVKKFGGEAVIPGNIIIRQRGTTWH
RL27_CAUVC      --------------MAHKKSGGSSSNGRDSESKRLGVKKFGGEKVLAGNILVRQRGTKFY
RL27_CHLPN      --------------MAHKKGQGASRNGRDSKSKRLGVKVGAGQKVSTGSILVRQRGTRWN
RL27_CHLTR      --------------MAHKKGQGASRNGRDSESKRLGLKVGAGQRVSTGSILVRQRGTKWH
RL27_LAWIN      --------------MAHKKAGGSSRNGRDSPGQRRGIKRFGGQKVLAGNILVRQLGTKIH
RL27_RICCN      --------------MATKKAGGSSRNGRDSAGRRLGVKKADGQYVIPGNIIVRQRGTKIH
RL27_RICPR      --------------MATKKAGGSSRNGRDSAGRRLGVKKSDGQYVIPGNIIVRQRGTKIH
RK27_CYACA      --------------MAHKKGSGSSKNGRDSNAKYLGIKKFGKQIVTPGQIIVRQRGTKIK
RL27_BORBU      --------------MATSKSGGSSKNGRDSISKRLGVKRSGGQFVKAGEIIVRQRGTKFH
RL27_BUCAI      --------------MAHKKAGGSTRNGRDSNAQRLGVKCFGGQLISAGSIIVKQRGTKFH
RL27_AQUAE      --------------MASKASGGSTRNGRDSISKRLGVKRYDGQFVKAGNIIVRQRGTRIY
RL27_THEMA      --------------MAHKKSGGVAKNGRDSLPKYLGVKVGDGQIVKAGNILVRQRGTRFY
RK27_CHRCT      --------------MAHKKGAGSTKNGRDSNSKRLGVKVYGDQPVKKGGIIIRQRGLTFK
RL27_STRCO      --------------MAHKKGASSTRNGRDSNAQRLGVKRFGGQAVNAGEILVRQRGTHFH
RL27_STRGR      --------------MAHKKGASSTRNGRDSNAQRLGVKRFGGQAVNAGEILVRQRGTHFH
RL27_MYCLE      --------------MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFH
RL27_MYCTU      --------------MAHKKGASSSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFH
RL27_TREPA      --------------MARKRGGSGSKNGRDSNPKYLGVKLFGGQHARAGSILVRQRGTRIH
RL27_STAAM      ------MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIY
RL27_STAAN      ------MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIY
RL27_BACSU      ------MLRLDLQFFASKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIY
RL27_LISMO      ------MLKFDIQHFAHKKGGGSTSNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIY
RL27_BACHD      ------MLKMNLQFFASKKGVGSTKNGRDSISKRLGTKRADGQLVTGGSILVRQRGTRIY
RL27_STRPN      ------MTLNNLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVTGGSILYRQRGTHIY
RL27_STRP1      ------MNLANLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGGSILYRQRGTHIY
RL27_LACLA      ------MLELNLQLFAHKKGGGSTSNGRDSQAKRLGAKASDGELVSGGSILFRQRGTHIH
RL27_CLOAB      ------MLSINLSLCAHKKGMGSSKNGRDSESKRLGVKASDGEFVLAGNIIVRQRGTKIH
RL27_CLOPE      ------MLKMNLQLFAHKKGVGSSKNGRDSEAKRLGVKCADGQFVLAGNILVRQRGTKIH
RL27_MYCPU      --------------MAKTKAGGSTRNGRDSKGRRLGAKLGDGQFALAGSIIYRQRGTKIF
RL27_MYCGE      MSKNSYCYQINLQFFASKKGVGSTKNGRDSHSKRLGAKKADGQMIRVGQIIYRQRGTKIF
RL27_MYCPN      MNNKYFLTKIDLQFFASKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVY
RL27_UREPA      --MNKLYWLTDLQLFASKKGVGSSKNGRDSNPKYLGAKLGDGQSTKAGQIIYRQRGNKIY
                               * .   . : *.***  :  * *    :    * *: :* *    

RL27_NOSS1      AGNNVGIGKDDTLFALVDGVVTFERKG--KSRKKVSVYPAAAAEAVAS---------
RL27_SYNE7      PGVNVGRGGDDTLFALIDGVVTFERKG--KGGKKVSVYPAGEAA-------------
RL27_SYNY3      PGNNVGRGKDDTLFALIDGVVKFEHKT--RSRRKVSVYPATAE--------------
RL27_HELPY      PGNNVGMGKDHTLYALIDGVVKFEHKD--RNRKKVSVVSQNFGE-------------
RL27_HELPJ      PGNNVGMGKDHTLYALIDGVVKFEHKD--RSRKKVSVISGNFGE-------------
RL27_CAMJE      AGNNVGMGKDHTIFALIDGFVKFERKD--KDRKKVSVYPA-----------------
RK27_GUITH      AGFNVGIGKDNTLYSLINGEVKFERFD--KKRKKISVYPCLD---------------
RK27_PORPU      PGQNVGKGKDDTLFALIDGFVLFEKSN--QKQKTISVYSSKN---------------
RK27_TRICV      PGLNVGCGKDFTLYALTDGIVNFDYKN--AQQKRINIIG------------------
RL27_BURPS      AGENVGMGKDHTLFALVDGHVKFTTKGA-AKKHTVVVVPAAA---------------
RL27_RALSO      AGVNVGMGKDHTLFALVDGHVKFATRGE-GKKQFVDVVPAA----------------
RL27_PASMU      AGSNVGMGRDHTLFATADGKVKFEVKGE-KNRKYVSIIAE-----------------
RL27_HAEIN      AGNNVGMGRDHTLFATADGKVKFEVKGE-KSRKYVVIVTE-----------------
RL27_SALTY      AGTNVGCGRDHTLFAKADGKVKFEVKGP-KNRKYISIVAE-----------------
RL27_ECOLI      AGANVGCGRDHTLFAKADGKVKFEVKGP-KNRKFISIEAE-----------------
RL27_YERPE      AGINVGCGKDHTLFALADGKVKFEVKGP-KNRKFISIEAE-----------------
RL27_VIBCH      AGTNVGIGKDHTLFALSDGKVKFEVKGP-NNRKFVSIETAE----------------
RL27_NEIMA      AGDNVGMGKDHTLFAKVDGYVEFKTKGA-LNRKTVSIRPYTGSEE------------
RL27_PSEAE      AGYGVGLGKDHTLFAKVDGVVKFETKGA-FGRKYVSIVAA-----------------
RL27_DEIRA      AGQGVGMGRDHTLFALSDGKVVFINKG--KGARFISIEAAQTEVAAD----------
RL27_XYLFA      AGDGVGLGRDHTLFALVDGTVAFSIKGP-KKRRTVNVIPA-----------------
RL27_BRUME      PGANVGLGKDHTIFATVNGSVSFRTKA--NGRTYVSVNPIAEAAE------------
RL27_RHIME      AGANVGLGKDHTIFALTTGNVDFRKKA--NGRVYVSVMPKAEAAE------------
RL27_RHILO      PGVNVGMGTDHTLFALESGAVTFNKKA--NGRTYVSVNPITKAAE------------
RL27_CAUVC      PGSGVGIGKDHTLFALVQGAVGFVTKK--HNRTYVTVTPAAQPAE------------
RL27_CHLPN      PAQNVGRGRDDTLFALVDGIV--VMKK--TNRTYISVVPEQL---------------
RL27_CHLTR      PAVNVGRGKDDTLFALVDGIV--VMKK--TDRTYVSVIPQA----------------
RL27_LAWIN      PGENVGMGRDYTLFAKVNGIVTYETYFR-KCKRYSRVHIQPTV--------------
RL27_RICCN      PGTNVGLGKDHTIFALIEGRVEFLTKR---NHKIVNVKEIAST--------------
RL27_RICPR      PGINVGLGKDHTIFSLIEGRVEFLTKQ---SHKIVNVKEIANV--------------
RK27_CYACA      PGLNVGLGRDYTIFSMIAGRVNYSTQK---NKKIVSVDPSYGKIQAIEIRKASHFAT
RL27_BORBU      KGKNVGLGRDYTIFALSSGKVEFKT-----LKGRKYVSIV-----------------
RL27_BUCAI      PGKNVGCGKDHTIFAIVKGKVEFKKKG---LKKRTYINIIN----------------
RL27_AQUAE      PGKNVGMGSDYTLFALKDGYVYFETRR---KKKFVSVLSPEEWEKVMAQKNGKVH--
RL27_THEMA      PGKNVGMGRDFTLFALKDGRVKFETKN---NKKYVSVYEE-----------------
RK27_CHRCT      PGINVAVGRDYTLFALQEGDVKFETIA---DRKFVSVIK------------------
RL27_STRCO      PGAGVGRGGDDTLFALQAGAVQFGTHR---GRKVVNIVPVA----------------
RL27_STRGR      PGTGVGRGGDDTLFALAAGAVQFGTHR---GRKVVNIVPLAV---------------
RL27_MYCLE      PGVNVGRGGDDTLFATSAGAVEFGVKR---GRKTVNIVAVGLTAD------------
RL27_MYCTU      PGVNVGRGGDDTLFAKTAGAVEFGIKR---GRKTVSIVGSTTA--------------
RL27_TREPA      PGENVGRGKDDTLFALAPGVVTYLQRK---GRRLVSVCVENRPS-------------
RL27_STAAM      PGENVGRGGDDTLFAKIDGVVKFERKG--RDKKQVSVYAVAE---------------
RL27_STAAN      PGENVGRGGDDTLFAKIDGVVKFERKG--RDKKQVSVYAVAE---------------
RL27_BACSU      PGENVGRGGDDTLFAKIDGTVKFERFG--RDRKKVSVYPVAQ---------------
RL27_LISMO      PGTNVGRGGDDTLFAKTDGVVRFERMG--RDKKKVSVYPEVQEA-------------
RL27_BACHD      PGVNVGKGGDDTLFAKVDGVVKFERVG--RDRKQVSVYPKAQ---------------
RL27_STRPN      PGVNVGRGGDDTLFAKVEGVVRFERKG--RDKKQVSVYPIAK---------------
RL27_STRP1      PGVNVGRGGDDTLFAKVEGVVRFERKG--RDKKQVSVYPVAK---------------
RL27_LACLA      PGTNVGRGGDHTLFAKIEGTVKFEMK---RGKKHVSVYPVVAK--------------
RL27_CLOAB      PGVNVGRGKDDTLFAKADGLVKFEKRG--KDKKFASVYPVEIEQSVAE---------
RL27_CLOPE      PGANVGKGGDDTLFAKIDGVVKYERLG--RDKKKASVYPVNVEEVIAE---------
RL27_MYCPU      PGQNVGRGNDDTLFMLVDGYVKYEKR---RNRKYASVYQEKK---------------
RL27_MYCGE      AGQNVAMGSDNTLFALSDGIVRFQKFGSKQSKTRVNIIKHQLNA-------------
RL27_MYCPN      PGVNVGLGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKLDA-------------
RL27_UREPA      PGLNVGQGKDHTLFAKTAGVVKYTKF--MGDKTKVSVLPKEDNN-------------
                 . .*. * * *::    * *               :