CLUSTAL format seed alignment for MF_00555

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ASNA_MYCGA      ---------------MKKLTLLETELAIKYIKDLFQNALSKELNLLRVSAPLIIAPDSGL
ASNA_MYCPE      ---------------MYNLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGI
ASNA_UREPA      ------------MDQLQKAKINQTQKAIVEIKNSFQKHFAKNLNLSRVTAPLFVEGQSGL
ASNA_LACPL      ------MHLIIPKDYDPKLSVKETQQAIRYIRETFQDEFGKQLNLSRLSAPMFVEKKTGL
ASNA_LACDA      -----MAKLVIPSDYDPKMTIRETEKAIRYIRETFQTEFGTAMNLERISAPMFVKKSSGL
ASNA_LACJO      ------MTLILPKDYHPSLTIRDTEAAIVFIRENFQDKIADKLNLQRMSAPMFVEKSTGL
ASNA_FUSNN      ------------MAYISSLDILETEIAIKKVKDFFESHLSKELDLLRVSAPLFVIPESGL
ASNA_CLOTE      MEIKCSERLIIPKEYKTELDLKETAIAIKEVKDCFERALAKQLNLIRVSAPLFVRCDKGL
ASNA_BACAN      -------------MYQSLMTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGL
ASNA_BACCR      -------------MYQSLMTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGL
ASNA_CLOPE      -----MEKLFIPKGYKPLLSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGL
ASNA_BACTN      -----MSYLIKPKNYKPLLDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGI
ASNA_ECOLI      ----------------MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGT
ASNA_ECOL6      ----------------MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGT
ASNA_SHIFL      ----------------MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGT
ASNA_SALTI      ----------------MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGT
ASNA_SALTY      ----------------MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGT
ASNA_YERPE      ----------------MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGT
ASNA_PHOLL      ----------------MKKSFIEKQQQISFVKSFFSRLLESKLGLIEVQGPILSCLGDGI
ASNA_HAEIN      ----------------MKKTFILQQQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGM
ASNA_HAEDU      ----------------MKKSFILQQQEISFVKNTFTQYLIDQLDIIEVQGPILSQVGNGM
ASNA_STRPN      ----------------MKKSFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGM
ASNA_STRR6      ----------------MKKSFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGM
ASNA_STRP1      ----------------MKKSFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGM
ASNA_STRP3      ----------------MKKSFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGM
ASNA_STRA3      ----------------MKKSFIHQQQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGM
ASNA_STRA5      ----------------MKKSFIHQQQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGM
ASNA_PASMU      ----------------MKKSFILQQQEISFAKNTFTEKLAEHLGIVEVQGPILSQVGNGI
ASNA_TREPA      ----------------MEKSFILQQQGISFAKHTFTQKLMEHLGLIEVQGPLLSQVGDGI
                                           *   :  *   :   : : .: .*:.     * 

ASNA_MYCGA      NDNLNGWEAPVSFKS-KTNGVSSQVVQSLAKWKRYSIARYEIPLYQGLYTDMNAIRMDET
ASNA_MYCPE      NDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES
ASNA_UREPA      NDHLDHKQKAVSFYA-KKLDKTLEIVQSLAKWKRLALLDYGFSLYEGLYTDMNAIRADDD
ASNA_LACPL      NDNLNGVEKPVSFTMQDMGDEQIEIVHSLAKWKRVALKRYGFDMHEGLYTNMNAIRKDED
ASNA_LACDA      NDNLSGWEKPVSFTLHDGNEGELQIVHSLAKWKRWALKHYGFSHGEGLFTNMNAIRKDEE
ASNA_LACJO      NDNLNGIERPVAFDMKAMPDDTIEVVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRRDED
ASNA_FUSNN      NDNLNGTERPVSFDTKSGE--RVEIVHSLAKWKRMALYRYNIENDKGIYTDMNAIRRDED
ASNA_CLOTE      NDNLNGVERPVKFTVKDDNEAAVEIVHSLAKWKRMALYRYNFNADEGLYTDMNAIRRDEE
ASNA_BACAN      NDHLNGVERPIEFDMLHSGE-ELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEE
ASNA_BACCR      NDHLNGVERPIEFDMLHSGE-ELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEE
ASNA_CLOPE      NDDLNGIERPVSFDMKAMPEFNIQIVHSLAKWKRLALHRYEFEHGEGLYTDMNAIRRDED
ASNA_BACTN      NDDLNGIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYNIEPGYGIYTDMNAIRSDEE
ASNA_ECOLI      QDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDED
ASNA_ECOL6      QDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDED
ASNA_SHIFL      QDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDED
ASNA_SALTI      QDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDED
ASNA_SALTY      QDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDED
ASNA_YERPE      QDNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
ASNA_PHOLL      QDNLSGHEKAVQVKVKTLPDSTFEVVHSLAKWKRRTLGRFGFQPEQGLYTHMKALRPDED
ASNA_HAEIN      QDNLSGIEKAVQVNVKCIPNAVFEVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDED
ASNA_HAEDU      QDNLSGIEKAVQVNVKCIPGAVFEVVHSLAKWKRHTLARFGFKQGEGLFVHMKALRPDED
ASNA_STRPN      QDNLSGVENPVSVKVLQIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDED
ASNA_STRR6      QDNLSGVENPVSVKVLQIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDED
ASNA_STRP1      QDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDED
ASNA_STRP3      QDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDED
ASNA_STRA3      QDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDED
ASNA_STRA5      QDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDED
ASNA_PASMU      QDNLSGAEKAVQVNVKQITDATFEVVHSLAKWKRHTLARFNFAQGEGLFVHMTALRPDED
ASNA_TREPA      QDGLSGREKAVSVSVKQIPGTAFEVVHSLAKWKRHTLARYGFQDNEGLFVHMIALRPDED
                :* *.  : .: .          :: :*******  :  .      *: ..* *:* *: 

ASNA_MYCGA      -LDATHSMYVDQWDWELRISENDRNVEFLKNTVNKIYKVLKEAQLKVNEKYGIFEQKDLL
ASNA_MYCPE      -LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAE-NLL
ASNA_UREPA      -IDEIHSIYVDQWDWEILINNQDCNLDFLKSIVNKIYSTIRIVQLEIDQLYN--PKQIIL
ASNA_LACPL      -LDNYHSAYVDQWDWEKVISKEERTVETLKAAVRQIFKVIKHMEHEVWYKFPQAVH--HL
ASNA_LACDA      VLDNLHSVYVDQWDWEKVIDKSERTEATLRQTVQRIFETIKGMEYHVRALYPQAAY--HL
ASNA_LACJO      -LDNFHSIYVDQWDWEKIIAKEERNIETLKTTVKQIFKAIKETEKELSARYPGSTY--RL
ASNA_FUSNN      -TDFIHSYYVDQWDWEKIISKEDRNEEYLKDVVRKIYSVFKKTEEYITTEYPKLTK--KL
ASNA_CLOTE      -LDNTHSIYVDQWDWERIIKKEDRNEEYLKDIVRKIFKAFKETEEHINKLYPFLGE--VL
ASNA_BACAN      -LDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLEDHLFEKYPFLGK--YL
ASNA_BACCR      -LDATHSIYVDQWDWEKIVQKEWRTVEYLQKTVQTIYGIFKDLEDHLFEKYPFLGK--YL
ASNA_CLOPE      -LDNIHSIYVDQWDWEKIIDKEERNLETLKETVKSIYGTFKATEDFIVAKYPHIEK--IL
ASNA_BACTN      -LGNLHSLYVDQWDWERVITNEDRNVEFLKEIVNRIYAAMIRTEYMVYEMYPQIKP--CL
ASNA_ECOLI      RLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPF---L
ASNA_ECOL6      RLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPF---L
ASNA_SHIFL      RLSPLHSVYVDQWDWERVMGDGERQLSTLKSTVEAIWAGIKATEAAVNEEFGLAPF---L
ASNA_SALTI      RLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFGLAPF---L
ASNA_SALTY      RLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFGLAPF---L
ASNA_YERPE      RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPF---L
ASNA_PHOLL      RLTPIHSVYVDQWDWEKVMEDGQRSLAYLKQTVGKIYEAIKETEKAVNKEFGLAPF---L
ASNA_HAEIN      SLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFDIPSI---L
ASNA_HAEDU      SLDPTHSIYVDQWDWEKVIPEGQRNFAYLKQTVNQIYKAIRLTELAVEARFDIPSS---L
ASNA_STRPN      SLDATHSVYVDQWDWEKVIPNGKRNIVYLKETVEKIYKAIRLTELAVEARYDIESI---L
ASNA_STRR6      SLDATHSVYVDQWDWEKVIPNGKRNIVYLKETVEKIYKAIRLTELAVEARYDIESI---L
ASNA_STRP1      SLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYDIEAV---L
ASNA_STRP3      SLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYDIEAV---L
ASNA_STRA3      SLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFDIESI---L
ASNA_STRA5      SLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFDIESI---L
ASNA_PASMU      SLDQTHSVYVDQWDWEKVISAEQRNLAYLKETVRAIYAAILETEEAVSKKFGLATF---L
ASNA_TREPA      FLDQVRSVCVDQWDWEKVVPVGSRNLAYLKDTVRKVYGALRESEVLVSERFGLRAF---L
                     :*  *******  :         *:  *  ::  :   :  :   :        *

ASNA_MYCGA      PEHIHFVTTQELLDQYPDKNPSEREQLVCEKYKAVFVMQVGKKLSNNQV-HDGRSPDYDD
ASNA_MYCPE      PEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKP-HDLRAPDYDD
ASNA_UREPA      PDSITFISSQELEDLYPHLSPSRREYEFAKIHKAIFIYQIGYPLKSGYI-QSIRSPEYDN
ASNA_LACPL      PDEIHFLTTQELEDMYPDMTPRERENAICKKLGCVFLMQIGWKLDSGER-HDGRAPDYDD
ASNA_LACDA      PEEISFVTSEELEARWPSLTPSEREDKICQEKGAVFLEHIGGALPLSKKPHDLRAPDYDD
ASNA_LACJO      PSDITFITTQELEDRWPDLAPEEREDKIAKEKKAVFLMKIGDKLKRSGKPHDGRAPDYDD
ASNA_FUSNN      PEEITFITAQELENKYPNLTPKNREHAAAKEYGAIFLMKIGGKLSSGEK-HDGRAPDYDD
ASNA_CLOTE      PEEVFFMTTQELEDMFPDLTAKEREDAITKEKKAVFLMKIGKTLESGEK-HDGRAPDYDD
ASNA_BACAN      PEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEK-HDGRAADYDD
ASNA_BACCR      PEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEK-HDGRAADYDD
ASNA_CLOPE      PEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEK-HDDRSPDYDD
ASNA_BACTN      PQKLHFIHSEELRQLYPNLEPKCREHAICQKYGAVFIIGIGCKLSDGKK-HDGRAPDYDD
ASNA_ECOLI      PDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHR-HDVRAPDYDD
ASNA_ECOL6      PDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHR-HDVRAPDYDD
ASNA_SHIFL      PDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHR-HDVRAPDYDD
ASNA_SALTI      PDQIHFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGRR-HDVRAPDYDD
ASNA_SALTY      PEQIQFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHR-HDVRAPDYDD
ASNA_YERPE      PDHIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQS-HDVRAPDYDD
ASNA_PHOLL      PDQIHFVHSETLLSRYPDLDAKGRERAIAKELGAVFLIGIGAKLSDGQS-HDVRAPDYDD
ASNA_HAEIN      PKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKP-HDGRAPDYDD
ASNA_HAEDU      PKQITFIHSEELAQRYPNMSSKERENAICKEHGAIFLIGIGGKLSDGKA-HDGRAPDYDD
ASNA_STRPN      PKQITFIHTEELVERYPDLTPKERENAICKEFGAVFLIGIGGELPDGKP-HDGRAPDYDD
ASNA_STRR6      PKQITFIHTEELVERYPDLTSKERENAICKEFGAVFLIGIGGELPDGKP-HDGRAPDYDD
ASNA_STRP1      PKKITFIHTEELVAKYPDLTPKERENAITKEFGAVFLIGIGGVLPDGKP-HDGRAPDYDD
ASNA_STRP3      PKKITFIHTEELVAKYPDLTPKERENAITKEFGAVFLIGIGGVLPDGKP-HDGRAPDYDD
ASNA_STRA3      PKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKP-HDGRAPDYDD
ASNA_STRA5      PKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKP-HDGRAPDYDD
ASNA_PASMU      PKDIQFVHSEELVQRFPNMNDKERENAICKEYGAVFLIGIGGKLSDGKP-HDVRAPDYDD
ASNA_TREPA      PADIVFVQSEELVRRYPHLDSKGREDAICKEHGAVFLIGIGGVLSDGKP-HDVRAPDYDD
                *  : *: :: *   :*      **    .   .:*:  :*  *  .   :. *:.:**:

ASNA_MYCGA      WS---------LNGDIMVYNPRSKKALELSSMGIRVNKEVLLKQLEESKQ-NERLELMFH
ASNA_MYCPE      WK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNN-NSRKELDFH
ASNA_UREPA      WN---------LNGDLIVYHKLNDQAIELSSMGIRVSKQDFIKQTNFANLKNDQENNFYH
ASNA_LACPL      WK---------LNGDILFWYEPLDQAIEISSMGIRVDAESMKKQLKDVDA-EDRLSLPYH
ASNA_LACDA      WT---------LNGDLLFWYEPLQRAFEVSSMSIRVDEDRLQEQLKLAGA-EDRLDLPFH
ASNA_LACJO      WE---------LNGDLLFWYEPLKRKIEISSMGIRVSEESLKEQLKKAHT-EERSDLPFH
ASNA_FUSNN      WD---------LNGDIIFNYPLLGIGLELSSMGIRVDEKSLDEQLKIANC-EDRRSLPYH
ASNA_CLOTE      WE---------LNGDILFWNPVLNKAFELSSMGIRVDEESLLKQLKLANC-EERKELQFH
ASNA_BACAN      WK---------LNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGE-DFKREYDFH
ASNA_BACCR      WK---------LNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGE-DFKREYDFH
ASNA_CLOPE      WT---------LNGDLLFYYPLFDEAVELSSMGIRVDEESLLKQLKIAEC-EERKELPFH
ASNA_BACTN      YTSTGLNNLPGLNGDLLLWDDVLQRSIELSSMGVRVDREALQRQLKEENE-EERLKLYFH
ASNA_ECOLI      WSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGD-EDRLELEWH
ASNA_ECOL6      WSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGD-EDRLQLEWH
ASNA_SHIFL      WSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGD-EDRLQLEWH
ASNA_SALTI      WSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGD-EDRLQLEWH
ASNA_SALTY      WSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGD-EDRLQLEWH
ASNA_YERPE      WTSPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGD-EDRLELEWH
ASNA_PHOLL      WTTPNSDGFVGLNGDIIVWNPVLEDAFEISSMGIRVDAEALERQLALTSD-EERLQYDWH
ASNA_HAEIN      WTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGD-EDHLKMDWH
ASNA_HAEDU      WTTESENGYKGLNGDILVWNEELGSAFELSSMGIRVDQQALRLQVSLTGD-EDRLTMDWH
ASNA_STRPN      WTSESENGYKGLNGDILVWNESLGGAFELSSMGIRVDEETLRRQVEITGD-EDRLELEWH
ASNA_STRR6      WTSESENGYKGLNGDILVWNESLGGAFELSSMGIRVDEETLRRQVEITGD-EDRLELEWH
ASNA_STRP1      WTTETENGYHGLNGDILVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGD-QDRLGFDWH
ASNA_STRP3      WTTETENGYHGLNGDILVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGD-QDRLAFDWH
ASNA_STRA3      WTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGD-EGRLEFEWH
ASNA_STRA5      WTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGD-EDRLEFEWH
ASNA_PASMU      WTTPSEGEYKGLNGDILVWNPILERAFELSSMGIRVDETALRKQLALTNN-EDRLKFDWH
ASNA_TREPA      WTTPSEGEYKGLNGDILVWNPVLGRAFEVSSMGIRVDEGALRTQLALTGD-EDSLACSWH
                :          ****::.        .*:***.:**.   :  *       :      :*

ASNA_MYCGA      KKLVNGELHQTIGGGIGQSRLCYFLLQKDHIGEVQASHWSDEIVVEAKAKGIKLL
ASNA_MYCPE      KKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL
ASNA_UREPA      QMILNNQLPQTIGGGIGQSRLCMFLLNKKHIGEVQVSVWPNEYKDELLKKGIKLL
ASNA_LACPL      QMILNADVPYTIGGGIGQSRLCMLLLGKAHVGEVQAALWHKP-------------
ASNA_LACDA      QALLKGDLPYSIGGGIGQSRLCMLLLGKAHIGEVQASIWPDEIVEKCQAAKIQLL
ASNA_LACJO      KMLLEGKLPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPPEMIESCKAADIKIL
ASNA_FUSNN      QMILNKVLPYTIGGGIGQSRICMFFLDKLHIGEVQASIWSQEVHEICRQMNIKLL
ASNA_CLOTE      KMLLEKKLPYTIGGGIGQSRMCMLFLKKAHIGEVQSSIWPEEMIKFCEEKGMTIL
ASNA_BACAN      KGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF
ASNA_BACCR      KGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF
ASNA_CLOPE      QMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL
ASNA_BACTN      KRLMDDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKECEELDIHLI
ASNA_ECOLI      QALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRESVPSLL----
ASNA_ECOL6      QALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRESVPSLL----
ASNA_SHIFL      QALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRESVPSLL----
ASNA_SALTI      QALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRESIPAIL----
ASNA_SALTY      QALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRESIPAIL----
ASNA_YERPE      QSLLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL----
ASNA_PHOLL      QALLKGDMPQSIGGGIGQSRLVMLLLQMKHIGQVQCSIWSPEVRETVEDML----
ASNA_HAEIN      QDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEEFSNIL----
ASNA_HAEDU      QDLLAGRLPLSIGGGIGQSRLVMFLLHKKHIGEVQSSVWPTEMLTQFENIL----
ASNA_STRPN      KSLLNGLFPLTIGGGIGQSRMAMFLLRKRHIGEVQTSVWPQEVRDTYENIL----
ASNA_STRR6      KSLLNGLFPLTIGGGIGQSRMAMFLLRKRHIGEVQTSVWPQEVRDTYENIL----
ASNA_STRP1      KSLLNGLFPLTIGGGIGQSRMVMFLLRKQHIGEVQTSVWPQEVRDSYDNIL----
ASNA_STRP3      KSLLNGLFPLTIGGGIGQSRMVMFLLRKKHIGEVQTSVWPQEVRDSYDNIL----
ASNA_STRA3      KTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFENIL----
ASNA_STRA5      KTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFENIL----
ASNA_PASMU      QDLVNGRLPLSIGGGIGRSRLVMLLLQKKHIGEVQSSVWPKWVMEQFDNIL----
ASNA_TREPA      QDLINGRLPQSIGGGIGQSRLAMLLLQRKHIGEVQASVWPRSVREEFENIL----
                : ::   .  :******:**:    *   *:*::* . *