CLUSTAL format seed alignment for MF_00544

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TNAA1_SYMTH      ---------------MPKGEPFKIKMVEPIRLIPREDRERALKEAHYNPFFLRSSDVYID
TNAA2_SYMTH      ---------------MPKGEPFKIKMVEPIRLIPREDREAAIKAAHYNPFLLRSSDVYID
TNAA_CALS4       ----------MYDDLTRMAEPYKIKMVEPLKITTREERIRLIKEAGYNLFLLKSDDVYID
TNAA_CLOTE       MIIYYLKLEGFNMKIKYVAEPFRIKMVEPIKMLTREERELKIAEAKYNTFNLRGEDVYID
TNAA_SHESH       --------------MKRIPEPFRIKMVESIKMTNLEDREQALTQAGLNPFLLRSEDVYID
TNAA_VIBPA       --------------MKRIPEPFRIKMVEPIKMTTLADREIALKEAGYNPFLLRSDDVYID
TNAA_CITK8       --------------MKRIPEPFRIKMVENIRMTTWDDRVKALEEAGYNPFLLRSDDVYID
TNAA_KLEAE       --------------MKRIPEPFRIKMVENIRMTTFDDRVKALKEAGYNPFLLNSQDVYID
TNAA_YERE8       --------------MKRIPEPFRIKMVENIRMTNREDREKALIEAGYNPFLLPSEDVYID
TNAA_PHOLL       --------------MKRIPEPFRIKMVENIRMTTRAEREKALEEAGYNPFLLPSDAVYID
TNAA_AERHH       --------------MRRIPEPFRIKMVEPIKQTTGAERRAALEAAGWNPFLLLAEDVYID
TNAA_AERS4       --------------MRRIPEPFRIKMVEPIKQTTGAERRAALEAAGWNPFLLLAEDVYID
TNAA_CHRVO       -------------MARRIPEPFRIKMVEPIRQTTAEYRRQALQEAGWNPFLLKAEDVYID
TNAA_DESVV       --------------MKRIPEPFRIKMIEPIRMTTLEDRTRALEEAGYNPFLLKSEDVYID
TNAA_DESVH       --------------MKRIPEPFRIKMIEPIRMTTLEDRTRALEEAGYNPFLLKSEDVYID
TNAA_PROIN       -------------MAKRIVEPFRIKMVENIRIPSREEREVALKEAGYNPFLLPSSAVYID
TNAA_PROVU       -------------MAKRIVEPFRIKMVEKIRVPSREEREAALKEAGYNPFLLPSSAVYID
TNAA_ECO24       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOLC       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOLI       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO27       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO8A       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO7I       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_SHIF8       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECODH       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO81       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO55       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_SHIFL       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOBW       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOL5       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO45       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOLU       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOSE       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOHS       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_SHIB3       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDREDVFID
TNAA_ECOL6       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO5E       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECO57       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ECOSM       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_ESCF3       -----------MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFID
TNAA_HAES1       -----------MENFKHLPEPFRIRVIEPVKRTTRAYRDEAILKAGMNLFLLDSEDIFID
TNAA_HISS2       -----------MENFKHLPEPFRIRVIEPVKRTTRAYRDEAILKAGMNLFLLDSEDIFID
TNAA_PASMU       -----------MENFKHLPEPFRIRVIEPVRRTTRSYREEAILKAGMNPFLLDSEDVFID
TNAA_HAEI8       -----------MENFKHLPEPFRIRVIEPVKRTTREYREQAMLKSGMNPFLLDSEDIFID
TNAA_HAEIF       -----------MENFKHLPEPFRIRVIEPVKRTTREYREQAILKSGMNPFLLDSEDIFID
TNAA_VIBCM       -----------MENFKHLPEPFRIRVIEPVKRTTREYREKAILNAGMNPFLLDSEDVFID
TNAA_VIBCH       -----------MENFKHLPEPFRIRVIEPVKRTTREYREKAILNAGMNPFLLDSEDVFID
TNAA_VIBC3       -----------MENFKHLPEPFRIRVIEPVKRTTREYREKAILNAGMNPFLLDSEDVFID
TNAA_VIBVU       -----------MDNFKHLPEPFRIRVIEPVKRTTREYREEAILKAGMNPFLLDSEDVFID
TNAA_VIBVY       -----------MDNFKHLPEPFRIRVIEPVKRTTREYREEAILKAGMNPFLLDSEDVFID
TNAA_RHOCA       --------------MKTIIEPFRIKSVEPIRLTSRPERERLARAAGYNLFGLHSDDVLID
TNAA_HYPNA       --------------MKTIIEPFRIKSVEPIRMTTREERARLLEAAGFNLFKLHSDDVIID
TNAA_SALRD       --------------MDTIIEPFRIKSVEPIQLTSRAERERMIRDAHYNLFNLHADDVIID
TNAA_HALS3       ------------------MRSHTATMVDRIEDTSRADREAALADAGHNVFELASDDVAVD
TNAA_HALSA       ------------------MRSHTATMVDRIEDTSRADREAALADAGHNVFELASDDVAVD
TNAA_AERPE       --------MPILPSPNPPVEPYKIRMVEPIRLLPREERLRRLREAGWNVFRLRSIDIFID
                                    ...    :: :.      *      :  * * *    : :*

TNAA1_SYMTH      LLTDSGTGAMSQFQWSAMMLGDESYAGASSYYRLKETVTDITGYEYVIPTHQGRGAEKVA
TNAA2_SYMTH      LLTDSGTGAMSQFQWSAMMLGDESYAGASSYYRLKEAVTDITGYEYVLPTHQGRGAEKSA
TNAA_CALS4       LLTDSGTAAMSDYQWAGMMLGDESYAGSRNYQHLCEVVQDIFGYKYVVPTHQGRGAEKVL
TNAA_CLOTE       LLTDSGTNAMSDDQWAGVMKGDEAYAGGKSYFKLVDAVKDIFGYKFVQPVHQGRAAEKVL
TNAA_SHESH       LLTDSGTGAMSDVQWAGLMMGDESYAGSRNYFNLCESVEHFFGYKLTVPVHQGRGAEQIL
TNAA_VIBPA       LLTDSGTGAMSDNQWAGIMLGDESYAGSRNYYNLCSAVEHFFGYKLTVPAHQGRGAEQIL
TNAA_CITK8       LLTDSGTGAMSDRQWSGLMMGDEAYAGSRNYYHLCDKVKELIGYPFTIPTHQGRGAEQIL
TNAA_KLEAE       LLTDSGTGAMSDHQWAGLMMGDEAYAGSRNYQHLCEKVKEIIGYPYTIPTHQGRGAEQIL
TNAA_YERE8       LLTDSGTGAMSDRQWAGLMMGDEAYAGSRNYYHLCDQVKKLIGYPFTIPTHQGRGAEQIL
TNAA_PHOLL       LLTDSGTGAMSDRQWAGIMMGDEAYAGSRNYYHLCDKVNELIGYQYTIPTHQGRGAEQIL
TNAA_AERHH       LLTDSGTGAMSDRQWAGIMMGDEAYAGSRNFVELERAVREIFGYQHVMPTHQGRGAEQIL
TNAA_AERS4       LLTDSGTGAMSDRQWAGIMMGDEAYAGSRNFVELERTVRELFGYQHVMPTHQGRGAEQIL
TNAA_CHRVO       LLTDSGTGAMSDRQWAGLMMGDEAYAGSRNFLRLADTVRELFGYAHTIPTHQGRGAEQIL
TNAA_DESVV       LLTDSGTGAMSDRQWAGLMMGDEAYAGSRNFLNLEKAVKDVFGYEHTVPTHQGRGAEQIL
TNAA_DESVH       LLTDSGTGAMSDRQWAGLMMGDEAYAGSRNFLNLEKAVKDVFGYEHTVPTHQGRGAEQIL
TNAA_PROIN       LLTDSGTTRYDHH--GSMITGDEAYAGSRNYYDLKDKVKEMFDYDYVIPAHQGRGAENML
TNAA_PROVU       LLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENIL
TNAA_ECO24       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOLC       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOLI       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO27       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO8A       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO7I       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_SHIF8       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECODH       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO81       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO55       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_SHIFL       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOBW       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOL5       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO45       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOLU       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOSE       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOHS       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_SHIB3       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOL6       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO5E       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECO57       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ECOSM       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_ESCF3       LLTDSGTGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIY
TNAA_HAES1       LLTDSGTGAVTQDMQAAMLRGDEAYSGSRSYYALANAVKEIFGYEYTIPTHQGRGAEQIY
TNAA_HISS2       LLTDSGTGAVTQDMQAAMLRGDEAYSGSRSYYALANAVKEIFGYEYTIPTHQGRGAEQIY
TNAA_PASMU       LLTDSGTGAVTQEMQAAMLRGDEAYSGSRSYHALANAVKEIFGYEYTIPTHQGRGAEQIY
TNAA_HAEI8       LLTDSGTGAVTQDMQAAMLRGDEAYSGSRSYYALAKAVKDIFGYEYTIPTHQGRGAEQIY
TNAA_HAEIF       LLTDSGTGAVTQDMQAAMLRGDEAYSGSRSYYALAKAVKDIFGYEYTIPTHQGRGAEQIY
TNAA_VIBCM       LLTDSGTGAITQEMQAAMFRGDEAYSGSRSYHALARAVKDIFGYEYTIPTHQGRGAEQIY
TNAA_VIBCH       LLTDSGTGAITQEMQAAMFRGDEAYSGSRSYHALARAVKDIFGYEYTIPTHQGRGAEQIY
TNAA_VIBC3       LLTDSGTGAITQEMQAAMFRGDEAYSGSRSYHALARAVKDIFGYEYTIPTHQGRGAEQIY
TNAA_VIBVU       LLTDSGTGAITQDMQAAMFRGDEAYSGSRSYHALANAVKDIFGYEFTIPTHQGRGAEQIY
TNAA_VIBVY       LLTDSGTGAITQDMQAAMFRGDEAYSGSRSYHALANAVKDIFGYEFTIPTHQGRGAEQIY
TNAA_RHOCA       LLTDSGTGAMSSLQWAAVMQGDESYAGSPSFFRFEAAVQNLMPFKHIIPTHQGRAAEAIL
TNAA_HYPNA       LLTDSGTSAMSAAQWGAVMTGDESYAGAPSFYRFEAAVKDLMDFTHIIPAHQGRAAEHLL
TNAA_SALRD       LLTDSGTSAMSAAQWAGLMQGDESYAGSPSYFRFEEAVKDLMPFEHVIPTHQGRAAERIL
TNAA_HALS3       LLTDSGTGTMSNDQWAAMLQGDEAYAGSASFEDLAVAAEDVMGFQHIIPAHQGRGAENVL
TNAA_HALSA       LLTDSGTGTMSNDQWAAMLQGDEAYAGSASFEDLAVAAEDVMGFQHIIPAHQGRGAENVL
TNAA_AERPE       LLTDSGTGSMSIYQWAALMTGDEAYAGARSWFRFRDAVRDVLGLDLVLPVHQGRAAERIL
                 *******        ..:: ***:*:*. .:  :   . ..       *.****.**   

TNAA1_SYMTH      FSQLITRP---------GMYVLSNMFFDTTRGHVQLAGGRPVDLLIDVP--TEEYHPFKG
TNAA2_SYMTH      FAQLITRP---------GMYVLSNMFFDTTRGHVQLAGGRPIDLLLDVP--TEEYHPFKG
TNAA_CALS4       FPLLIKK----------GQYVLGNMHFDTTKAHIELAGGIGIDMVIKEAEDTENYHPFKG
TNAA_CLOTE       FGLLLGE----------GKYSISNMHFDTTRAHVELSGARAIDCVVPEASDPTVRIPFKG
TNAA_SHESH       FPCLIERMRQVR--GGTEPIFISNYHFDTTAGHIEMNGGKALNVVTEKAFDTESYYDWKG
TNAA_VIBPA       FPALIERMRQVR--GGETPVFISNYHFDTTAGHIELNGGKAINVVTEEAFDTTTPYDWKG
TNAA_CITK8       FPCLIARRN------AEKPVFISNFHFDTTAAHVELNGAKAINVVTPKAFDTTSWYDWKG
TNAA_KLEAE       FPSLIARRK------SAHPVFISNFHFDTTAAHVELNGAKAINVVTPKAFDTTSWYDWKG
TNAA_YERE8       FPCLIAKKQKAG--GAKNPVFISNFHFDTTAAHVEMNGAKAINVVTPKAFDTVAYYDWKG
TNAA_PHOLL       FPTLIARKKAQG--GATHPVFISNFHFDTTAAHVELNGAKAINVVTSKAFDTTTYYDWKG
TNAA_AERHH       FPELVKRCQ------GKAPVFISNYHFDTTKAHVELAGARAINLLTPKALDTTAPYAWKG
TNAA_AERS4       FPELVKRCK------GKAPVFISNYHFDTTKAHVELAGERAINLLTPKALDTTAPYAWKG
TNAA_CHRVO       FPELVKRCR------GERPVFLSNYHFDTTKAHVELAGARAVNALTPRALDTGAAYDWKG
TNAA_DESVV       FPCLVARMK------GDKPVFISNYHFDTTAAHVEMTGAKAINVVTEKAFDTGTYYDWKG
TNAA_DESVH       FPCLVARMK------GDKPVFISNYHFDTTAAHVEMTGAKAINVVTEKAFDTGTYYDWKG
TNAA_PROIN       FPVLLKVKQEQG--GAKKPVFISNFHFDTTAAHVELNHCKAINIVTEKAYDSDTYDDWKG
TNAA_PROVU       FPVLLKYKQKEG--KAKNPVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKG
TNAA_ECO24       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOLC       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOLI       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO27       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO8A       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO7I       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_SHIF8       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECODH       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO81       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO55       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_SHIFL       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOBW       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOL5       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO45       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOLU       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOSE       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOHS       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_SHIB3       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOL6       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO5E       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECO57       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ECOSM       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_ESCF3       IPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKG
TNAA_HAES1       IPVLIKKREQEKGLDRNKMVVFSNYFFDTTQGHSQLNGATVRNVYIKEAFDTDVDHDFKG
TNAA_HISS2       IPVLIKKREQEKGLDRNKMVVFSNYFFDTTQGHSQLNGATVRNVYIKEAFDTDVDHDFKG
TNAA_PASMU       IPVLIKKREQEKGLDRSKMVVFSNYFFDTTQGHSQINGATVRNVYTKEAFDTSVNADFKG
TNAA_HAEI8       IPVLIAKREREKGLDRSKMVVFSNYFFDTTQGHSQINGATVRNVYIKEAFDTTAKHPFKG
TNAA_HAEIF       IPVLIAKREREKGLDRSKMVVFSNYFFDTTQGHSQINGATVRNVYIKEAFDTTAKHPFKG
TNAA_VIBCM       IPVLIKKREKEKGLDRSKMVALSNYFFDTTQGHTQINCCVAKNVYTEEAFDTGVKADFKG
TNAA_VIBCH       IPVLIKKREKEKGLDRSKMVALSNYFFDTTQGHTQINCCVAKNVYTEEAFDTGVKADFKG
TNAA_VIBC3       IPVLIKKREKEKGLDRSKMVALSNYFFDTTQGHTQINCCVAKNVYTEEAFDTGVKADFKG
TNAA_VIBVU       IPVLIKKREIEKGLDRSKMVALSNYFFDTTQGHTQINCCVAKNVYTEEAFDTGVKADFKG
TNAA_VIBVY       IPVLIKKREIEKGLDRSKMVALSNYFFDTTQGHTQINCCVAKNVYTEEAFDTGVKADFKG
TNAA_RHOCA       FSIFGG----------KGRRIPSNTHFDTTRGNIEASGATGDDLVIAEGKDPQNLHPFKG
TNAA_HYPNA       FSLIAK----------TGDLIPSNTHFDTTRGNIEAMGAEALDLPIAEGRVPSLDHPFKG
TNAA_SALRD       MGIVAG----------PDAKIPSNTHFDTTRANIEATGAEAVDLVIDAGHVPDAEHPFKG
TNAA_HALS3       YGAVLS----------AGDTVLNNAHFDTTRAHVAANDATPVDCPVDGARDPDTDAPFKG
TNAA_HALSA       YGAVLS----------AGDTVLNNAHFDTTRAHVAANDATPVDCPVDGARDPDTDAPFKG
TNAA_AERPE       YGELLRRR--------NARIVPANTHFDTGRAVILNQGGVPLDLPSPQASR-REAYPFKG
                    .                   * .***  .          :              :**

TNAA1_SYMTH      NMDTERLEQFIREHGAENIACIVMTVTNNSAGGQPVSMANIRETYQIARKYGVLVLFDVA
TNAA2_SYMTH      NMDTARLEAFIQEHGAENIACIVMTVTNNSAGGQPVSMANIRETSRIARKYGILLLFDVA
TNAA_CALS4       NFDVEALENFIKEKGAENIAFILATVTCNSAGGQPVSMENIKEVRRIADKYGIRLFFDAA
TNAA_CLOTE       NMDVEKLEKLIKEHGADKIGVVVMTITNNSAGGQPVSIENMKETAEICKKYNIRLCIDAA
TNAA_SHESH       DFDLDKLRDTIATYGANNIAAIITTVTCNSSGGQPVSMANMRAVYEIAQKHDIPVVIDSA
TNAA_VIBPA       NFDLNKLVETIEEHGSKNICAIITTVTCNSSGGQPVSMENMRSVYEIATKYDIPVVIDSA
TNAA_CITK8       NFDIDLLNATIAEHGAENVAAIITTVTCNSSGGQPVSIANMREVYQIAKRHNIPVVIDSA
TNAA_KLEAE       NFDIDLLKATIAEHGAENVAAIITTVTCNSSGGQPVSLANMREVYQIARQNNIPVVIDSA
TNAA_YERE8       DFDLDQLKATIAEYGADNVVSIITTVTCNSSGGQPISMSNMREVYRIAQQHNIPVVIDSA
TNAA_PHOLL       DFDIDELEKTIAEHGADNVVAIITTVTCNSSGGQPISLANMKAVYEIAKQHDIPVVIDSA
TNAA_AERHH       DFDLPRLSDTIETLGDDNVAGIIITVTCNSAGGQPVSMANMEAVAELARRHHIPVVIDAA
TNAA_AERS4       DFDLGRLTDTIETLGADNVAAVIITVTCNSAGGQPVSMGNMQAVSELARRHHIPVVIDAA
TNAA_CHRVO       DFDLARLGEIVEAEG-ENVAAIIVTVTCNSAGGQPVSMANIRAASALARSKGIPVVIDAA
TNAA_DESVV       DFDLEKLEATIRQHGAQNVAGIIVTITCNSAGGQPVSMANIREAAAIAKRHGITVIIDSA
TNAA_DESVH       DFDLEKLEATIRQHGAQNVAGIIVTITCNSAGGQPVSMANIREAAAIAKRHGITVIIDSA
TNAA_PROIN       NFDIQKLKDNIAPEWCRKRCCHYFSITCNSAGGQPVSMANLKEVYEIAKHHNIFVVMDSA
TNAA_PROVU       DFDIKKLKENIAQHGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSA
TNAA_ECO24       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOLC       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOLI       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO27       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO8A       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO7I       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_SHIF8       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECODH       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO81       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO55       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_SHIFL       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOBW       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOL5       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO45       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOLU       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOSE       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOHS       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_SHIB3       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOL6       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKVMYSIAKKYDIPVVMDSA
TNAA_ECO5E       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECO57       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ECOSM       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_ESCF3       NFDLEGLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSA
TNAA_HAES1       NFDLEKLEQGILEVGANNVPYIVCTITCNSAGGQPVSLANMKAMYQIARKYDIPVIMDSA
TNAA_HISS2       NFDLEKLEQGILEVGANNVPYIVCTITCNSAGGQPVSLANMKAMYQIARKYDIPVIMDSA
TNAA_PASMU       DFDLEKLEQGIQEVGAENVPYIVCTITCNSAGGQPVSLANMRAMYEIAKKYDIPVVMDSA
TNAA_HAEI8       NFDLEKLEKGIQEAGAHNVPYIVCTITCNSAGGQPVSIANLKGMYEIARKYDIPVIMDSA
TNAA_HAEIF       NFDLEKLEKGIQEAGAHNVPYIVCTITCNSAGGQPVSIANLKGMYEIARKYDIPVIMDSA
TNAA_VIBCM       NFDLEKLEQAILEAGPANVPYIVSTITCNSAGGQPVSIANLKAVYEIAQRYDIPVIMDSA
TNAA_VIBCH       NFDLEKLEQAILEAGPANVPYIVSTITCNSAGGQPVSIANLKAVYEIAQRYDIPVIMDSA
TNAA_VIBC3       NFDLEKLEQAILEAGPANVPYIVSTITCNSAGGQPVSIANLKAVYEIAQRYDIPVIMDSA
TNAA_VIBVU       NFDLEKLEEAILEAGPANVPYIVSTITCNSAGGQPVSLANLKAVYEIAKRYDIPVIMDSA
TNAA_VIBVY       NFDLEKLEEAILEAGPANVPYIVSTITCNSAGGQPVSLANLKAVYEIAKRYDIPVIMDSA
TNAA_RHOCA       NMDLARLEAYLEAHHAE-VPLVMITITNNAGGGQPVSLANIRAVADLAHRYGKPFVIDGC
TNAA_HYPNA       NMDLAALERVLTEEGGR-IPAVMMTITNNAGGGQPVSLENIRGAARLAKAHGKAFYIDGC
TNAA_SALRD       NINLDRLEALLDAEGDR-VPIVMLTVTNNTGGGQPVSLANIRGAKALCDTYDVPLVLDAC
TNAA_HALS3       NFSVERARRVVDDVGADAVPVVVLTITNNSMAGQPVSIENTREVAAFADDIDATFVIDAC
TNAA_HALSA       NFSVERARRVVDDVGADAVPVVVLTITNNSMAGQPVSIENTREVAAFADDIDATFVIDAC
TNAA_AERPE       DIDVARLERLLKERSRD-VAFILLVITNNTAGGQPVSMDNVKTVRELADAYGLPLVMDIC
                 ::.       :              :* *: .***:*: * .    :.      . :* .

TNAA1_SYMTH      RYAENCHFIRMREEGYADKHPIDIAREMFSYGDGLMMSAKKDALVNIGGLLAFR-D--EE
TNAA2_SYMTH      RYAENCHFIRMREEGYADKAPIDIAREMFSYGDGLMMSAKKDALVNIGGLLAFK-D--EE
TNAA_CALS4       RFAENAYFIKQREKGYENKSIKEIVREMFSYGDGFTMSAKKDALVNIGGLIAIKED--EE
TNAA_CLOTE       RYAENAYFIKQREPGYENKSIKEIIKEIFSYADIFTMSAKKDAIVNMGGLLGIKED--EE
TNAA_SHESH       RYCENAYFIKQREPGYEDSSMLEIIREMFQYGDMLTLSAKKDPMVNIGGLCCVRDH--EE
TNAA_VIBPA       RYCENAYFIKQREEGYADKSILEIIREMYQYGDMLTMSAKKDPMVNIGGMCCIRDH--QE
TNAA_CITK8       RFCENAWFIKQREEGYADKTVKEIVREMYQYGDMLTMSAKKDPMVNIGGLCCFRDD--ED
TNAA_KLEAE       RFCENAWFIKQREEGYADKSVKEIILEMYQYGDMLTMSAKKDPMVNIGGLCCFRDD--EE
TNAA_YERE8       RFCENAWFIKQREPGYSDKSIKEIILEMYQYGDMLTMSAKKDPMVNIGGLCCFRTD--ED
TNAA_PHOLL       RFCENAWFIKQREKGYENKSVKQIVKEMYQYGDMLTMSAKKDPLVNIGGLCCFRDD--ED
TNAA_AERHH       RFAENAWFIKERDPAYAKCSIKEIVRQMFALGDIFTMSAKKDGLVNIGGLCCFKED--LE
TNAA_AERS4       RFAENAWFIKARDPDYAKSSIKEIVRQMFDLGDMFTMSAKKDGLVNIGGLCCFKEG--LD
TNAA_CHRVO       RFAENAWFIRERDPAYAGVAISSIVREMFDYGDMFTMSAKKDGLVNIGGLCCFKND--EA
TNAA_DESVV       RFCENAWFIKQREAGYADKSIREIIREMYSYGDVLTCSAKKDPIVNIGGLCCIKED--VD
TNAA_DESVH       RFCENAWFIKQREAGYADKSIREIIREMYSYGDVLTCSAKKDPIVNIGGLCCIKED--VD
TNAA_PROIN       RFCENAYFIKERDPKYKNATIKEIILDMYKYADALTMSAKKDPLLNIGGLVCIKND--EK
TNAA_PROVU       RFCENAYFIKARDPKYKNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDN--EE
TNAA_ECO24       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOLC       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOLI       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO27       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO8A       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO7I       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_SHIF8       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECODH       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO81       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO55       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_SHIFL       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOBW       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOL5       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO45       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOLU       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOSE       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOHS       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_SHIB3       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOL6       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO5E       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECO57       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFD
TNAA_ECOSM       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCVKDDSFFD
TNAA_ESCF3       RFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCVKDDSLFD
TNAA_HAES1       RFAENAYFIQQREAEYKDWTIEQITYESYKYADALAMSAKKDAMVPMGGLLCFKDNSMED
TNAA_HISS2       RFAENAYFIQQREAEYKDWTIEQITYESYKYADALAMSAKKDAMVPIGGLLCFKDNSMED
TNAA_PASMU       RFAENAYFIQQREPGYKEWTIEQITYESYKYADALAMSAKKDAMVPMGGLLCFKDKSMED
TNAA_HAEI8       RFAENAYFVQQREEAYKDWTIEQITYESYRYADGLAMSAKKDAMVPMGGILAFKDKSMEE
TNAA_HAEIF       RFAENAYFVQQREEAYKDWTIEQITYESYRYADGLAMSAKKDAMVPMGGILAFKDKSMEE
TNAA_VIBCM       RFAENAYFIQQRERDYRNWSIEEITREAYKYADGLAMSAKKDAMVQMGGLLCFKDESFFD
TNAA_VIBCH       RFAENAYFIQQRERDYRNWSIEEITREAYKYADGLAMSAKKDAMVQMGGLLCFKDESFFD
TNAA_VIBC3       RFAENAYFIQQRERDYRNWSIEEITREAYKYADGLAMSAKKDAMVQMGGLLCFKDESFFD
TNAA_VIBVU       RFAENAYFIQQREKDYQNWSIEEITRESYKYADGLAMSAKKDAMVQMGGLLCFKDESFLD
TNAA_VIBVY       RFAENAYFIQQREKDYQNWSIEEITRESYKYADGLAMSAKKDAMVQMGGLLCFKDESFLD
TNAA_RHOCA       RFAENAWFIKTREEGQADRSIPEIVRDCFAVADGMTMSAKKDAFGNIGGWLALNDD--D-
TNAA_HYPNA       RFAENAWFIKLREEGQKDRSIKEIVRETFALADGMTMSAKKDAFANIGGWLALNND--A-
TNAA_SALRD       RFAENAYFIKQREDGYGDRSVKEIVREMFSHADGMTMSAKKDALVNIGGWLALDDD--A-
TNAA_HALS3       RFAENAHFVQQREPGYEHDSVAAIAREQLSYADACVMSGKKDGLVNVGGFVGLHDD--GR
TNAA_HALSA       RFAENAHFVQQREPGYEHDSVAAIAREQLSYADACVMSGKKDGLVNVGGFVGLHDD--GR
TNAA_AERPE       RFAENAYLVKERDPRYRGWSVRDIAREMISYGDHFVMSAKKDGLANIGGFIATRDP--S-
                 *:.**. ::: *:          :  :    .*    *.*** :  :**           

TNAA1_SYMTH      LFTKVGAAVVPFEGFLTYGGLAGRDLEAMAVGLREALDPDYLAYRVGQVQYLGEMLRNAG
TNAA2_SYMTH      LYTRVGGTVVPFEGFLTYGGLAGRDLEAMAVGLREALDPDYLAYRVGQVEYLGNLLRSAG
TNAA_CALS4       LFTRVKTMLIPMEGFVTYGGLAGRDMEAMARGLEEVLDENYLAWRINQVKYLGDKLREAG
TNAA_CLOTE       LFQLCKGRTISFEGFITYGGLSGRDLESLAIGLYEGIDENYLRYRIGQMEYLAARLDEAG
TNAA_SHESH       LFRAVQTRCVPMEGFVTYGGMAGRDMEALARGMHEGADEDFLHYRVCQVAYLGERLREAG
TNAA_VIBPA       LFQAVQTRCVPMEGFVTYGGMAGRDMEALARGLYEGADEDFLHYRISQVQYLGERLREGG
TNAA_CITK8       LFNDVRIRCVPMEGFVTYGGLAGRDMEALAIGLEEGMNEDFLAYRINQVEYLGERLREGG
TNAA_KLEAE       LFNEVRIRCVPMEGFVTYGGLAGRDMEALAIGLEEGTNEDYLAYRINQVEYLGERLREGG
TNAA_YERE8       LFNDVRIRCVPMEGFVTYGGLAGRDMEALAIGLEEGMNEDFLTYRIGQVEYLGERLRAGG
TNAA_PHOLL       LFNEVRTRCVPMEGFVTYGGLAGRDMEALAIGLEEGMNEGYLAYRINQVAYLGNRLRDAG
TNAA_AERHH       LFRAVQVRCVAMEGFVTYGGLAGRDMAALAIGLREGMDEEYLTYRISQVAYLGERLAEAG
TNAA_AERS4       LFRSVQVRCVAMEGFVTYGGLAGRDMAALAIGLREGMDEEYLTYRIGQVAYLGERLAEAG
TNAA_CHRVO       LFRAVQVRCVPMEGFITYGGLAGRDMEALAIGLKEGLDDAYLSYRIGQVAYLGERLREGG
TNAA_DESVV       LFRAVQVRCVPMEGFVTYGGLAGRDMEALAIGLYEGTDEHFLTYRIKQVEYLGERLRQGG
TNAA_DESVH       LFRAVQVRCVPMEGFVTYGGLAGRDMEALAIGLYEGTDEHFLTYRIKQVEYLGERLRQGG
TNAA_PROIN       IFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGAGEEYLHYRIGQVKYLGDRLREGG
TNAA_PROVU       IFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAG
TNAA_ECO24       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOLC       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOLI       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO27       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO8A       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO7I       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_SHIF8       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECODH       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO81       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO55       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_SHIFL       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOBW       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOL5       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO45       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOLU       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOSE       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOHS       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEID
TNAA_SHIB3       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOL6       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO5E       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECO57       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ECOSM       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_ESCF3       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG
TNAA_HAES1       VYNECRTLCVVQEGFPTYGGLEGGAMERLAVGLRDGMRQDWLAYRISQIEYLVQGLEKIG
TNAA_HISS2       VYNECRTLCVVQEGFPTYGGLEGGAMERLAVGLRDGMRQDWLAYRISQIEYLVQGLEKIG
TNAA_PASMU       VYNECRTLCVVQEGFPTYGGLEGGAMERLAVGLRDGMRQDWLAYRINQIEYLVNGLEAIG
TNAA_HAEI8       VYHECRTLCVVQEGFPTYGGLEGGAMERLAVGLHDGMRQEWLAYRIAQIEYLVAGLEKIG
TNAA_HAEIF       VYHECRTLCVVQEGFPTYGGLEGGAMERLAVGLHDGMRQEWLAYRIAQIEYLVAGLEKIG
TNAA_VIBCM       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMRQDWLAYRINQVEYLVNGLEAIG
TNAA_VIBCH       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMRQDWLAYRINQVEYLVNGLEAIG
TNAA_VIBC3       VYTECRTLCLVQEGFPTYGGLEGGAMERLAVGLYDGMRQDWLAYRINQVEYLVNGLEAIG
TNAA_VIBVU       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMRQDWLAYRINQVEYLVNGLESIG
TNAA_VIBVY       VYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMRQDWLAYRINQVEYLVNGLESIG
TNAA_RHOCA       LAEEARGHLIRTEGFPTYGGLAGRDLDALAQGLVEIVDEDYLRYRIRTHQYIVERLDAMG
TNAA_HYPNA       LAERARTLLIQTEGFPTYGGLAGRDLDAIAQGLKEIIDEDYLRYRVRTNAYIAERLDAMG
TNAA_SALRD       WARKARNQLILTEGFPTYGGLAGRDLEAIAVGLQEIVDEDYLEYRMASTRYLGEALTELG
TNAA_HALS3       LHEQCRQRGILYEGFSTYGGMSGRDMAAFAVGLREAVEPPYVAERVAQVQRLADALTDRD
TNAA_HALSA       LHEQCRQRGILYEGFSTYGGMSGRDMAAFAVGLREAVEPPYVAERVAQVQRLADALTDRD
TNAA_AERPE       LYEDLAARVVLEEGYVTYGGLAGRDLEAIAQGLREVVEEDYLRHRVEQVRYLGELLSSQG
                          :  **: ****: *  :  :. *: :     ::  *:     :   *   .

TNAA1_SYMTH      IPIQWPVGGHAVFIDAAKFLPHVPWDQFPGHALTLALYLEGGVRTVEVGSLMIGRDPETG
TNAA2_SYMTH      IPIQWPVGGHAVFIDAAKFLPHIPWDQFPGHALTVALYQEGGVRTVEVGSLVMGRDPETG
TNAA_CALS4       IPIQYPTGGHAVFIDGKKFLPHVPQEQFPSHAICVELYIEAGIRAVEVGALLAGRDPETG
TNAA_CLOTE       IAYQSPVGGHGVFVDAKSMFPHIPYNEFPGQVLAVELYKEAGIRTCEIGSYMLGNDPDTG
TNAA_SHESH       IPIQYPTGGHAVFVDAAKMLPHIPAHQFPAQSLCNALYLEAGIRAVEIGSLLLGREPETG
TNAA_VIBPA       IPIQYPTGGHAVFVDAAKILPHIPADQFPAQALCNALYLEAGIRAVEIGSLLLGRDPETG
TNAA_CITK8       IPIQYPTGGHAVFVDAKLLLPHIPAEQFPAHALNNELYLEAGIRSVEIGSLLLGRDPATG
TNAA_KLEAE       IPIQYPTGGHAVFVDAKLLLPHIPPEQFPAHALNNELYLEAGIRSVEIGSLLLGRDPETG
TNAA_YERE8       IPIQYPTGGHAVFVDAKILLPHIPAEQFPAQALNNALYLEAGIRSVEIGSLLLGRDPQTG
TNAA_PHOLL       IPIQYPTGGHAVFVDAKLLLPHIPGEQFPAHALNNELYLEAGIRSVEIGSLLLGRDPKTG
TNAA_AERHH       IPIQTPTGGHAVFVDAKKLLPHIPAEQFPAHALACELYLEGGVRGVEIGSLLLGRDPATG
TNAA_AERS4       IPIQTPTGGHAVFVDAKKLLPHIPGEQFPAHALACALYLEGGVRGVEIGSLLLGRDPATG
TNAA_CHRVO       VPIQTPTGGHAVFVDAARLLPHIPAGQFPAHALACELYLEGGVRAVEIGSLLLGRHPQTG
TNAA_DESVV       VPIQYPTGGHAVFIDAKLMLPHIPGNQFPAHALANEVYIEGGVRGVEIGSLLLGRDPATG
TNAA_DESVH       VPIQYPTGGHAVFIDAKLMLPHIPGNQFPAHALANEVYIEGGVRGVEIGSLLLGRDPATG
TNAA_PROIN       ISIQYPTGGHAVFVDCKKLVPHIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRDPETG
TNAA_PROVU       IPIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRDPATG
TNAA_ECO24       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOLC       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOLI       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO27       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO8A       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO7I       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_SHIF8       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECODH       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO81       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO55       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_SHIFL       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOBW       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOL5       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO45       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOLU       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOSE       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOHS       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_SHIB3       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOL6       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO5E       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECO57       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ECOSM       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_ESCF3       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_HAES1       VVCQQP-GGHAAFVDAGKLLPHIPAEQFPAQALACELYKVAGIRSVEIGSLLLGRDPKTG
TNAA_HISS2       VVCQQP-GGHAAFVDAGKLLPHIPAEQFPAQALACELYKVAGIRSVEIGSLLLGRDPKTG
TNAA_PASMU       VVCQQP-GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_HAEI8       VPCQQP-GGHAAFVDAGKLLPHIPADQFPAQALSCELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_HAEIF       VLCQQP-GGHAAFVDAGKLLPHIPADQFPAQALSCELYKVAGIRAVEIGSFLLGRDPKTG
TNAA_VIBCM       VICQQA-GGHAAFVDAGKLLPHIPADQFPAHALACELYKVAGIRAVEIGSLLLGRDPATG
TNAA_VIBCH       VICQQA-GGHAAFVDAGKLLPHIPADQFPAHALACELYKVAGIRAVEIGSLLLGRDPATG
TNAA_VIBC3       VICQQA-GGHAAFVDAGKLLPHIPADQFPAHALACELYKVAGIRAVEIGSLLLGRDPATG
TNAA_VIBVU       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAHALACELYKVAGIRAVEIGSLLLGRDPATG
TNAA_VIBVY       VVCQQA-GGHAAFVDAGKLLPHIPADQFPAHALACELYKVAGIRAVEIGSLLLGRDPATG
TNAA_RHOCA       VPVVKPAGGHAVFIDARAWLSHIPPLEYPGQALAVALYEIAGVRSCEIGTAMFGRQ-PDG
TNAA_HYPNA       VPVVKPAGGHAVFIDARAFLPHIPPLEYPGQALTCAMYETGGIRACEIGTVMFGRK-PDG
TNAA_SALRD       VPIVKPVGGHAVYIDAKSLLPHIPPLDYPAQSLAVALYVTGGIRGVEIGSVMFGRQ-PDG
TNAA_HALS3       VPIYQPAGGHAVYIDANAALPHLPREQFPGQAFVCELYREGGVRAVELGRFAFPDT-DRR
TNAA_HALSA       VPIYQPAGGHAVYIDANAALPHLPREQFPGQAFVCELYREGGVRAVELGRFAFPDT-DRR
TNAA_AERPE       VPIVEPVGGHAVYVDVLEALPEMPRSHYPADALAAALYLESGVRAVGLGALAFARE-ENG
                 :    . ***..::*    ...:*  .:*.. .   :*  .*:*   :*           

TNAA1_SYMTH      ENVRGPFEFTRLAIPRRVYTNLHLEDVAETVINAFQKRE-EIRGVKFAREP--KVLRHFT
TNAA2_SYMTH      ENVRSPFEFTRLAIPRRVYTNLHLEDVAETVINAFQKRE-QIRGVKFTREP--KVLRHFT
TNAA_CALS4       QNRLPKLDFVRLTIPRRVYTNSHMDVVAEAVKRVYARRD-QIKGYRFVYEP--PILRHFT
TNAA_CLOTE       EQLKADFEFTRLAIARRVYTQAHIDIMADALITIKERAN-TVKGYRITWEP--PILRHFQ
TNAA_SHESH       EQKVSPMELMRLTIPRRVYTNDHMDYIADALIAIKDQAA-SLKGLTFDYEP--PVLRHFT
TNAA_VIBPA       EQKASELELMRLTIPRRVYTNDHMDYIADALIELKNRAH-ELKGLMFEYEP--PVLRHFT
TNAA_CITK8       KQKPSPMELLRLTIPRRVYTNDHMDYIADALIAVKARAA-SIKGLTFTYEP--PVLRHFV
TNAA_KLEAE       KQKASPMELLRLTIPRRVYTNDHMDYIADALIAVKARAA-TIKGLTFTYEP--PVLRHFV
TNAA_YERE8       KQKPSPLELLRLTIPRRVYTNDHMDYIADALISLKSRAE-EIKGLTFTYEP--PVLRHFV
TNAA_PHOLL       KQKPSPMELLRLTIPRRVYTNDHMDYVVEAFISLKERIP-QIKGLTFTYEP--SVLRHFV
TNAA_AERHH       KQEAADFELLRLTIPRRVYTRDHMDYVADCLIAVKARAS-DIRGLTFDYEP--PLLRHFT
TNAA_AERS4       KQEAADFELLRLTIPRRVYTRDHMDYVADCLIAVKTRAS-EIRGLTFDYEP--PLLRHFT
TNAA_CHRVO       RQEPSPFELMRLTIPRRVYTNDHMDYIADCLIDVKRRAA-GVRGLVFDYEP--PILRHFT
TNAA_DESVV       LQKESPLELLRLAIPRRVYTNDHMDYIADTVIAVLDRAS-SIKGLEFTYEP--PVLRHFT
TNAA_DESVH       LQKESPLELLRLAIPRRVYTNDHMDYIADTVIAVLDRAS-SIKGLEFTYEP--PVLRHFT
TNAA_PROIN       KQKHADMEFMRLTIARRVYTNDHMDYIADALIGLKDKFA-TLKGLDFEYEP--PVLRHFT
TNAA_PROVU       EQKHADMEFMRLTIARRVYTNDHMDYIADALIGLKEKFA-TLKGLEFEYEP--PVLRHFT
TNAA_ECO24       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOLC       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOLI       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO27       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO8A       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO7I       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_SHIF8       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECODH       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO81       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO55       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_SHIFL       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOBW       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOL5       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO45       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOLU       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOSE       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOHS       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_SHIB3       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECOL6       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ECO5E       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAS-NIKGLTFTYEP--KVLRHFT
TNAA_ECO57       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAS-NIKGLTFTYEP--KVLRHFT
TNAA_ECOSM       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_ESCF3       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKHVKENAA-NIKGLTFTYEP--KVLRHFT
TNAA_HAES1       QQLPCPAELLRLTIPRATYTQTHMDFIIEAFKRVKENAK-NIKGLDFTYEP--KVLRHFT
TNAA_HISS2       QQLPCPAELLRLTIPRATYTQTHMDFIIEAFKQVKENAK-NIKGLDFTYEP--KVLRHFT
TNAA_PASMU       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFKQVKENAE-NIKGLTFTYEP--KVLRHFT
TNAA_HAEI8       KQLPCPAELLRLTIPRATYTQTHMDFIIEAFQKVKENAE-NIKGLTFTYEP--KVLRHFT
TNAA_HAEIF       KQLPCPAELLRLTVPRATYTQTHMDFIIEAFQKVKENAE-NIKGLTFTYEP--KVLRHFT
TNAA_VIBCM       KQHPCPAELLRLTIPRATYTQTHMDFIIEAFEKVKANAR-NVKGLEFTYEP--PVLRHFT
TNAA_VIBCH       KQHPCPAELLRLTIPRATYTQTHMDFIIEAFEKVKANAR-NVKGLEFTYEP--PVLRHFT
TNAA_VIBC3       KQHPCPAELLRLTIPRATYTQTHMDFIIEAFEKVKANAR-NVKGLEFTYEP--PVLRHFT
TNAA_VIBVU       KQHPCPAELLRLTIPRATYTQTHMDFIIEAFGKVKANAA-NVKGLEFTYEP--QVLRHFT
TNAA_VIBVY       KQHPCPAELLRLTIPRATYTQTHMDFIIEAFGKVKANAA-NVKGLEFTYEP--QVLRHFT
TNAA_RHOCA       SEKPAAMDLVRLAFPRRTYTQSHADYIVEAFEELAATKD-ALRGYRIVKEP--KLMRHFT
TNAA_HYPNA       TEAPGAMDLVRLAMPRRVYTQSHADYVVEVLEDVAATKD-TLKGLRIVKEP--PMMRHFT
TNAA_SALRD       SEEPADQELLRLAIPRRVYTQSHVDYVIECFEALVGRKG-ALCGYEITEEP--PQLRHFT
TNAA_HALS3       -------DLVRLALPRRTYGPDHLDHVADTAAAVCERGT-DVTGLEIVSEPELTELRHFS
TNAA_HALSA       -------DLVRLALPRRTYGPDHLDHVADTAAAVCERGT-DVTGLEIVSEPELTELRHFS
TNAA_AERPE       EIVYPEFELLRLAVPRRTYTNSHMEYVAASLARLLREGRRKVKGLRVVKEPRIKGIRHFL
                        :: **:..* .*   * : :              : *  .  **    :*** 

TNAA1_SYMTH      AWFDPA-----------------
TNAA2_SYMTH      AHFDLV-----------------
TNAA_CALS4       ARLEPVE----------------
TNAA_CLOTE       ASLEPLK----------------
TNAA_SHESH       AKFNSL-----------------
TNAA_VIBPA       ARFREID----------------
TNAA_CITK8       ARLKPVK----------------
TNAA_KLEAE       ARLKPVK----------------
TNAA_YERE8       ARLKPIE----------------
TNAA_PHOLL       ARLKPIK----------------
TNAA_AERHH       ARLKPV-----------------
TNAA_AERS4       ARLKPV-----------------
TNAA_CHRVO       ARLRPA-----------------
TNAA_DESVV       ARLRPIA----------------
TNAA_DESVH       ARLRPIA----------------
TNAA_PROIN       ARLKPIK----------------
TNAA_PROVU       ARLKPIE----------------
TNAA_ECO24       AKLKEV-----------------
TNAA_ECOLC       AKLKEV-----------------
TNAA_ECOLI       AKLKEV-----------------
TNAA_ECO27       AKLKEV-----------------
TNAA_ECO8A       AKLKEV-----------------
TNAA_ECO7I       AKLKEV-----------------
TNAA_SHIF8       AKLKEV-----------------
TNAA_ECODH       AKLKEV-----------------
TNAA_ECO81       AKLKEV-----------------
TNAA_ECO55       AKLKEV-----------------
TNAA_SHIFL       AKLKEV-----------------
TNAA_ECOBW       AKLKEV-----------------
TNAA_ECOL5       AKLKEV-----------------
TNAA_ECO45       AKLKEV-----------------
TNAA_ECOLU       AKLKEV-----------------
TNAA_ECOSE       AKLKEV-----------------
TNAA_ECOHS       AKLKEV-----------------
TNAA_SHIB3       AKLKEV-----------------
TNAA_ECOL6       AKLKEV-----------------
TNAA_ECO5E       AKLKEV-----------------
TNAA_ECO57       AKLKEV-----------------
TNAA_ECOSM       AKLKEV-----------------
TNAA_ESCF3       AKLKEV-----------------
TNAA_HAES1       ARLKEI-----------------
TNAA_HISS2       ARLKEI-----------------
TNAA_PASMU       ARLKEV-----------------
TNAA_HAEI8       ARLKEVE----------------
TNAA_HAEIF       ARLKEVE----------------
TNAA_VIBCM       ARLKEKA----------------
TNAA_VIBCH       ARLKEKA----------------
TNAA_VIBC3       ARLKEKA----------------
TNAA_VIBVU       ARLKEIDA---------------
TNAA_VIBVY       ARLKEIDA---------------
TNAA_RHOCA       CRFEKL-----------------
TNAA_HYPNA       AAFERL-----------------
TNAA_SALRD       AHLRPKAPEAVHHETDGPVEASS
TNAA_HALS3       AALQPVA----------------
TNAA_HALSA       AALQPVA----------------
TNAA_AERPE       AELEPIEPV--------------
                 . :