CLUSTAL format seed alignment for MF_00541

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RHAA_ECO57      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGG
RHAA_ECOLI      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGG
RHAA_ECOL6      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGG
RHAA_SHIFL      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGG
RHAA_SALTI      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVAGFENPEGSLTGG
RHAA_SALTY      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVAGFENPEGSLTGG
RHAA_SALPA      --MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVAGFENPEGSLTGG
RHAA_YERPE      --MTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGDDVTGFEDPDGVLTGG
RHAA_YERPS      --MTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGDDVTGFEDPDGVLTGG
RHAA_PECAS      --MSTPIEAAWQLAKTRYAGLNIDVEAALKQLDQIPVSMHCWQGDDVAGFENTGGPLTGG
RHAA_MANSM      ---MSTVQQAYELAKKQFADIGVDTEQALALLDQLPISMHCWQGDDVSGFEQGAGALSGG
RHAA_RHOBA      MNRAGNIEKAFELAREEYQAIGVDVDSALQRMRDVEISVHCWQGDDVKGFEGDDGALGNG
RHAA_BACTN      MKKEEMIQKAYEIAVERYAAVGVDTEKVLKTMQDFHLSLHCWQADDVTGFEVQAGALSGG
RHAA_BACSU      ----MTIKANYDSAKQAYEKWGIDVEEALRQLEQVPISIHCWQGDDIEGFEVNKGELSGG
RHAA_OCEIH      ----MDVKQNYEQAKKQYEKWGVNVEDALEKLKQIPISIHCWQGDDVTGFEVNQQELSGG
RHAA_BACHD      ----MSMKSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELSKGELSGG
RHAA_LISIN      MGQETEISKRYQVAKERYQAIGVDTEKALKTLKDIKISMHCWQGDDVKGFLNPDGELTGG
RHAA_LISMO      MGQETEINKRYQVAKERYQAIGVDTEKALKTLKDIKISMHCWQGDDVKGFLNPDGELTGG
RHAA_LISMF      MGHETEISKRYQVAKERYQAIGVDTENALKTLKDIKISMHCWQGDDVKGFLNPDGELTGG
RHAA_ENTFA      ---MTTITQKYEEAKEKYASIDVDTEAVLEKMADVKISMHVWQGDDVRGFLSED-ELSGG
RHAA_LACPL      MVKTDEVEKAYQVAKERYAEIGVDTEKAMEALKKVKLSVHCWQGDDIHGFLNPDQELTGG
                      :   :: *   :   .::.: .:  :  . :*:* **.**: **      * .*

RHAA_ECO57      IQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVS-RDQIKPEHFKN
RHAA_ECOLI      IQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVS-RDQIKPEHFKN
RHAA_ECOL6      IQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVA-RDQIKPEHFKN
RHAA_SHIFL      IQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVS-RDQIKPEHFKN
RHAA_SALTI      IQSTGNYPGKARNATELRADLEQALRLIPGPKRLNLHAIYLESDTPVA-RDQIKPEHFKN
RHAA_SALTY      IQSTGNYPGKARNATELRADLEQALRLIPGPKRLNLHAIYLESDTPVA-RDQIKPEHFKN
RHAA_SALPA      IQSTGNYPGKARNATELRADLEQALRLIPGPKRLNLHAIYLESDTPVA-RDQIKPEHFKN
RHAA_YERPE      IQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESDTPVA-RNKIEPRHFSH
RHAA_YERPS      IQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESDTPVA-RNKIEPRHFSH
RHAA_PECAS      IQATGNYPGKASTPDELRADLEQAFALIPGPKRLNLHAIYLESAQPVA-RNEIAPEHFSN
RHAA_MANSM      IQTTGNYPGKARTPQELRADLDKAVSLIPGKKRLNLHASYLEADHRVD-RNEVKPEHFAN
RHAA_RHOBA      LAVTGNYPGRARTIDELQSDLELAYSLIPGNHRLNLHALYGEFKGRVD-RDEIEVEHFQG
RHAA_BACTN      IQATGNYPGKARNIDELRADILKAASYIPGTHRLNLHEIYGDFQGKVVDRDQVEPEHFKS
RHAA_BACSU      IDVTGNYPGKAQTPEELRRDLEKALSLIPGKHRVNLHAIYAETNREAVERDELKPQHFEN
RHAA_OCEIH      IDVTGNYPGKATTPEELRDDLDKALSLIPGMHRVNLHAIYAETNGEAVERDEIEPKHFEN
RHAA_BACHD      IDVTGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEK
RHAA_LISIN      IMATGNYPGAAHTPKQLRQDLEKAYSLIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTP
RHAA_LISMO      IMATGNYPGAAHTPKQLRQDLEKAYSLIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTP
RHAA_LISMF      IMATGNYPGAAHTPKQLRQDLEKAYSLIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTP
RHAA_ENTFA      ISVTGNYPGVARSPQQLRQDLEKAFSLIPGKHKLNLHAIYLDTE-ERVDLNELEPKHFEP
RHAA_LACPL      IGVSGDYPGIARTPDQLTGDLHEALSLIPGSHKVALHTLYAVTD-KKKDFNEVGPEDFKY
                :  :*:*** * .  :*  *:  *   *** ::: **  *          :::  ..*  

RHAA_ECO57      WVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLG
RHAA_ECOLI      WVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLG
RHAA_ECOL6      WVEWAKTNQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLG
RHAA_SHIFL      WVEWAKANQLGLDFNPSCFSHPLSADGFTLSHPDDSIRQFWIDHCKASRRVSAYFGEQLG
RHAA_SALTI      WVEWAKANRLGLDFNPTCFSHPLSADGFTLSHPDAKIRQFWIDHCKASRRVSAYFGEQLG
RHAA_SALTY      WVEWAKANRLGLDFNPTCFSHPLSADGFTLSHPDAKIRQFWIDHCKASRRVSAYFGEQLG
RHAA_SALPA      WVEWAKANRLGLDFNPTCFSHPLSADGFTLSHPDAKIRQFWIDHCKASRRVSAYFGEQLG
RHAA_YERPE      WVAWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIEHCQASRRVSAYFGEQLG
RHAA_YERPS      WVTWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIEHCQASRRVSAYFGEQLG
RHAA_PECAS      WVAWAKRHQLGLDFNPTCFSHPLSADGFTLSHPDEKVRRFWIEHCQASRRISAYFGRELG
RHAA_MANSM      WVAWAKANNMGLDFNPTYFSHPLSAEA-TLSHQNKEIRDFWIEHGKACRKISEYFGKELG
RHAA_RHOBA      WIDWARDQKVRLDFNPSYFSHPNAADGFTLAHADSGIRQFWIDHGIACRKIAAAMGAAQS
RHAA_BACTN      WIEWGKEHNMKLDFNSTSFSHPKSGDL-SLSNPDEGIRQFWIEHTKRCRAVAEEMGKAQG
RHAA_BACSU      WVKWAKNLGLGLDFNPTLFSHEKAADGLTLSHPDPDIREFWIRHCIACRRIGEYFGKELG
RHAA_OCEIH      WVKWAKENGLGLDFNPTLFSHPKADDGLTLAHPNKEIRDFWIRHTIASRKIAAYMGKELG
RHAA_BACHD      WVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELE
RHAA_LISIN      WVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEHGKRSRKISEYFGKELG
RHAA_LISMO      WVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEHGKRSRKISEYFGKELG
RHAA_LISMF      WVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEHGKRSRKISEYFGKELG
RHAA_ENTFA      WVTWAKENGLGLDFNPTFFSHPMYRDGFTLAHPNPQVRDFWIEHGKRSRRIAEYFGRELG
RHAA_LACPL      WVDWAKQEGIGLDMNPTFFSHPMVKHNFTLASPEKSVRDYWIEVGKKSREIANYFGQELG
                *: *.:   : **:*.: ***    .  :*:  :  :* :**     .* :.  :*    

RHAA_ECO57      TPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLDPAHHIDAVESKLFGIGAESY
RHAA_ECOLI      TPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESY
RHAA_ECOL6      TPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLDPAHHIDAVESKLFGIGAESY
RHAA_SHIFL      TPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESY
RHAA_SALTI      TPSVMNIWIPDGMKDITVDRLAPRQRLLEALDEVISEKFDPAHHIDAVESKLFGIGAESY
RHAA_SALTY      TPSVMNIWIPDGMKDITVDRLAPRQRLLEALDEVISEKFDPAHHIDAVESKLFGIGAESY
RHAA_SALPA      TPSVMNIWIPDGMKDITVDRLAPRQRLLEALDEVISEKFDPAHHIDAVESKLFGIGAESY
RHAA_YERPE      TPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNPAHHIDAVESKLFGIGAESY
RHAA_YERPS      TPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNPAHHIDAVESKLFGIGAESY
RHAA_PECAS      TPSVMNIWVPDGMKDLTIDRLAFRQRLLSALDEVIAEPLDQTHHIDAVESKLFGIGAESF
RHAA_MANSM      TASVMNIWIPDGSKDFVVDKFAPRQRLVEALDEIIAEKIDAKYHLDAVESKLFGIGVESY
RHAA_RHOBA      NPCINNFWVPDGYKDVPADRKAPRERLADSLDSIFATEYPAEQTLDAVECKLFGIGSESY
RHAA_BACTN      DPCIMNLWVHDGSKDITVNRMKYRALLKDSLDQIFATEY--KNMKDCIESKVFGIGLESY
RHAA_BACSU      TPCLTNIWIPDGYKDIPSDRLTPRKRLKESLDRIFSEEISEQHNLDSIESKLFGLGSESY
RHAA_OCEIH      TSALTNIWTPDGYKDIPSDRLTPRKRLEDSLNQIFEEEIDKEYNVDAVESKLFGIGSEAY
RHAA_BACHD      TPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESY
RHAA_LISIN      QTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAY
RHAA_LISMO      QTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAY
RHAA_LISMF      QTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAY
RHAA_ENTFA      QVAVNNFWVPDGFKDNPVDRLTPRKRLMASLDEIFSEEIDPAYTVDAMESKLFGIGSEAY
RHAA_LACPL      QQSVNNFWIPDGFKDNPIDKQAPRERLIESLDEVFAKKYDEKNTIEAVEGKLFGTGIESY
                  .: *:*  ** **   ::   *  *  :*: ::          :.:* *:** * *::

RHAA_ECO57      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDH
RHAA_ECOLI      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDH
RHAA_ECOL6      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDH
RHAA_SHIFL      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDH
RHAA_SALTI      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPRLLLHVSRPVRWDSDH
RHAA_SALTY      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPRLLLHVSRPVRWDSDH
RHAA_SALPA      TVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPRLLLHVSRPVRWDSDH
RHAA_YERPE      TVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSAMLYVPRLLLHVSRPVRWDSDH
RHAA_YERPS      TVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSAMLYVPRLLLHVSRPVRWDSDH
RHAA_PECAS      TVGSSEFCLGYAASRGTALCLDAGHFHPTEVISDKISSAILYVPRLLLHVSRPVRWDSDH
RHAA_MANSM      TVGSNEFYAAYAVSRGTALCLDAGHFHPTEVISDKISAVMPFVQHLLLHVSRPVRWDSDH
RHAA_RHOBA      VVGSHEFYMGYAMSRYKVLCLDAGHFHPTETISDKISAVMMYVPELLLHVSRGVRWDSDH
RHAA_BACTN      TVGSNDFYIGYGASRNKMVTLDTGHFHPTESVADKVSSLLLYVPELMLHVSRPVRWDSDH
RHAA_BACSU      VVGSHEFYLAYALTNHKLCLLDTGHFHPTETVSNKISSMLLYTDKLALHVSRPVRWDSDH
RHAA_OCEIH      VVGSHEFYMGYALKNNKLCLLDTGHYHPTEMVSNKISSMLLYSDELALHVSRPVRWDSDH
RHAA_BACHD      VVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDH
RHAA_LISIN      TVGSHEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDH
RHAA_LISMO      TVGSHEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDH
RHAA_LISMF      TVGSHEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDH
RHAA_ENTFA      TVGSHEFYMGYGLTRNKLICLDAGHFHPTEVISNKLSSLSLFGEGMLLHVSRPVRWDSDH
RHAA_LACPL      TVGSHLFYNNYAISRGKLWTIDAGHWHPTEDVSDKFSAFMPFGKGLMLHVSRPIRWDSDH
                .***  *   *. .. .   :*:**:**** :::*.*:   :   : ***** :******

RHAA_ECO57      VVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWIIGTRNMKKALLRALLEPT
RHAA_ECOLI      VVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPT
RHAA_ECOL6      VVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPT
RHAA_SHIFL      VVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPT
RHAA_SALTI      VVLLDDETQAIASEIVRHNLFDRVHIGLDFFDASINRVAAWVIGTRNMKKALLRALLEPT
RHAA_SALTY      VVLLDDETQAIASEIVRHNLFDRVHIGLDFFDASINRVAAWVIGTRNMKKALLRALLEPT
RHAA_SALPA      VVLLDDETQAIASEIVRHNLFDRVHIGLDFFDASINRVAAWVIGTRNMKKALLRALLEPT
RHAA_YERPE      VVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPT
RHAA_YERPS      VVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPT
RHAA_PECAS      VVLLDDETQAIAHEIIRHQLLNRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPT
RHAA_MANSM      VVLLDDETQAIAGEIIRNQLFDRVHIGLDFFDASINRIAAWVIGTRNMQKALLRALLEPT
RHAA_RHOBA      VVTYSDELQSIMQEVVRGDYLGRVHIGLDFFDASINRVAAWAIGTRNALKAVLAALLEPT
RHAA_BACTN      VTIMDDPTMELFSEIVRCGALERVHYGLDYFDASINRIGAYVIGSRAAQKCMTRALLEPI
RHAA_BACSU      VVVLDDELREIALEIVRNHALEKVAIGLDFFDASINRVAAWTIGTRNMIKALLYALLLPN
RHAA_OCEIH      VVILDDELREIGLEIVRNDALDKVRIGLDFFDASINRIAAWTIGTRNMIKSLLYALLTPN
RHAA_BACHD      VVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPH
RHAA_LISIN      VVIMDDELIEIGRELVRNDLLGITNIGLDFFDATINRIAAWVVGTRNTQKSLLKALLEPT
RHAA_LISMO      VVIMDDELIEIGRELVRNDLLGITNIGLDFFDATINRIAAWVVGTRNTQKSLLKALLEPT
RHAA_LISMF      VVIMDDELIEIGRELVRNDLLGITNIGLDFFDATINRIAAWVVGTRNTQKSLLKALLEPT
RHAA_ENTFA      VVIMDDELQEIAKELVRNDLLGKTHVGLDFFDATINRVAAWVIGTRNTQKALMKAMLEPT
RHAA_LACPL      VVIFDEALQRITRSLVRDNELERTNIGLDFFDATINRVSAWVIGARATQKALLQAMLAPI
                *.  .:    :  .::*   :  .  ***:***:***:.*: :*:*   *.:  *:* * 

RHAA_ECO57      AELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKETLSR
RHAA_ECOLI      AELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSR
RHAA_ECOL6      AELRKLEAAGDYTARLALLEEQKSLPWQAVWKMYCQRHDTPAGSEWLENVRAYEKEILSR
RHAA_SHIFL      AELRKLEAAGDYTARLALLEEQKSLPRQAVWEMYCQHHDTPAGSEWLESVRAYEKAILSQ
RHAA_SALTI      DQLRQLEASGDYTARLAMLEEQKSLPWQAVWEMYCQRHDTPAGSQWLDSVRTYEKEILSK
RHAA_SALTY      DQLRQLEASGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSQWLDSVRVYEKEILSK
RHAA_SALPA      DQLRQLEASGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSQWLDSVRAYEKEILSK
RHAA_YERPE      DRLRQLELRGDYTARLALLEEQKSLPWQAIWEGYCQRNDVPVDARWLDAVREYEQQILSQ
RHAA_YERPS      DMLRQLELRGDYTARLALLEEQKSLPWQAIWEGYCQRNDVPVDARWLDAVREYEQQILSQ
RHAA_PECAS      ETLRKLEQNGDYTARLALLEEQKSLPWQAVWEHYCQRHDVIPGSEWLQQVRQYEETILTQ
RHAA_MANSM      DELRALENARDFGSRLALLEEQKSLPWQAVWDMYCERHNVPVGRRWLDEVRAYEKTVLSQ
RHAA_RHOBA      EQLRKMELEGDLTGRLALLEEQKTLPLGAVWNHYCQSVDVPAGSDWLENVRQYESQVLSQ
RHAA_BACTN      AKLREYEANGQGFQRLALLEEEKALPWNAVWDMFCLKNNVPVGEDFIAEIEKYEAEVTSK
RHAA_BACSU      GYLKQLQEEGRYTERLALMEEFKTYPFGAIWDSYCEQMGVPVKEAWLYDIKEYEQQVLLK
RHAA_OCEIH      EHLKQLQEEGNFTDRLAIMEELKTYPFGAIWDYYCESMNVPVGESWLTEVKEYEKEVLSK
RHAA_BACHD      KQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQ
RHAA_LISIN      ADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGLDWLKEVKAYEKDVLLK
RHAA_LISMO      ADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGLDWLKEVKAYEEDVLLK
RHAA_LISMF      ADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGLDWLKEVKAYEEDVLLK
RHAA_ENTFA      NVLKEAELIGDFTTRLALTEELKDFPFADIWNYYCQENHVPIGLDWLTDVQEYEKVILPT
RHAA_LACPL      DDLKKAELNYDFTKRLAVTEELKSFPFGAVWDEFCLKNNTPVGTDWLDEIHNYEQKVQFP
                  *:  :       *:*: ** *  *   :*. :*    .     ::  :  **      

RHAA_ECO57      RG-----------
RHAA_ECOLI      RG-----------
RHAA_ECOL6      RG-----------
RHAA_SHIFL      RG-----------
RHAA_SALTI      RS-----------
RHAA_SALTY      RS-----------
RHAA_SALPA      RS-----------
RHAA_YERPE      R------------
RHAA_YERPS      R------------
RHAA_PECAS      RQG----------
RHAA_MANSM      RV-----------
RHAA_RHOBA      RSDSSALV-----
RHAA_BACTN      R------------
RHAA_BACSU      RKASSPIV-----
RHAA_OCEIH      R------------
RHAA_BACHD      RH-----------
RHAA_LISIN      R------------
RHAA_LISMO      R------------
RHAA_LISMF      R------------
RHAA_ENTFA      RQLPTGKDSCRFS
RHAA_LACPL      RDKKVVTE-----
                *