CLUSTAL format seed alignment for MF_00558

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SUCC_HERA2        ----------------------------------------------------MKLHEYQA
SUCC_GEMAT        ----------------------------------------------------MNLHEYQA
SUCC_PELPD        ----------------------------------------------------MKIHEYQA
SUCC_PELCD        ----------------------------------------------------MKLHEYQA
SUCC_MYXXD        ----------------------------------------------------MKIHEYQG
SUCC_RHOBA        ----------------------------------------------------MKIHEYQG
SUCC_BACSU        ----------------------------------------------------MNIHEYQG
SUCC_SORC5        ----------------------------------------------------MKIHEYQG
SUCB_NEUCR        -MFKLGRNRALASAFAATSRAPLASRLPS---------------VSQQQRRALSIHEYLS
SUCB1_MOUSE       MAASMFYGRQLAAAALRSHRPQTTLRAAAQVLGNSGLFNKHGLQVQQQQQRTLSLHEYLS
SUCB1_DICDI       MLSNIVKKTIQSSKNLKSLVLNKSTSSLV------------------YQKRFLNVHEYQA
SUCB2_DICDI       --MSLFNSANKVIGGVLKFNPSK------------------------YQVRYLNLHEYQS
SUCC_AKKM8        ----------------------------------------------------MNIHEYQA
SUCC_OPITP        ----------------------------------------------------MNIHEYQA
SUCC_RICPR        ----------------------------------------------------MNIHEYQA
SUCC_PELUB        ----------------------------------------------------MNIHEHQA
SUCC_WOLSU        ----------------------------------------------------MNIHEYQA
SUCC_CAMC5        ----------------------------------------------------MNIHEFQA
SUCC_ANAPZ        ----------------------------------------------------MNVHEFQA
SUCC_SULSY        ----------------------------------------------------MKVHEHQA
SUCC_DESPS        ----------------------------------------------------MKIHEYQA
SUCC_GRAFK        ----------------------------------------------------MNIHEYQG
A8Z5U7_SULMW      ----------------------------------------------------MNLHEYQA
SUCC_SALRD        ----------------------------------------------------MKLHEYQA
SUCC_LEPIN        ----------------------------------------------------MKIHEYQA
SUCC_ECOLI        ----------------------------------------------------MNLHEYQA
SUCC_HAEIN        ----------------------------------------------------MNLHEYQA
SUCC_FRATT        ----------------------------------------------------MNLHEYQA
SUCC_THIDA        ----------------------------------------------------MNLHEYQA
SUCC_XYLFA        ----------------------------------------------------MNFHEYQA
SUCC_DICNV        ----------------------------------------------------MNLHEYQA
SUCC_HYDCU        ----------------------------------------------------MNLHEYQA
SUCC_RUTMC        ----------------------------------------------------MHIHEYQA
SUCC_ACIF2        ----------------------------------------------------MNLHEYQA
SUCC_ZYMMO        ----------------------------------------------------MNIYEYQA
MTKA_RHILO        ----------------------------------------------------MDIHEYQA
SUCC_PARUW        ----------------------------------------------------MNTHEFQA
SUCC_CHLTR        ----------------------------------------------------MHLHEYQA
SUCC_BACTN        ----------------------------------------------------MKIHEYQA
SUCC_RUBXD        ----------------------------------------------------MDLYEHQG
SUCC_HALSA        ----------------------------------------------------MKLHEYQA
SUCC_CUTAK        ----------------------------------------------------MDLYEYQA
SUCC_ACIC1        ----------------------------------------------------MDLFEYQA
B8DUE4_BIFA0      ----------------------------------------------------MDLYEYQA
SUCC_DEIRA        ----------------------------------------------------MKLHEYQG
SUCC2_ARCFU       ----------------------------------------------------MRLHEYQA
SUCC1_ARCFU       ----------------------------------------------------MRLHEHQA
SUCC_PYRAE        ----------------------------------------------------MKLHEYEA
SUCC_IGNH4        ----------------------------------------------------MNLLEYEA
SUCC_STAMF        ----------------------------------------------------MKLYEFEA
SUCC_METTH        ----------------------------------------------------MKFYEYSA
A5ULQ1_METS3      ----------------------------------------------------MKFFEYMA
SUCC_METJA        ----------------------------------------------------MKLHEYEA
B2A0T1_NATTJ      ----------------------------------------------------MKLYEYMA
A2SQQ5_METLZ      ----------------------------------------------------MKFREYEA
L0HJ42_METFS      ----------------------------------------------------MKLREYEA
B1L6Q9_KORCO      ----------------------------------------------------MRLLEYES
                                                                      :   *. .

SUCC_HERA2        RDIVARYGIPVTGGGVAATAEEVQKVAEQI-----GGPVAVKAQVHVGGRGKA-------
SUCC_GEMAT        KELLRVAGVPIPPGEIATTPEQAEAIAKKL-----GTAVMVKAQVHAGGRGKA-------
SUCC_PELPD        KDILAGFGIAIPRGRVAMNASQVERAAREL-----GGHCVIKAQVYAGGRGKG-------
SUCC_PELCD        KQLFHRYGIPIPEGRLARSVEETGQAARAF-----AGRCVVKAQIHAGGRGKA-------
SUCC_MYXXD        KEIFRKYGVPTPKGILAVSANDAEAAAKEL----GTSVVVVKAQIHAGGRGKG-------
SUCC_RHOBA        KQLFRTAGVPVLDGHMVTTPDEAAAAYDKL----GGKIAVVKAQIHAGGRGKGNVI-DNP
SUCC_BACSU        KEVLRKYGVSVPEGKVAFTAEEAVESAKSL----SSSVYVVKAQIHAGGRGKA-------
SUCC_SORC5        KQLFARYGVPVPKGEPAFQASEVAPIADRLIAQTGNPVVVVKAQIHAGGRGKG-------
SUCB_NEUCR        ADLLRQYGIGVPKGDVARTGAEAEAIAKQI----GGEDMVIKAQVLAGGRGKGTF--DNG
SUCB1_MOUSE       MELLQEAGVSVPKGFVAKSSDEAYAIAKKL----GSKDVVIKAQVLAGGRGKGTF--TSG
SUCB1_DICDI       QKMMKSYGINCPVGNVAETPEEAEKIAEVM----NTQDLVVKAQVLAGGRGKGIF--TSG
SUCB2_DICDI       KSLMDKYGVNTQKWRVVTKASDAIKAASEL----NGE-LVVKAQVHAGGRGKGSFI-ETG
SUCC_AKKM8        KQLFERFGVATPKGIAASTAQEAAQTARNM----GLSQYVVKAQVHAGGRGKGTF--KNG
SUCC_OPITP        KALFEKFGVLVPKGAPAKTPEEFVTALAQL----PEGMIVVKSQIHAGGRGKGTF--TDG
SUCC_RICPR        KEILRKYGVPTSTGLVVTKTEKINETIDKL----NTKVYVIKAQIHAGGRGKA-------
SUCC_PELUB        KQILKKYGAVVPEGVFAFTVDELIEKAKSL----KTEKFVLKAQIHAGGRGKA-------
SUCC_WOLSU        KALLAQYGVGIPRGGVAETPAEATVIAQRL----GGEIWAIKAQIHAGGRGKA-------
SUCC_CAMC5        KEILKRYGVNVAKGAVAENLEQASEILNDL----EGEIFALKAQIHAGGRGLA-------
SUCC_ANAPZ        KGILSGFDVRVPKGVVVRSVEEVDSALGSL----AAGIVAVKAQIHAGGRGKA-------
SUCC_SULSY        KEIFRKYGLPVPRGYPAFDVKEAVEAAEELG----TWPVVVKAQIHAGGRGKA-------
SUCC_DESPS        KQLFRKYSIPVPEGLLCTNLQEVKTALKSL-----QLPIAVKAQIHAGGRGKG-------
SUCC_GRAFK        KEILNSFGVRIQRGTVARNAKEAVEAAKELTEKTGTGWHVIKAQVHAGGRGKG-------
A8Z5U7_SULMW      KKILATFGVKVPYSINALNIEETVYAAKKVFKKTKEYICVIKAQIHAGGRGKG-------
SUCC_SALRD        KGLFRDYGVSVPDGIVAETVDAAVDAARRLEEENDATLFIVKAQIHAGGRGKG-------
SUCC_LEPIN        KEILRRHKANVPFGVVIDKKENASKAHDEVTSKTGGSVVVVKAQIHAGGRGKG-------
SUCC_ECOLI        KQLFARYGLPAPVGYACTTPREAEEAASKIG----AGPWVVKCQVHAGGRGK--------
SUCC_HAEIN        KQLFEHYGLPVKNGAVCQSVEDVDLVLAQLS----GGKWAAKCQVHAGGRGK--------
SUCC_FRATT        KDLLESYGLKVQKGIVAHNPNEAAQAFDQLG----GKFAVVKAQVHAGGRGK--------
SUCC_THIDA        KQVLRSSNLNTPRGIAATSADAAADAARELG----GEAWVVKAQIHAGGRGK--------
SUCC_XYLFA        KQLFAEYGIPVPAGRIASSADEAVTAAKSLG----NGPWMVKAQIHAGGRGK--------
SUCC_DICNV        KALLRAAGIKTPRGIIIKNSVEAKEAAQQLG----GNRWVVKAQIHSGGRGK--------
SUCC_HYDCU        KSLFQQYGIPVPKGVMINDLADLDAALGQID----SKGWVVKAQIHAGARGK--------
SUCC_RUTMC        KTLFRCRDIQIPKGILIDNTTKINDVCKALG----GDVWVVKAQIHAGGRGK--------
SUCC_ACIF2        KRLLAEEGVPVPRAIPAFSVREAVNQARELG----GPAWVVKAQVHAGGRGK--------
SUCC_ZYMMO        MALLNERGVSVVPGYMAANVEEAVKAAEQLS----SPPYVIKSQILAGGRGKGYFRESPK
MTKA_RHILO        KELLARHGVHVPRGGLAYSPEQATYRAREIG----GGKWVLKAQVHSGARGK--------
SUCC_PARUW        KQILRKYGIPVPDFYIASSSKEVEEIIKQYQ----LQSAIIKVQVHAGGRGKA-------
SUCC_CHLTR        KDLLTAYQLPIPPYHVATSVPEVETAIQAEQ----WKAGVVKAQVHAGGRGKN-------
SUCC_BACTN        KEIFSKYGIPVERHTLCRTAAGAVAAYKRMG----SDRVVIKAQVLTGGRGKA-------
SUCC_RUBXD        KELLGRFGLRTLPGVVATTPEEARRAAERLG----GTVA-VKAQVLTGGRGKA-------
SUCC_HALSA        KEVFADAGIPTPESALATSVDEAVEVADALD----YPVA-VKAQVHVGGRGKA-------
SUCC_CUTAK        RDLFEKHGVPVLRGIVAETPEQASEAAAKLG----TPVVAVKAQVKVGGRGKA-------
SUCC_ACIC1        KELFAAHGVPITPGEVAENPDQAADIARRLG----GRVV-VKAQVKTGGRGKA-------
B8DUE4_BIFA0      RQLLEEQDIDVPKAVFAQNSHEVAEAADIIG----YPVV-IKAQVKIGHRGQA-------
SUCC_DEIRA        KEVLRDFGVNVQDGKVATTPEEVQAIYKEYG----QPVV-VKAQVHVGGRGKA-------
SUCC2_ARCFU       KQIFSKHGIRVARGELATSVEDVRGIAEELG----GKVV-LKSQVLVGGRGKA-------
SUCC1_ARCFU       KQIFAKHGIRVPRGEVATSPEEAEKIAEKLG----GRVV-VKAQILVGGRGKA-------
SUCC_PYRAE        KELFSKYGVKIPPGKVALTPEEVLKIAREIG----APVV-LKAQVVVAGRGKA-------
SUCC_IGNH4        KAIAKKYGIPTPEGVLIERPEQVNEAVEKLG----LPVV-LKAQVPVAGRGKA-------
SUCC_STAMF        KEIAKNNGIPVPRGGIAKTPEEARIVAEKIG----GEVV-LKAQVLVGRRGLA-------
SUCC_METTH        KEIFRAEGISTPRGGVAETPEEAERIAAELG----CDVA-VKSQVLTGGRGKA-------
A5ULQ1_METS3      KRIFNEEGIPILEGHVANSAEEATSIASDMG----VPVA-IKSQVLVGGRGKA-------
SUCC_METJA        KNIFKKYGIPVPESFLVSKEDDLNSINVDK------EVV-LKAQVLVGGRGKA-------
B2A0T1_NATTJ      KKLMNQCGISVPRGEAAFSAQEVEQKFTGLD----SPAV-IKSQVLVGGRGKA-------
A2SQQ5_METLZ      KQIFREAGIPVPNSVLITSADEANAAQKKVA----EKVV-LKAQVDVGGRGKA-------
L0HJ42_METFS      KNVIKAAGIPVPAGFLIRSPDELTPHLDALG----TAFV-LKAQVDVGGRGKA-------
B1L6Q9_KORCO      KEALASKGIPIPKGILARDPEEAASAVEKLG----GRGV-LKIQIPHGQRGKA-------
                                                           * *:  . **         

SUCC_HERA2        --GGIKLANT-PAEAFDAGKAILGMDI-------KGLTVEKV-LVAEAITFEK-----EI
SUCC_GEMAT        --GGVKFCPT-PEAAKEKATAILGMTI-------KDLTVEKV-LVTVAADIAS-----EA
SUCC_PELPD        --GGIRVAQD-PGQAGEIAKELLGTKLVTPQTGPEGLEVRRL-LVEEVVDIER-----EL
SUCC_PELCD        --GGVARVNS-VDQARNIAQRLLQHTLVTAQTGDQGLYVGSL-LVEEIVPVAR-----EM
SUCC_MYXXD        --GGVKLAKS-PAEAKELAKQMLGMKLKTIQTGPEGQTVHKV-YIEEGLAIGQ-----EL
SUCC_RHOBA        DQKGVVLVKS-AEEAKAAAEGLLGKKLVTIQTGPEGQTVSKV-FVEAGCDIAR-----EL
SUCC_BACSU        --GGVKIAKS-LDEVKAYAEELLGKTLVTHQTGPDGQVIKRL-LIEEGCDIKK-----EY
SUCC_SORC5        --GGVKVAKGGSAEATALAEKILGMQLVTKQTGPEGQKVRRL-YIEQGLDIAR-----EL
SUCB_NEUCR        LKGGVRVIYS-PTEAKMFAEQMIGHKLITKQTGAQGRLCSAV-YICERKFARR-----EF
SUCB1_MOUSE       LKGGVKIVFS-PEEAKAVSSQMIGQKLITKQTGEKGRICNQV-LVCERKYPRR-----EY
SUCB1_DICDI       LKGGVQLCSS-AEDVKKFASKMLGHTLVTKQTGEDGKVVHQV-YVTERHFLRK-----EM
SUCB2_DICDI       FKGGVHLCKT-GKEAERLCDEMLGKHLVTKQTTKEGTKVQSV-MLAESVDPKR-----EL
SUCC_AKKM8        FKGGVHVVKS-VEEVEEVAGKMLNQVLVTKQTGEAGKLVSKI-MVAEAVDLKK-----EC
SUCC_OPITP        FKGGVKVCKS-KAEAREAAGKMLGNTLVTAQTGPAGRKVQTI-YFNVGSQIKK-----EY
SUCC_RICPR        --GGVKVAKS-KEEAKKVAHDMFGINLVTHQTGPQGQKVNRI-YIESGCDILK-----EY
SUCC_PELUB        --GGVKILNT-IDELSVAAKELLGKTLVTHQTGPAGREVKRL-YVEESSNIDK-----EF
SUCC_WOLSU        --GGVKLAKT-PEEAGEIAKAMLGSRLITHQTSLEGKEVHKV-YVEEGLGIER-----EY
SUCC_CAMC5        --GGVKIASS-REQAIQFASKLLGMTLITPQTPKNGILVRKI-YIEEGLNFKQ-----EI
SUCC_ANAPZ        --GGVKIGKA-REEVADLVKSMLGSVLVTHQTSAAGQKVHAV-YLEEGVSIKK-----EY
SUCC_SULSY        --GGVKLAKS-IEEVQQIASELLGKKLATFQTGPEGLPVSRL-YIEEATAIDK-----EF
SUCC_DESPS        --GGVKLGKT-ATEVVQYADDILGMSLVTAQTGPSGRTVSKI-LLEEGVSIAR-----EL
SUCC_GRAFK        --GGVKLAKN-LKEVEEIAGEIIGMNLVTPQTSAEGKKVHQV-LVTEDVYYPGDNEPEEY
A8Z5U7_SULMW      --GGIKISKY-IDDVYKKSSKILGRRLVTNQTNNKGKIVNKV-LISEYVFNTE--KENEY
SUCC_SALRD        --GGVKLAHS-VEEVREHADNILGMDLVTHQTGPEGQTVRKI-LVTEGVDIDQ-----EY
SUCC_LEPIN        --GGVKVTKT-KEDAIAAVDKILGMQLITPQTGPEGKKVLKV-YLEQGIDIAK-----EY
SUCC_ECOLI        -AGGVKVVNS-KEDIRAFAENWLGKRLVTYQTDANGQPVNQI-LVEAATDIAK-----EL
SUCC_HAEIN        -AGGVKLVQD-VEEARAFAEKWLGQRLVTFQTDKLGQPVNQI-YFEETCDIDK-----EF
SUCC_FRATT        -AGGVKVVKS-SQEAREVAESLIGKNLVTFQTDAEGQPVNSVGVFEDVYPVTR-----EL
SUCC_THIDA        -AGGVKVVTS-IDAVRSVAAALLGKPLVTVQNAPDGQPVHTV-LVEETLPIAR-----EL
SUCC_XYLFA        -AGGVKFCKT-TDEVKQAAAAMLGTKMATYQSAGVALPVNLV-LVTEAGEITK-----EL
SUCC_DICNV        -AGGIKTAQT-LDEVHHISAAMLGSRLKTEQSSADGLPINEV-LIEEECRAIA-----TY
SUCC_HYDCU        -AGGVKLVET-AEEAEQAASELLGSSLATIQTAGKALPINAL-LIEQTLDIYQ-----EF
SUCC_RUTMC        -GGGVIFCHS-IEKVERVCNQLLGSKLITPQTDAKGLPVGQL-LIEAKQNIER-----EL
SUCC_ACIF2        -AGGVRMVDS-IAQVEKAAQELLGKPLVTAQTGPQGQHVAAL-LIEEPSRIAR-----EL
SUCC_ZYMMO        EGGGVRLVSD-IAAVKKQAESMLGRHLVTAQTDDQGIPVEKL-LITEAVSIAR-----EF
MTKA_RHILO        -AGGIKLCAN-DEEISSAAEAMLGRKLVTQQTGPRGKLISRL-YLEEAVDIAQ-----EL
SUCC_PARUW        --GGVKLATN-PQEILEFSQELIGKKIINEQTGPSGMISHQV-LISPAILIKK-----EF
SUCC_CHLTR        --GGVVIAHS-PEDLLAAADKLLHMQFSSNQTAGLSLPINKV-LISPLVEIAS-----EY
SUCC_BACTN        --GGVKLVDN-TEDTYQEAKNILGMSI-------KGLPVNQI-LVSEAVDIAA-----EY
SUCC_RUBXD        --GGIKVAES-PEEAEEAARRILGMDIR-------GHTVRRL-LIESGADIE-----REL
SUCC_HALSA        --GGIKLAEN-TAEAREAAESILGMDLK-------GYTVDRV-LVEEAVDFT-----NEL
SUCC_CUTAK        --GGVKIAKS-AAEAAERAEAILGMDIK-------GHTVHKV-MVAEGADIA-----EEY
SUCC_ACIC1        --GGVKLADD-ADAAAAAAEAILGMEIR-------GHRVHRV-LVTTAVDIA-----HEY
B8DUE4_BIFA0      --GGVRIAHD-RDEAILISEDILPMTIH-------GHKVSGI-LVTEAKNIL-----HEY
SUCC_DEIRA        --GGVKYSAN-EDKALENAKNILGMDIK-------GLTVNKV-LVTKAVDIDA---GTEY
SUCC2_ARCFU       --GGIKKAYS-VEEAVEKAKEMFGSVLK-------GHIVEKI-YVEEMIEVQ-----REM
SUCC1_ARCFU       --GGVKKANS-PEEAKEVAKKILGMTIK-------GHRVEKV-LVEEQLNMR-----KEY
SUCC_PYRAE        --GGIKVANS-PEEAYELSKRMFGMNIK-------GLIVKKL-YVTKFVEVE-----REM
SUCC_IGNH4        --GGVKLARD-PDEALELAEELFSKEIK-------GFPVLSL-LVEKAENIQ-----KEL
SUCC_STAMF        --GGVLFASN-SLEAEKVARELFSKRVR-------GEKVELI-LVEEKICID-----KEY
SUCC_METTH        --GGIRFASP-SG-VAEVTGDLLSSEVR-------GETVEKV-LIEEKIPID-----REL
A5ULQ1_METS3      --GGIKFADN-SGEAYKVADSLIGNTIN-------GERVHQL-LIEKKANII-----KEF
SUCC_METJA        --GGILFASN-KEEFIKKAEELFNKEVK-------GEKVEKI-LVEEKLPIE-----KEY
B2A0T1_NATTJ      --GGIKFADT-PQEARKVSKELFNMQIK-------GEQVTGV-LVEEQLDIS-----SEL
A2SQQ5_METLZ      --GGILPA-N-AENISDVARDLFAKTIK-------GLPVEKI-LVEEALEIS-----HEY
L0HJ42_METFS      --GGILMA-D-KATGTKVAKDLFAKQIK-------GLPVKEV-LAEQKLDIK-----HEY
B1L6Q9_KORCO      --GGIKLVNS-PNEAREVAKELFSRTFY-------GYEVSSL-LVEEPVDTA-----TEI
                     *:                 :   .              :                  

SUCC_HERA2        YLGVILDRATKRVVLIASSEGGVEIEEVAKINPDAIIKLAADPLLGLQPYQAQELAYSIG
SUCC_GEMAT        YVGIIVDRATKKPVFMVSAAGGIDIEEVAATTPEKILYHPVDTRYGLLPFEAMRMGFFL-
SUCC_PELPD        YLSITLDRESSRYCLIASAEGGMDIEEIARTAPDRIRILTIDPFIGLRSYQARRTALGLG
SUCC_PELCD        YLSLTLDRANGRYCLIASPDGGVDIEQTARKTPERVRRLTIDPLVGLRAFHARDIARFLG
SUCC_MYXXD        YLGVTLDRATSRITFMASREGGVEIEEVAEKHPEKILRESVDPAVGFQDFQGRKLAFGLG
SUCC_RHOBA        YLGIVVDRAGSKPVLMVSTEGGVEIETVAEETPELIFKEHFDPAVGLDGFQVRKLCKKLG
SUCC_BACSU        YIGLVLDRATSRIVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAIN
SUCC_SORC5        YFAMLVDRERRRIAVIASTEGGMDIEEVAHSTPEKIYKLFIDPVLGLAPYQGRQLAIALG
SUCB_NEUCR        YLAVLMDRASQGPVIVSSSQGGMDIEGVAKENPEAIHTTYIDINVGVTDEMARDIATKLG
SUCB1_MOUSE       YFAITMERSFQGPVLIGSAQGGVNIEDVAAENPEAIVKEPIDIVEGIKKEQAVTLAQKMG
SUCB1_DICDI       YFAILMDRKAGGPVMVASPEGGVDIEGVARDNPSAIFKEPIDIMIGVQPEQTKRLAEKLG
SUCB2_DICDI       YFAIVMDRKYGGPVMIASPQGGVDIESVAEETPDLIFKEPIDIVKGIRPEQTKNLAEKLG
SUCC_AKKM8        YFAILQDRARECPVIVASTEGGMDIEEVAATRPEAIIREHINPALGILPFQALKIAVALE
SUCC_OPITP        YLAILLDRATSRPVIVASTEGGMEIEKVAHDTPDRIFKVHVDPAYGLADFQVRELVFKLG
SUCC_RICPR        YFSIVFDRSASCITFIASTEGGVDIEAVAEKMPEKIIKFAVDPATGLQDFHMRGIAYELG
SUCC_PELUB        YLSCLVDRASSKIVFISSDQGGMDIEEVAEKTPEKIITTKIDITDEISDADCEKIIAIYA
SUCC_WOLSU        YLGIVLDRSLEMPVIMASRQGGVDIEEVAKNSPNEIIKVAVDPMIGFRPFHGRKLAFALG
SUCC_CAMC5        YLSLAFDRNSEKISLIVSKDGGVSIEETAKQNPHLIKTISIDPQIGLCGFHTKELINFLQ
SUCC_ANAPZ        YLGAVVDRKAGMVSVIFSSEGGMDIEEVAHSRPEMVVVVNVDPVYGFLDFHGRKLCYGLG
SUCC_SULSY        YVAITLDRSKSKPIIMVSAAGGMEIEEVAATNPEAIITQTIEPFIGLRSYHARELALKLG
SUCC_DESPS        YLSILVDRERACITIIACQDGGMNIEEVAASTPERIGKIHINPLIGPRSYHINQAREWLN
SUCC_GRAFK        YMSVLLNRATGRNMIMYSTEGGMDIETVAEETPELIFTEEIDPATGLLGFQARRIAFNLG
A8Z5U7_SULMW      YISIFYDRNIYQNRILYSKEGGLEIES--KYRYKKIFLQKIDPYIGIQDFLIRKIAFNLK
SUCC_SALRD        YLGVTLDRETSMNAIMVSTEGGVDIETVAEESPEKIQRVWVDPSIGLRPFQTRQLAFAMG
SUCC_LEPIN        YLSILLDRSIRKTIIMASTEGGMEIEEVAETHPEKILKIAIDPGIGLQVNQARQLAFELG
SUCC_ECOLI        YLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLG
SUCC_HAEIN        YLSAVVDRTSQKVVFIASSEGGMNIEEVVQNSPHLLHKVTIDPLFGGLPYQGRELAFKLG
SUCC_FRATT        YLGAVVDRSSRKVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQAREVAFKLG
SUCC_THIDA        YLSLLVDRASERVAVVASAAGGMDIEQVAHATPEKVLTEICDPLLGVQDFQCRALAFALG
SUCC_XYLFA        YLSVLVDRGTRSITYIASSEGGVDIEHVAAETPEKIQTLNVDFVEGLQPYQGRDIGFHLG
SUCC_DICNV        YLALTLDRPRQQIVFIASMAGGTEIETVAETNPEAIIYAGVNPAIGFSPYLSARVGGALQ
SUCC_HYDCU        YLSLMVDRVTKTHTFVISAAGGMDIELVAEASPEKILSVHVDPTVGLMPYQCREIAFALG
SUCC_RUTMC        YLSLLIDRQTHKITVLSSTKGGMDIEKVASKTPDKIIKFGIDPLGSLSVQDCTFLAKKLG
SUCC_ACIF2        YLALMVDRGQARITFLATREGGVDIEELAASRPEALHRVVVEPSTGFLPFQARQLGFQFG
SUCC_ZYMMO        YLSLLVDRQTGRVTFVASPEGGMDIETVAKEKPEAIHRIAIDPATGFQPHHGRMIGFALG
MTKA_RHILO        YVGFVLDRKEERVMIVASAAGGMEIEDIVEKEPNSILRTSVDPGVGMQRFQAREIAFGLG
SUCC_PARUW        YLGITINRELASRVLIASPIGGVNIEKIAHEQPNQLLMLPIPLEETFRSYHLIRIASFMG
SUCC_CHLTR        YLAIVIDRKHRCPVIMLSKAGGVDIEEVAEKQPDQLLKMTLPSSGKIYGYQLRRIAKFME
SUCC_BACTN        YVSFTIDRNTRSVILMMSASGGMDIEEVARQSPEKIIRYAIDPFIGLPDYLARRFAFSLF
SUCC_RUBXD        YLSAMVDRESRRPLILFSTEGGVDIEEVAERSPGSIVRLHVDPLVGLLPYQVRELTFASG
SUCC_HALSA        YVGVTMDRSEGAPVVMVSERGGVDIESVAEEAPEDIVREHVDPSFGLQAYQARNAVYDAG
SUCC_CUTAK        YFSILLDRGERRYLAMCSREGGMDIETLAKERPEALAKVPVDPIDGVDDAKAREILSEAG
SUCC_ACIC1        YVAFLVDRSRRSFLAMGSAEGGVEIEQVAAENPQAIVRVPIDATEGVDATLAARIADDIG
B8DUE4_BIFA0      YVSISVDRSSRDFDVLATANGGTEVEEVARKHPESVKRLHISALEDFDLEAATKMAESIG
SUCC_DEIRA        YVGMIVDRNVQSYTLMASAEGGMEIEEVAATNPEKIIRHRVDPVTGLRPYEAREVAIKAG
SUCC2_ARCFU       YAGLTIDRANKGIAAILSSVGGMDIEEIAVKHPEKIARIAVNPKWGLWDYQIRELLLNSQ
SUCC1_ARCFU       YVGYVVDKSSRLPTVIFSRMGGMDVEEIAAKHPDAIHRIYFDPLWGLKDYEVRKALFRAG
SUCC_PYRAE        YLSLIIDRASRRYLFLASPVGGMDIEEIAKTSPEKIKRVYVDPATGLRDYHVRSIVSWLG
SUCC_IGNH4        YLSFTIDRTNRKVVMLASAEGGMEIEELAKEKPDAIVKLPIEPEVGLKAHEAREVGKRIG
SUCC_STAMF        YLSLTIDRSNREIVYLVSPLGGVEIEELVKKYPDKLLRIRVDPVIGYKPYMSRLAAKFLG
SUCC_METTH        YVSAVIDRTAKMPLIMASAEGGVDIEELAARSPEKIVRYHINPLDEFLPYEAREIARKMG
A5ULQ1_METS3      FLSISIDRANKKPVIMVSNEGGVEIENLAKTNPEKIIKYHPNPLIEFLPYESREIARKMG
SUCC_METJA        YVSIIIDRDAKKPLIIFSTEGGVDIEEVAEKNPEKIIKYHIDVRKPFLPYIARWIVKEAK
B2A0T1_NATTJ      YLSITVDTGTKKPLIMASTQGGVDIEEVSD---DLIVKRHIEPDWGVLPYLCREITDQLN
A2SQQ5_METLZ      YLSITIDRAKKMPLILFSSEGGVEIETLAKERPEALRRVYVDPSFVTLPDFI-----VRN
L0HJ42_METFS      YLSITVDRSSRQPLILFTEAGGVEIEVTAKEHPELIRKVVANPLMKDLPPFL-----IRE
B1L6Q9_KORCO      YIGGIIDRNSRGMTFISTPYGGMDVEEIAASHPESIEKRTVHPLMGMRSHIARALAKNAA
                  : .   :        :    ** .:*         :                        

SUCC_HERA2        ITDA-KQARQFSSIATGLYRAFVENDAELAEINPLVVLPNGQ------LQALDSKIVLDD
SUCC_GEMAT        YQDV-KLARQAAKIMQQLYTAFMSAGCSIAEINPLVVTPQNE------LIAVDGKMVIDD
SUCC_PELPD        L-VG-PLCEECVELILNLYRCLLERDCSLVEINPLVVTNAGW------LVAMDTKMTFDD
SUCC_PELCD        L-DG-PLSAAASKVILSLYRCLLEKDASLVEINPLAVTEEGR------LMAMDAKVSIDD
SUCC_MYXXD        L-TG-PTVNKFTQFCSALYRMFMDTDASLVEINPLVILKDGG------VVALDAKVTFDE
SUCC_RHOBA        I-EG-AAAKSAYKFMTAMCRFFVDFDCEMAEINPLVITGDGE------MVALDAKIIFDE
SUCC_BACSU        I-PK-ELVGKAAKFMLGLYKAFVEKDCSIAEINPLVVTGDGN------VMALDAKLNFDS
SUCC_SORC5        LTAK-ETQRQFLKLVASLYACFTAEDCSLLEINPLVVTGAGD------VFALDAKVSFDD
SUCB_NEUCR        F-SE-QCVEEAKDTIQKLYKIFCEKDATQIEINPLSETSDHK------VMAMDAKFGFDD
SUCB1_MOUSE       F-PS-NIVDSAAENMIKLYNLFLKYDATMVEINPMVEDSDGK------VLCMDAKINFDS
SUCB1_DICDI       F-SK-KNISMAQDQMKKLYDFFIKNDCTLVEINPLAETASGD------VLCMDAKLNFDD
SUCB2_DICDI       F-TG-EKAKIAQQQMENLYQLFIKSDATQVEINPFAETTDGQ------VICMDAKINFDD
SUCC_AKKM8        L-TG-PLLRQATKLITNVYKLFTALDCSLVEINPLVVTTDDR------VCALDAKFNFDD
SUCC_OPITP        F-TA-AEGKNASKLIRALYRCFWENDASMVEVNPLITTPDGQ------VEALDAKVAFDD
SUCC_RICPR        F-KD-NQAKQMKEIVKAVYNAFIETDATQIEINPLIINSYGN------LLALDAKITFDD
SUCC_PELUB        L-AD-DAKKQAIALIKSVYKMFLGTDANMVEVNPLILTKEKK------IICLDAKVNFDS
SUCC_WOLSU        L-AK-EQVGLFVDFCTSLFRLYVQKDAEIVEINPLVFTSCKR------FVALDAKISFDN
SUCC_CAMC5        I-DK-ILWSKLDTLLQNLYKIYIFKDANLIEINPLVLTQDDE------FYALDAKMSFDD
SUCC_ANAPZ        L-KK-EQVVQITAMARKVCRALMETDASQVEINPLVETTCGE------FIALDAKMTFDD
SUCC_SULSY        L-PK-NLLNKAASIFTTLYKIYIELDASMVEINPLVLTKDGN------IVILDAKIEFDD
SUCC_DESPS        I-AQ-EQARAFSLFIHALYKLFLDYDCSMVEINPLIITEDNQ------LIALDAKVDTDS
SUCC_GRAFK        L-SG-KGFKEMTKFVMSLYEAFEKSDSSLFEINPVLKTSDDL------IMAVDAKVTLDD
A8Z5U7_SULMW      I-KY-SAFIRFKTFIRNIYNAYIYSDASLLEINPVFITKNNE------ILAIDAKVILDD
SUCC_SALRD        L-EG-DAFKQAVASIQGLYEAFEENDCTLAEINPLVQTPGGD------IEAVDAKVNLDD
SUCC_LEPIN        L-PA-ESHKSFQSLLAAIYEAYIKEDASLLEINPLILTKQNE------IIAGDCKIDLDE
SUCC_ECOLI        L-EG-KLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGD------LICLDGKLGADG
SUCC_HAEIN        L-SG-TQNKQFTDIFMGLSRLFLEKDLSLLEVNPLVLTPQGN------LVCLDAKISVDD
SUCC_FRATT        L-EG-KQINDFVKTMLGAYKAFIECDFALFEINPLAVRENGE------IVCVDGKINLDS
SUCC_THIDA        L-GG-DAYKDFCRLLPQLYRVFVANDLSLLEINPLVVTTDNR------VLPLDCKMSVDD
SUCC_XYLFA        L-EA-KQVNQLSKIMISLYQLFNDKDLSLIELNPLAILSNGD------LYALDGKINSDD
SUCC_DICNV        L-DK-SYQLPLTKLMNRLYQLFIDNDLTLLELNPLIITEDHE------FLPLDAKISIDD
SUCC_HYDCU        L-TG-TAFKQMASVMQGFYQLALDKDVSLLEINPLVLTAENE------LVALDAKVNIDS
SUCC_RUTMC        F-NT-ELTKQFNNTLLSLYEIFTQKDVNLIEINPLIITQENK------LLALDGKIDFDD
SUCC_ACIF2        L-DA-GQVQQLTRIMQGMYRLAQRLDALMVEINPLAITAEGR------LLALDAKVVMDD
SUCC_ZYMMO        L-SG-DVFKQGIKLAASLYKAFTTSDMSLLEINPLVETNDGK------LLPVDAKISFDD
MTKA_RHILO        L-DH-NLIGKATETIFSCYQVFRDYDASMLEINPLVVTRDGN------LIALDAKMSFDE
SUCC_PARUW        W-KG-KQIQEGVAIIQSLVKAFKETDASLLEINPLVETKEGH------LLALDAKLSIDD
SUCC_CHLTR        W-DQ-PIADQGNRIIRQLLQCFYEKDASLLEINPLVLTKDGS------LVILDAKMTIDD
SUCC_BACTN        P-HI-EQAGRMAAILQALYKIFMENDASLVEVNPLALTAKGI------LMAIDAKIVFDD
SUCC_RUBXD        LSG--ETAKDFGRAVQNLYEAFRGIDASLVEINPLVVTGE------GEVVALDAKVTVDN
SUCC_HALSA        IEQ--DVAGDVAKIVQGVYDLWADSDATEVEINPVMVTSE------RDVVAADAVMKLDE
SUCC_CUTAK        FPD--SEQDAIVPAVLKLWETYRDEDATLVEVNPMIKTGD------GRILAIDGKMTVDN
SUCC_ACIC1        FPA--AVRDEAVRILRGLWEAFQAEDASLVEVNPLVRTLD------DRLIALDGKVTLDD
B8DUE4_BIFA0      FYH--ADSAQAAQILLNMWRCFKQNDATLVEINPLAKVGDPDDESSKSLCALDAKISLDD
SUCC_DEIRA        FRG--NL-NKIADMMVKMSKAALERDAVLVEINPLFVDAD------GTPIALDTKFEIDD
SUCC2_ARCFU       MPR--EYWKEVASILKTLYRIMVHYEAELVEINPLVVTPDG-------LVAADARLNIDD
SUCC1_ARCFU       FEG--EEFKQMFDIIKKLVDIAFAYEAELTEINPLAVTDEG-------FLAADARLNTDD
SUCC_PYRAE        FKQGTSQWQQAASIVQAMYRIMVDYDAELVESNPLAVTKEGE------VIPLDARVIVDD
SUCC_IGNH4        LSG--QLLRQFEGIAKTMYKIFEDYDAELVESNPLAITDRG-------LVALDFRMIVDD
SUCC_STAMF        LPK--ELWPSMHKIMNSMYNIMKNYDADLVEFNPLVKTCSNE------IVAVDAKITIDD
SUCC_METTH        LES--ELIPSVGGVIWKLYQLFRKYDARLAEINPLVISGDS-------VIAADAKLEVDD
A5ULQ1_METS3      VPS--ELISPMGDVIYKLYKLFEKYDAETAEINPLVLTDEG-------LIAADAKFVVEN
SUCC_METJA        LPS--NEIGKVADVIYKLYKIFKELDATMVEINPLVITKDGN------VYAADAVLHLDD
B2A0T1_NATTJ      LPG--EASKQVSAIISKLYDTFKTYDAELVEINPLVITEDNR------VIAADGKMTIDD
A2SQQ5_METLZ      VIG--TNPKEIGTIVRDLFAVFRSRDAVLAEINPLVMTPKG-------ILAADGKIILDD
L0HJ42_METFS      LLG--SAPKEIGPVINKLYKVFIEKDALLAEINPLVATPNG-------IFAADAKIIVDD
B1L6Q9_KORCO      KNV-PDKVNEIQRIISSLWDVAVEYDAVMLEINPLALTKDGR------LVALDARIEVDD
                                                * **.                 *  .  : 

SUCC_HERA2        SGLFRHSEVAGMRDIA--GEPESEIKARENGLTFIKLD-GNIGCMVNGAGLAMATMDVVN
SUCC_GEMAT        NELDRLPQIAALRDES--SEAPSEVDARNANLTFIKLD-GNVGCVVNGAGLAMATMDLVK
SUCC_PELPD        NALQRHCEYPDLVDYS--QLNPLEIAAARFDLSYIKLS-GAIGCMVNGAGLAMATLDVLK
SUCC_PELCD        SALFRQKEMLEWLDES--QLAPLEVRAAHSDIAYIKMD-GCIGCLVNGAGLAMATLDMLS
SUCC_MYXXD        NALYRHKDLLEYRDLA--EEEPREIQAKEWDLAYIALD-GNIGCMVNGAGLAMATMDTIK
SUCC_RHOBA        NAMFRHKDLEELRDLS--EEEESELRAKKAGLSYVKLD-GNIACLVNGAGLAMSTMDIIK
SUCC_BACSU        NALYRQKDIMEYRDLD--EEDPKEIEASKYDLSYISLD-GNIGCMVNGAGLAMSTMDIIK
SUCC_SORC5        NAEFRHADWNGMRDVD--EEDPVELQAKRAGLSYVSLD-GDIGCLVNGAGLAMATMDIIL
SUCB_NEUCR        NADFRQPDIFKLRDTT--QEDPDEVRAAQAGLNFIKLD-GDIGCLVNGAGLAMATMDIIK
SUCB1_MOUSE       NSAYRQKKIFDLQDWS--QEDERDKEAANADINYIGLD-GSIGCLVNGAGLAMATMDIIK
SUCB1_DICDI       NAAFRHPDIFKLRDKS--QEDPREVKAAEFDLNYIGLD-GNIGCLVNGAGLAMASMDIIK
SUCB2_DICDI       NASFRQKEIFEMRDTA--EEDPREVEAGKFGLNYIGLD-GNIGCMVNGAGLAMATMDIIK
SUCC_AKKM8        NALYRHPEIMEMRDET--EEDPREVEAGKYDLNYIGLD-GNIGCMVNGAGLAMATMDIIK
SUCC_OPITP        NALFRHPELVELRDLN--EEDPKEIEASKHELNYIALD-GNIACLVNGAGLAMSTMDIIK
SUCC_RICPR        NGLFKHPNITAMRDHD--EEDPLETRAANAGLSYVKMD-GNIGCMVNGAGLAMATMDIIK
SUCC_PELUB        NALFRHPEIIELRDLN--EEDPTEIDASKHDLAYIKLD-GSIGCMVNGAGLAMATMDIIK
SUCC_WOLSU        NALYRHPEIVAMRDLS--EEESSEIEAGEYNLNYVKLQ-GNVGCMVNGAGLAMATMDIIK
SUCC_CAMC5        SALFRHEDIRALNDET--QTDTSENEAKAQRLNYIKLE-GSVGCVVNGAGLAMATMDIIK
SUCC_ANAPZ        NGLFRRPEIVKLTDPH--EYSEEELEAAKYGLSYIKLD-GNIGCMVNGAGLAMATMDIVK
SUCC_SULSY        NGLFRHPEIMEMDDPT--QISPLEVEAKKFNLNYIKLD-GNIACMVNGAGLAMSTMDTIK
SUCC_DESPS        NALFRQRELQKMHDPA--EDDPAEAEAAKFNLNYIKLS-GNVGNMVNGAGLAMATMDIIK
SUCC_GRAFK        NALFRHKDYAEMRDVR--EENATEVEAREVGLNYVDLD-GNVGCMVNGAGLAMATMDLIK
A8Z5U7_SULMW      NALFRHMDYKEMYDEK--EYDLIELEAKKAGLNYLKLD-GEVACMVNGAGLAMSTMDMIK
SUCC_SALRD        NALFRHPDLEEMRDLH--EEDPTEVKAGEHGLSYITLD-GNVGCMVNGAGLAMATMDIIK
SUCC_LEPIN        NALYRHADNAAFRDIT--EEDPLEVQASEFNLNYVKLD-GNIGCMVNGAGLAMATMDIVK
SUCC_ECOLI        NALFRQPDLREMRDQS--QEDPREAQAAQWELNYVALD-GNIGCMVNGAGLAMGTMDIVK
SUCC_HAEIN        NALFRHKDLLALQDLT--QNDAREAEAEKFQLNYVALE-GDIGCMVNGAGLAMGTMDIVK
SUCC_FRATT        NALYRHPKLLALRDKS--QENAKELKASEHELNYVALE-GNIGCMVNGAGLAMATMDIIQ
SUCC_THIDA        NALYRRKALADLRDDS--QIDAKEAAANAANVNYVALA-GNIGCMVNGAGLAMATMDLIQ
SUCC_XYLFA        NATFRHKELAAMRDKT--QEDETEVLASENDLNYVTMD-GNIGCMVNGAGLAMATMDVIK
SUCC_DICNV        NALFRHQELVDLRDTT--QEDHRETQAQELQLNYVPLD-GTIGCIANGAGLAMATMDIIK
SUCC_HYDCU        NALYRQPGLVEMRDIS--QEDVREAKAADHQLNYIALD-GNIGCMVNGAGLAMATMDLIK
SUCC_RUTMC        NALYRHKDIAKLRDIS--QEDEKERLASEYQLNYILFD-GNIGCMVNGAGLAMATMDLIE
SUCC_ACIF2        NALYRHPESDELFDST--QQDGREITARQFGLNYISLE-GNIGCMVNGAGLAMATMDLIK
SUCC_ZYMMO        NALFRHPDIAALGEAG--ASDPLEQEARQAGLSYIKLD-GSIGCMVNGAGLAMGTMDIIQ
MTKA_RHILO        NALFRRPEISELRDKS--QEDPRETFASDRGLSYVGLD-GNIGCIINGAGLAMATMDMIK
SUCC_PARUW        NALFKHEDLKTLFDPS--QMSNNEARAQQFELAYVALE-GEIGCMVNGAGLAMATMDLIQ
SUCC_CHLTR        NALYRHPQLADCYDPS--QENIRDVLAKQLGLSYIALD-GTIGCLVNGAGLAMSTLDILK
SUCC_BACTN        NALYRHPDVLSLFDPT--EEEKVEADAKNKGFSYVHMD-GNIGCMVNGAGLAMATMDMIK
SUCC_RUBXD        SSLYRHQEIAGWRDVE--AADPQEHRAQEVGLQYVKLD-GDVGILGNGAGLVMSTLDVVA
SUCC_HALSA        DALFRQPAFADMEEDA--AEDDLEAKANEYGFDYVRLD-GNTGIIGNGAGLVMTTLDLVD
SUCC_CUTAK        NASFRQPDHAGLVDRA--TTDPLELRAGELGLNYVKLD-GNVGVIGNGAGLVMSTLDCVA
SUCC_ACIC1        NADFRHPDRARFADPS--AADPLEAKAKAAGLHYVKLD-GEVGVIGNGAGLVMSTLDVVA
B8DUE4_BIFA0      NAAFRHDGWKRFADPI--VPDPFEQRAREHNLHYVHLT-GEVGVIGNGAGLVMSSLDAVA
SUCC_DEIRA        NAMYRHKDLAHYRELS--AEHPLEVEASDYGFAYVKLDDGNVGVLGNGAGIVMTTLDVVN
SUCC2_ARCFU       SALFRHRDLEKLRDYTE--ADQMERIAMEKGLNYVKLD-GNVGVLANGAGMAMATMDLIY
SUCC1_ARCFU       NALYRHPELAELREATE--EDPLEREARLKGINYVHLG-GNVGVIANGAGLAMATMDIIN
SUCC_PYRAE        NALFKHPELEKALEEDPRDVTEFEAYAKKIGFHYVELD-GDVGIIGNGAGLTMATMDLVY
SUCC_IGNH4        NAIFRHPELEASRE---RELSELEKEAARWGFFYVELD-GDIGIIGNGAGLTMATMDVVN
SUCC_STAMF        NSLYRHIEFAEKYG---RELSEMEAIAKKLGFSYVELD-GDIGIMCNGAGLTMATMDMVA
SUCC_METTH        DSIYRHREFMEMEE-----YEPEE-------FAFVKLD-GDIAVIGNGAGLTLTAMDLIK
A5ULQ1_METS3      DSLYRHPDLVKLAR-----YKKKA-------VDFVKLD-GDIAVIGNGAGLTLTGMDMIK
SUCC_METJA        DAAFRH-NYEEFEE-----YKNKEK----LPFAYVELD-GDVAVIGNGAGLTLASMDIIN
B2A0T1_NATTJ      DAMYRQDELPRVSE-----KTSLEQQVEKIGLSFVELE-GDIAIMANGAGMAMATVDVIE
A2SQQ5_METLZ      NSLIRQ-GISENRD-----LTPREAEAEKHGFSYVELE-GNIGVIGNGAGLTMATLDIIS
L0HJ42_METFS      NALGRQ-GITVNRD-----LSEREREAEKHGFSYVELD-GKIGVIGNGAGLTMATLDLIE
B1L6Q9_KORCO      NALFRHMEFEKRYYS---SENPRENEARKRDIAYVELD-GNIGTMANGAGLAMATMDLVH
                  .   :                          . :: :  *  . : ****:.:  :* : 

SUCC_HERA2        LFGG------EPANFLDIGGGANAQK-VAAALDIILDDPNVKVVMVNIFGGITRCDEVAK
SUCC_GEMAT        YYGG------DPANFLDIGGSSNPEK-VVNALRIITADPNVKCILFNIFGGITRTDDVAN
SUCC_PELPD        EAGG------EPANFLDVGGGASREK-VAEAFRIILQDRDVRGVFVNIFGGIMRCDIIAQ
SUCC_PELCD        ECGG------QPANFLDVGGGADQDK-VVEAFRILLEDPAVEGVLVNIFGGIMRCDLIAQ
SUCC_MYXXD        LVGG------SPANFLDVGGGANKEK-VTAAFKLILADPAVKAVLVNIFGGIMKCDVIAE
SUCC_RHOBA        YHGG------EPANFLDVGGGANAAQ-VTEAFRILLSDPNCKGVLVNIFGGIARCTTIAG
SUCC_BACSU        HYGG------EPANFLDVGGGATAEK-VTEAFKIILSDQNVKGIFVNIFGGIMKCDVIAE
SUCC_SORC5        HYGG------KPANFLDVGGGASQEQ-VKTAFQIILRSERVRGIFVNIFGGIMRCDVVAA
SUCB_NEUCR        LNGG------QPANFLDVGGGATPAA-IREAFELITSDPKVTAIFVNIFGGIVRCDAIAH
SUCB1_MOUSE       LHGG------TPANFLDVGGGATVQQ-VTEAFKLITSDKKVQAILVNIFGGIMRCDVIAQ
SUCB1_DICDI       LYGG------SPANFLDVGGGATQKQ-VTEAIKLISSDKKVKSILVNIFGGIMKCDVIAL
SUCB2_DICDI       LKGG------IPANFLDVGGSASEQA-VTEAFKILTKDPRVKCLLVNIFGGIMKCDIIAS
SUCC_AKKM8        YYGG------EPANFLDVGGSATEEM-VTNAFRILTSDKNVKALLVNIFGGIMRCDVIAQ
SUCC_OPITP        HFGG------TPANFLDVGGGASREQ-VVAAFKIILGDKNVRGILVNIFGGIMDCNVIAQ
SUCC_RICPR        LYGA------LPANFLDVGGGADRER-VKEALKIILSDKEVKGILVNIFGGIMRCDIIAE
SUCC_PELUB        LYGE------EPANFLDVGGGASKEK-VSAALKIILSDKNVKGILINIFGGIMRCDVLAQ
SUCC_WOLSU        HEGG------EPANFLDVGGGAKPET-VAKGFEIILKDPNVKAIFVNIFGGIVRCDRVAN
SUCC_CAMC5        ELGG------EAANFLDVGGAATGEG-VAKAFRLILNDRRVKVIFVNIFGGIVRCDRIAA
SUCC_ANAPZ        YYGG------EPANFLDVGGGASKDT-VREAFKIILRS-GVDGILVNIFGGIMRCDVIAA
SUCC_SULSY        LAGG------EPANFLDVGGSANATQ-IANAFKIILSDPNVKAIFINIFGGILRCDRLAE
SUCC_DESPS        RAGA------EPANFLDVGGSADAER-IENGFRIILADTNVKAILINIFGGILRCDILAQ
SUCC_GRAFK        QAGG------EPANFLDVGGTADAKR-VEEAFRLILKDDKVEAILVNIFGGIVRCDRVAQ
A8Z5U7_SULMW      LYGA------NPANFLDLGGKADSKC-IKKGFDIILKDKKVKIILINIFGGIVRCDIVAE
SUCC_SALRD        LAGG------EPANFLDVGGAASAET-VEAGFRIILEDPNVEALLLNIFGGIVRCDRVAQ
SUCC_LEPIN        LAGA------EPANFLDVGGGANKTT-VTNGFKIILGDPNVKGIFVNIFGGIVRCDMVAE
SUCC_ECOLI        LHGG------EPANFLDVGGGATKER-VTEAFKIILSDDKVKAVLVNIFGGIVRCDLIAD
SUCC_HAEIN        LYGG------KPANFLDVGGGATQER-VAEAFKIILTDPSVKVILVNIFGGIVRCDLIAE
SUCC_FRATT        LYGG------KPANFLDVGGGATKER-VIEAFKLILDDENVKAILINIFGGIVRCDMIAE
SUCC_THIDA        LEGG------APANFLDVGGGATPET-VAQGFKIILLDPNVKAVLINIFGGIVRCDVIAE
SUCC_XYLFA        LNGG------EPANFLDVGGGATKER-VTTAFKLILSSNKVKAIFVNIFGGIVRCDMIAE
SUCC_DICNV        LYGG------EPANFLDVGGDATSER-VKQAFKLILTSSRIKSILVNIFGGIVRCDLIAD
SUCC_HYDCU        LNGG------EPANFLDVGGGATPER-VAEAFKLILSSSDVQSILVNIFGGIVRCDLIAD
SUCC_RUTMC        HFGG------SPANFLDVGGGTTADR-VAKAFELIQTETNVKSILVNIFGGIVHCDLIAQ
SUCC_ACIF2        LHGG------EPANFLDVGGGAAADK-VNQAFKLILSDTRVKAILVNIFGGITRCDLLAE
SUCC_ZYMMO        LHGE------MPANFLDVGGGASKEK-VAAAFRIILSDPSVKGILVNIFGGIMRCDILAE
MTKA_RHILO        IAGG------EPANFLDIGGGASPER-VAKSFRAVLGDKNVETILVNIFAGINRCDWVAE
SUCC_PARUW        YHGG------RPANFLDVGGGASQVK-VAEGFRIILSDSNVKAILINIFGGIMNCETLAS
SUCC_CHLTR        LYGG------SAANFLDVGGSASEKQ-IQEAISLVLSDKSVRVLFIHIFGGIMDCAVVAS
SUCC_BACTN        LHGG------NPANFLDIGGSSNPVK-VVEAMKLLLQDEKVKVVLINIFGGITRCDDVAI
SUCC_RUBXD        QA------GGRPANFCDVGGGADAEK-IATALEIVASNENVRSVFFNIFGGITRGDEVAR
SUCC_HALSA        YY------GGQPANFLDIGGGAKADR-VANALDMVFSDENVDSVVFNIFGGITRGDEVAK
SUCC_CUTAK        YAGENFPGSPAPANFLDIGGGASAEI-MANGLDLIMSDEQVRSVFVNVFGGITACDQVAL
SUCC_ACIC1        YAGETY-GGIRPANFLDIGGGASAEV-MAAGLTVVLADPAVRAVLVNVFGGITACDAVAR
B8DUE4_BIFA0      FAGEEQGTGVKAANFLDIGGGASSQV-MCESLEIILSDPQVESVFINVYGGITSCEQVAL
SUCC_DEIRA        RA------GAKPANFLDIGGGAKADV-VYNAVKLVSKDPDVKAIFINIFGGITRADEVAK
SUCC2_ARCFU       IYGG------KPANFLDIGGGASAEV-VREAINLILSDKNVKVVFINIFGGITRCDEVAK
SUCC1_ARCFU       LMGG------KPANFLDTGGGLADPVKMKNCLLHVLKDPNVRVVFINIYAEITRCEKVAE
SUCC_PYRAE        HFGG------RPANFLDIGGGASREV-VKEAVKVLLHHPRVKVIFVNIFGGITRADEVAL
SUCC_IGNH4        YYGG------RPANFLDIGGGARRDR-VKAAVNVLLKNPKVKVIFVNIFGGITLASEVAQ
SUCC_STAMF        YYGG------RPANFLDIGGGASRER-VREAAKLLLKHDKVKVLLVNIFGGITRCNEVAR
SUCC_METTH        LNG-------EPATFLDIGGGASEDV-IRRALDLVISHPSVRVVFLNVLGGITRADDVAR
A5ULQ1_METS3      FHGG------EPATFLDIGGGASEES-IKKSLNIVLNYEPVKVVFLNVLGGITKADDVAH
SUCC_METJA        NLGR------KPACFLDIGGGADAET-VKLALRKVLENKNVKGIFINILGGITRCDEVAK
B2A0T1_NATTJ      QYGG------KAANFLDAGGGASVEP-TKKALELLLN-TDPRAVIINIFGGITRCDDVAN
A2SQQ5_METLZ      HYHG------KAANFLDVGGGAASDR-VMYAVQLVASMPGVKVIVVNLLGGITRCDEVAK
L0HJ42_METFS      YYGG------KAANFLDVGGGAESER-VKNAVRLVASVPSVKVIVVNLLGGITKCDEVAK
B1L6Q9_KORCO      TFGG------KPANFCDVGGGASADR-VANALEIILSNPRASVVLINTLCGITSALDVAL
                             .* * * **              :        :..:    *     :* 

SUCC_HERA2        GIVEA--QKIIK---RQVPMVVRLVGTNEAEGQRILADASL------TPASTLADAAQKA
SUCC_GEMAT        GIVTA--TKANP---LKVPIVIRLTGTNEELALQILKENGF------SASSDMDSAVQRA
SUCC_PELPD        GIIDA--ASGGG---CRLPIVVRMDGNRVEEGKQLLRESGL----NIRIGENMGDGAQQI
SUCC_PELCD        GLIAA--AEQVG---CQLPIVVRMAGARRDEGKHLLQQTQL----NISWQDGLAAAATAI
SUCC_MYXXD        GIIAA--AKEVQ---LKVPLVVRLEGTNVEKGKELLSNSGL----AITPADNLRQAAEKA
SUCC_RHOBA        ALITA--SKEVG---FNVPLVVRLEGTEVEEGRKMLAESDV----DIINAMDLTDAAKKI
SUCC_BACSU        GVVEA--TRQVG---LTLPLVVRLEGTNVDLGKKILSESGL----NITSAESMADGAQKI
SUCC_SORC5        GVIAA--AKELG---LKVPLVVRLEGTNVEAGRKLLDESGL----TIQSASSMADGAQKI
SUCB_NEUCR        GLINT--VKSLD---LKIPIIARLQGTNMEAARQLINDSGM----KIFSIDDLQSAAEKS
SUCB1_MOUSE       GIVMA--VKDLE---IRIPVVVRLQGTRVDDAKALIADSGL----KILACDDLDEAAKMV
SUCB1_DICDI       GIIAA--LKELS---IATPLVVRLQGTNVEAAKKIMEDSGL----RLIAADNLDDAAQKS
SUCB2_DICDI       GIVNA--SKQVG---LKIPLVVRLEGTNVNIGKEILEKSGL----NITSASDLDDAAIKA
SUCC_AKKM8        GIVAA--AKNID---MKIPLVVRLEGTNVEIGKKILADSGI----AIIPADNLDEAAQKA
SUCC_OPITP        GIVDA--VKEVG---LELPLVVRLEGNNVAAGKATLATSGL----KLVSGDSMADAAQKI
SUCC_RICPR        GIIAA--AKDIG---IKVPLVVRLAGTNVEKGKEILSNSDL----KIIPAHDLADAANKI
SUCC_PELUB        GVVDA--AKEIN---ISVPLVVRLAGTNFKEGKEILDNSGL----KLISAENLDDAAQKI
SUCC_WOLSU        GILEA--AKIVH---VSVPVVVRLDGTNAKEAKEILEQANIP---NIFAAPSLEGGAKKA
SUCC_CAMC5        GIIEA--CQSTP---LGVPVVVRLDGTNAKEALDMLKNSALK---GLHTSDDLFEGARLA
SUCC_ANAPZ        GIIES--AKEIG---VSVPMVVRLSGTNYKIGKEMLDASGL----SIVTAENLDEAARFV
SUCC_SULSY        GIITA--AKEVS---INVPVIVRMEGTNVELGKKMLQESGL----PLITADTMWEGALKA
SUCC_DESPS        GVVQA--AAKVS---LQVPVVIRMEGTNVKEGREILAKSGL----SLINATDLNDAAEKI
SUCC_GRAFK        GIVDASKNMGDA---MNVPIIVRLQGTNADIAKELIDNSGL----KVSSAIQFQEAADKV
A8Z5U7_SULMW      GIIN---YFNKS---INKKIILRLEGTNVNLAKKLINNSNS----IINNSIIYVTSLEEA
SUCC_SALRD        GVIEA--AKNID---IDVPLIVRLQGTNAEEGKRLLDESDL----SLRSAVLLKEAADEV
SUCC_LEPIN        GIIEA--AKAVD---LKVPLVVRLQGTNSELGREVLNKSGL----KITGVDDLREAASTI
SUCC_ECOLI        GIIGA--VAEVG---VNVPVVVRLEGNNAELGAKKLADSGL----NIIAAKGLTDAAQQV
SUCC_HAEIN        GVIAA--VNEVG---VRVPVVVRLEGTNAEMGRQILAESDV----NILTAQSLQQAAELA
SUCC_FRATT        AIIEA--VKEVN---VTVPVVVRLEGNNAEKGAKILADSGL----KLIPADGLADAADKV
SUCC_THIDA        GIIQA--VREVG---VEVPVIVRLEGTNAELGRTLLAESGL----AIVAAESLTQAAKFA
SUCC_XYLFA        GIIAA--VKEVG---VKVPVIVRLEGTNVDAGKQLLATSGL----AIIPADDINDGAKKA
SUCC_DICNV        GIIQA--AKEID---LKIPVIVRLQGNNVDLGRKMLDECPL----NLQAADDLIDAAQKA
SUCC_HYDCU        GIIQA--VQEVG---LTIPVVVRLEGTNVTLGKEKLANSGL----SIITADGLADAAEKV
SUCC_RUTMC        GILQA--IKTVG---LTLPIVVRLEGTNAPEGLNLLNKSKF----NIHVESDLTKAAIKI
SUCC_ACIF2        GIIQA--AAEVG---LHLPVVVRLEGTRKEEGMALLRESGL----SLITADGLTDAAMKA
SUCC_ZYMMO        GIIAA--ARELD---ITVPLVVRLEGNNVNEGKAALVSSGL----PIITASDLGDAAQKI
MTKA_RHILO        GVIKA--IREVG---VNVPLVVRLSGTKAEEGRRILADSGE----AVIVADTLAEAAEKA
SUCC_PARUW        GIIEA--AKGLQ---IHIPLIVRMEGTNVEKGKQLLQQSGL----KILITENLTEAAQQA
SUCC_CHLTR        GLVSA--MQGQK---ETIPTVIRLEGTNVDKGKDMIINAGI----PCEFVTSMSEGAELA
SUCC_BACTN        GLIQA--FDQIK---SDIPVIVRLTGTNEHLGRDLLRNHSR-----FQIATTMQEAALMA
SUCC_RUBXD        GLLAAIRK-----TGIDLPVVVRLDGTNAEEGLRLLAEGAP---ENVHTEETMLDAARRA
SUCC_HALSA        GINSALEQF----DEIPTPVVVRLAGTNAAEGREILND------DLVTVEETLEGAVQRA
SUCC_CUTAK        GIKGALEKL---GDKAVKPLVVRLDGNAVAEGRKILEEFNY---PLVTMVSTMDEAASKA
SUCC_ACIC1        GIVAAFENLIAAGERIDVPLVVRLDGNRAAEGRAILAAAQL---PRVEQVETMDDAARRV
B8DUE4_BIFA0      GILEAADQL-----GASKPMVVRFEGNKADEGLRILAEADN---PNIHVCETMGQAAAEA
SUCC_DEIRA        GVIRALDEG-----ILTKPVRMRIAGTAEDEAKALLNEKNS---DLIKMYPTMFEAANEA
SUCC2_ARCFU       GLKEALADVS-------TPVVVRLAGTNEEEGRKIMDEFAKDR-PNFHIVETMEEGAEKA
SUCC1_ARCFU       GIILALDEAPR-----KVPLVVKLAGTNEEIGREMLERYSSEKGAEIHFVESIEEGARKA
SUCC_PYRAE        GIKEALAESGG----TNKKIVVRMKGTNEELGRAILAEI------GVPLFDSAEEAAKKA
SUCC_IGNH4        GIVDALSESN-----VKKPIVARIVGTAEEEGKKILKEA------GIPLFESMDEAAQEA
SUCC_STAMF        GIIEAVEETG-----VKKPIVIRLLGTNEEIGRRLLEEK------GYSVFSEADDAVKKA
SUCC_METTH        GVVNALRDAR-----RDVPLVIRLTGTNEEEGQRILREA------GIPFETSLERAAEKA
A5ULQ1_METS3      GVVDAIKESK-----SLVSIVIRLTGTNEEEGQRILEEA------GIPYEISMEKAAKKA
SUCC_METJA        GIVEVLKE-H-----PNVKFAVRMMGTNEEIGRKILEEH------GIPYETSMEEAGRKL
B2A0T1_NATTJ      ALVQVKQDMG-----IKVPLVIRLIGTKDEEAVKILGQH------GISAYQDMGEAAKKA
A2SQQ5_METLZ      GIIEAGVP---------QPVIVRIAGTNEEEGRRLLQEC------GYVMSDTMDAAIRAA
L0HJ42_METFS      GIIAAEIP---------QKVIVRLAGTNEAEGRRLLSEK------GYEMLDTMDLVVKKA
B1L6Q9_KORCO      GVKSIKEK-GL----LKIPVVVRMSGNQADEGKRILEEI------GIKATESAEEAVRYA
                  .:                    :: *     .   :                        

SUCC_HERA2        VDIAKQ------------------------------------------
SUCC_GEMAT        VELATKGGAA--------------------------------------
SUCC_PELPD        VAMLNREVNQPCQS----------------------------------
SUCC_PELCD        VRQLSPSA----------------------------------------
SUCC_MYXXD        VAAVK-------------------------------------------
SUCC_RHOBA        VAATA-------------------------------------------
SUCC_BACSU        VSLV--------------------------------------------
SUCC_SORC5        VAATRGGKAGA-------------------------------------
SUCB_NEUCR        VQLSKVVKMARDIDVGVEFTLGI-------------------------
SUCB1_MOUSE       VKLSEIVTLAKEAHVDVKFQLPI-------------------------
SUCB1_DICDI       VRIAEIVSLAEKSDLEISFKLPL-------------------------
SUCB2_DICDI       VNCLKK------------------------------------------
SUCC_AKKM8        VAAVK-------------------------------------------
SUCC_OPITP        VKLVA-------------------------------------------
SUCC_RICPR        VEAIR-------------------------------------------
SUCC_PELUB        VEAIK-------------------------------------------
SUCC_WOLSU        VELACQGGAS--------------------------------------
SUCC_CAMC5        VMLAKGEK----------------------------------------
SUCC_ANAPZ        VDLVGKRG----------------------------------------
SUCC_SULSY        VEAANKQQ----------------------------------------
SUCC_DESPS        STLLTD------------------------------------------
SUCC_GRAFK        QEVLSK------------------------------------------
A8Z5U7_SULMW      ANKIII------------------------------------------
SUCC_SALRD        TAALGED-----------------------------------------
SUCC_LEPIN        AKLIG-------------------------------------------
SUCC_ECOLI        VAAVEGK-----------------------------------------
SUCC_HAEIN        VNAAKGEH----------------------------------------
SUCC_FRATT        VKSLG-------------------------------------------
SUCC_THIDA        VEKAA-------------------------------------------
SUCC_XYLFA        VAAVTV------------------------------------------
SUCC_DICNV        IAAAQ-------------------------------------------
SUCC_HYDCU        VAVALEANQ---------------------------------------
SUCC_RUTMC        VKLTK-------------------------------------------
SUCC_ACIF2        VAAAQG------------------------------------------
SUCC_ZYMMO        VAAIRQTA----------------------------------------
MTKA_RHILO        VAAWRAAAKKKAA-----------------------------------
SUCC_PARUW        VQLAQSVR----------------------------------------
SUCC_CHLTR        VQLSR-------------------------------------------
SUCC_BACTN        IKS---------------------------------------------
SUCC_RUBXD        VELARDGGH---------------------------------------
SUCC_HALSA        VEYADEEDIQ--------------------------------------
SUCC_CUTAK        AELASKEA----------------------------------------
SUCC_ACIC1        AELAAAAR----------------------------------------
B8DUE4_BIFA0      ARLAAHGKEER-------------------------------------
SUCC_DEIRA        AKEANALGGK--------------------------------------
SUCC2_ARCFU       VKLAEEV-----------------------------------------
SUCC1_ARCFU       VELAG-------------------------------------------
SUCC_PYRAE        VELARV------------------------------------------
SUCC_IGNH4        VKLAKAA-----------------------------------------
SUCC_STAMF        VEIAKNLSR---------------------------------------
SUCC_METTH        VEIAKNL-----------------------------------------
A5ULQ1_METS3      VELCNKIKAEE-------------------------------------
SUCC_METJA        IEQL--------------------------------------------
B2A0T1_NATTJ      VELAAEGGVGV-------------------------------------
A2SQQ5_METLZ      VEVVQ-------------------------------------------
L0HJ42_METFS      VEVTSEQPHQKKPGPWKKPNGGQHSVAVITKPESQPTSEMYQLGKGGM
B1L6Q9_KORCO      VELAKRA-----------------------------------------