CLUSTAL format seed alignment for MF_00549

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MGSA_SALTY        ---MELTTRTLPTRKHIALVAHDHCKQMLMNWVERHQPLL--EKHVLYATGTTG-----N
MGSA_ECOLI        ---MELTTRTLPARKHIALVAHDHCKQMLMSWVERHQPLL--EQHVLYATGTTG-----N
MGSA_YERPE        ---MELTTRTIAARKHIALVSHDHCKKSLLAWVMENRDLL--AQHELYATGTTG-----N
MGSA_VIBCH        ---MKKTTRTMAAHKHVALVAHDNCKGELLRWVTENKEKL--QRHFLYATGTTG-----H
MGSA_PASMU        ---MQSTARTLSVNKHIALVAHDHCKQDLINWCKTHRTLL--AQHTLYATGTTG-----N
MGSA_HAEIN        ---MQTTTRTLTQHKRIALVAHDSCKKNLLNWTQKHKEAL--KPHILYATGTTG-----H
MGSA_THEMA        ----------MDKKKRIALIAHDRRKRDLLEWVSFNLGTL--SKHELYATGTTG-----A
MGSA_CLOAB        ----------MNSKKKIALVAHDNRKKALISWCEANSEVL--SNHSLCGTGTTA-----K
L0AM12_NATGS      -------------MTRIALIAHDEKKPDLVEFARTHESQL--RDYDLIATGTTG-----K
I7BLL0_NATSJ      -------------MTRVALIAHDEKKADLIDFARTHETQL--RAYDLIATGTTG-----Q
E4NQV9_HALBP      --------------MRLALIAHDEKKPDLIEFAQNRQDDL--EHLDLMATGTTG-----Q
MGSA_RALSO        ----------MPKRRRIALIAHDHKKDDMIAFAQTHKAFL--MRCDLLATGTTG-----G
MGSA_BORBU        ------------MEKKIALIAHDKKKEDLVNFVKQNYLFL--SKFKLIATGTTG-----S
MGSA_CLOPE        --------------MKIALIAHDKKKEEMIELAKDFEDKL--SKHILVATGTTG-----L
MGSA_LISIN        --------------MHIALIAHDEKKDLMVGFATAYKHLL--EPHQLYATGTTG-----L
MGSA_LISMO        --------------MHIALIAHDEKKDLMVGFATAYKHLL--EPHQLYATGTTG-----L
MGSA_BACSU        --------------MKIALIAHDKKKQDMVQFTTAYRDIL--KNHDLYATGTTG-----L
MGSA_BACHD        --------------MRIALIAHDKKKDEMVQFTIAYKDVL--KDHELYATGTTG-----M
MGSA_THETR        -----------MVNLNIALIAHDMKKSLMIDFAIAYKDIL--EKCNIYATGATG-----Q
A6LKE0_THEM4      -------------MLRVALIAHDKKKLDLAMFVKEWKSVF--EKCVLFATKTTG-----K
A7HN41_FERNB      ------------------------------MFVKEWKNVF--ERCELYATKSTG-----K
J3C7C8_FLASC      --------------MEIAIIAHDGKKADLINFLIKNTIVLHNENISLIGTGTTG-----G
D5BFV9_ZUNPS      -------------MKTIAIIAHNGKKAEMVQFLNEYRNVLESKEIRLISTGTTG-----S
F9Z7J2_ODOSD      --------------MKIAVIAHDGKKAEMVAFLNRHMDFLKSVGTEIVATGTTG-----K
I3Z9C5_BELBD      --------------MKIALIAHDGKKADLVHFLSGFKDELLQKDISLVATGTTG-----S
Q6MIV1_BDEBA      --------MKKQKKKTLALIAHDGKKALMVSFVRDHLETF--KNFTLVGTGNTG-----R
MGSA_BRUME        ----------MTQRLRIALIAHDQKKDDMVAFARAHEQAL--SRYDIVATGTTGG----L
MGSA_RHIME        ----------MADRKCLALIAHDQKKDDLAAFAKANEAVL--SKWKIVATGTTGG----R
G4RG83_PELHB      -----------MTTKTIGLVAHDEKKDDMVAFARAHKDRL--SGFTLVGTGTTGG----R
Q3B468_PELLD      MKRCRKTEATMESSKKIALVAHLSKNADLQAWAKYSRDLL--ERHTLFATGTTV-----Q
MGSA_TRESO        ----------MRRKLRIALVAHDNRKADIVDWALNNAEML--SQHRLFGTGTTGTLVRES
                                                         :      : .*  *       

MGSA_SALTY        LIQRATGMDVNAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRLAT
MGSA_ECOLI        LISRATGMNVNAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRLAT
MGSA_YERPE        LVQKATGIDVHCLLSGPMGGDQEVGALISEKKIDILIFFWDPLNAVPHDPDVKALLRLAT
MGSA_VIBCH        MLSKETGLAIKSMISGPMGGDQQLGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRIAS
MGSA_PASMU        LIQKEANLPIKSLLSGPMGGDQQLGGLIAEKQIDVLIFFWDPMNAVPHDPDVKALMRIAT
MGSA_HAEIN        ILERETGLSIQSLLSGPMGGDQQLGGLIAEKKIDMMIFFWXPMNAAPHEPDVKALMRIAT
MGSA_THEMA        LLQEKLGLKVHRLKSGPLGGDQQIGAMIAEGKIDVLIFFWDPLEPQAHDVDVKALIRIAT
MGSA_CLOAB        LIKEATGLEVFPYKSGPMGGDQQIGAAIVNEDIDFMIFFWDPLTAQPHDPDVKALLRISV
L0AM12_NATGS      RLLEETDLDVGRKESGPLGGDLMIGAEVAAGNLDGIVFLRDPLRAQPHEPDISALLRICD
I7BLL0_NATSJ      RLRDETDLEIERKESGPLGGDLMIGSEVAEGALDGVVFLRDPLRAQPHEPDISALLRICD
E4NQV9_HALBP      RLIDATGLDIERKESGPLGGDMQIGAEIASETCHGVIFLRDPLTAQPHEPDITALLRICD
MGSA_RALSO        RLQDEVGLSVQRMLSGPWGGDLQIGAQLAEGRVDAVIFLRDPMTPQPHEPDINALVRACD
MGSA_BORBU        KIQQATDLTIFKYKSGPMGGDQQIGAEVAEGNILAIFFFRDPLTSQPHEPDVSALIRLCD
MGSA_CLOPE        KIMQNTSLEVKRCKSGPLGGDQEIGAMVANHDVDMVIFLRDPLTAQPHEPDISALLRLCD
MGSA_LISIN        RIIEATGLTVHRFKSGPLGGDQQIGARISENKMDLVIFLRDPLTAQPHEPDVSALIRLCD
MGSA_LISMO        RIIEATGLTVHRFKSGPLGGDQQIGARISENKMDLVIFLRDPLTAQPHEPDVTALIRLCD
MGSA_BACSU        KIHEATGLQIERFQSGPLGGDQQIGALIAANALDLVIFLRDPLTAQPHEPDVSALIRLCD
MGSA_BACHD        RIMEAAQLPVKRFKSGPLGGDQQIGALVAENKFDLIIFLRDPLTAQPHEPDVTALVRLCD
MGSA_THETR        LVEEATGIKVNKFLPGPMGGDQQIGAMIAEDKMDLVIFLRDPLTAQPHEPDILALLRVCD
A6LKE0_THEM4      IIEEKIGLKVTKLESGPYGGDLQIGALVANGEIDFVIFLRDPLTAQPHEPDVSALLRVCD
A7HN41_FERNB      IIEEKIGLKVNKFESGPYGGDLQIGSMIVNGEIDFVIFLRDPLTAQPHEPDVSALLRVCD
J3C7C8_FLASC      KA-EAAGFKTRRMLSGPLGGDAQIAGRVAEGITKMVFFFKDPLSSHPHEADINMLIRVCD
D5BFV9_ZUNPS      KA-ETAGFEVEKLLSGPLGGDAQIASRLAEGKVDMVIFFRDPMDKHPHEPDIFMLMRLCD
F9Z7J2_ODOSD      HA-QDAGLEVERLLSGPLGGDAQIAALVAEHQIAMVIFFRDPLGKHPHEPDVQMLMRVCD
I3Z9C5_BELBD      HI-EKAGFKVNKLLSGPLGGDAQIAAMAAQKELDLVIFFRDPLDKHPHEPDVQMLMRICD
Q6MIV1_BDEBA      LI-QAAGLKVTRRLSGPLGGDAQIAAEVATGKCQGVIFFRDPLGMHPHDPDISMLMRICD
MGSA_BRUME        IQDACPSLNIHRVKSGPLGGDQQIGAMIAEGTVEVLIFFIDPLSPLPHDVDVKALTRLGS
MGSA_RHIME        VLDVCPALDIVRLKSGPLGGDQQIGALIATGDVDCLIFFVDPLTAMPHDVDVKALMRLAI
G4RG83_PELHB      VAQE-TGLAVLALKSGPLGGDAQIGAMIAEGRLDALIFFIDPMSALPHDVDVKALTRLAT
Q3B468_PELLD      VSELEFRITVHRLMSGPLGGDRQIGAIIAGEELDFLIFFRDPLELPPHDPDVKVLLRMAV
MGSA_TRESO        FMKRGIASDITCMHSGPMGGDAEIAALVVRKEIDFAVFFIDDLNPQPHEADIQMLLRQCR
                                .** ***  :..          .*:   :   .*: *:  * *   

MGSA_SALTY        VWNIPVATNVSTADFIIQSPHFNDAVDILIPDYARYLAERLK----------
MGSA_ECOLI        VWNIPVATNVATADFIIQSPHFNDAVDILIPDYQRYLADRLK----------
MGSA_YERPE        VWNIPVATNRSTADFLIGSTLFSSEVTIAIPDYDRYMQQRLDLK--------
MGSA_VIBCH        VWNIPVATNRASAKFLFSSSLMEQEVQIEIPDYQAYLAERT-----------
MGSA_PASMU        VWNIPVAMNMATADFLITSPSFAQETQVRIPDYDGYLKERLK----------
MGSA_HAEIN        VWNIPVAINQSSADFLLTSVLFEQDVEIDVPDYEGYLKERLA----------
MGSA_THEMA        VYNIPVAITRSTADFLISSPLMNDVYEKIQIDYEEELERRIRKVVEGEEEET
MGSA_CLOAB        LYDIPIAMNESTAEFLIKSPIMKEQHERHIIDYYQKIRKDNF----------
L0AM12_NATGS      VHDTALATNLESATYLIEGLAE------------------------------
I7BLL0_NATSJ      VHDTALATNLASAEFLIEGLTE------------------------------
E4NQV9_HALBP      VHDVPLATNLASADAVLDELLEQLGDEPSRNG--------------------
MGSA_RALSO        VHNIPCATNLATADLVMIALGLAQPDPKEIHA--------------------
MGSA_BORBU        VHKIPLATNVKTAEILIKGLESLIF---------------------------
MGSA_CLOPE        VYKVPLATNTESAKLIMADI--------------------------------
MGSA_LISIN        VYEIPLATNIGTAEILIRGLGAGFLDWRDLRRNDE-----------------
MGSA_LISMO        VYEIPLATNIGTAEILIRGLGAGFLDWRDLRRNDE-----------------
MGSA_BACSU        VYSIPLATNMGTAEILVRTLDEGVFEFRDLLRGEE-PNV-------------
MGSA_BACHD        VQRVPLATNIGTAEILIKGLARGDFTWRELVHDEEEPRV-------------
MGSA_THETR        VHSIPLATNLATAEVLIKGLDAGLLEWRNAVK--------------------
A6LKE0_THEM4      VHNVPLATNLATAEGLVLEIKRKLER--------------------------
A7HN41_FERNB      VHNVPLATNLATAEALVLEIQKKILQENQKNEETGE----------------
J3C7C8_FLASC      VHNVPLATNEATAQLLLDAIAQQL----------------------------
D5BFV9_ZUNPS      VHNIPLATNPATAKLLIEAF--------------------------------
F9Z7J2_ODOSD      VHNVPIATNPASAEMMIRGFLDMHQK--------------------------
I3Z9C5_BELBD      VHNIPLATNPAAANMIFKHVISLRH---------------------------
Q6MIV1_BDEBA      VHNVPLATNPATAELLITGLSHD-----------------------------
MGSA_BRUME        VYDIPMALNRATAEKLVRALD-------------------------------
MGSA_RHIME        VYDIPMALNRATAEQLIDFRRN------------------------------
G4RG83_PELHB      LYDIPVAYNKSTAEAVLKAL--------------------------------
Q3B468_PELLD      EWNIPAACNPASADFMISSPLMERTFSGWYPTI-------------------
MGSA_TRESO        IHNIPIACNRYSADLMITSSLWDDAGYVPKDPIYAPFDRKAFEESLKVKE--
                      . * .  :*  :.