CLUSTAL format seed alignment for MF_00563

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SAHH_ACIAD      --------MFFKEIVMNAVNASFTDYKVAD---------ISLADYGRKEIKLAEAEMPAL
SAHH_HAHCH      -------------MAQLQSVDNFSDYKVKD---------ISLAAWGRKEIDIAEGEMPAL
SAHH_PSEE4      -------------MSAVNTPAGFSDFKVAD---------ISLADWGRKEVIIAESEMPAL
SAHH_PSE14      -------------MSAVITPAEFNDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEU2      -------------MSAVMTPAEFNDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSESM      -------------MSAVITPAEFNDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEFS      -------------MSAVNTPADFNDYKVAD---------MSLAAWGRRETFIAESEMPAL
SAHH_PSEF5      -------------MSAVNTPAGFTDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEPF      -------------MSAVITPADFNDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEPW      -------------MSAVNTPAGFTDFKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEP1      -------------MSAANMPAGFTDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEPG      -------------MSAANMPAGFTDYKVAD---------ISLAAWGRRETIIAESEMPAL
SAHH_PSEU5      -------------MSAVMTPAGFTDFKVAD---------ISLAAWGRREIIIAESEMPAL
SAHH_PSEMY      -------------MSAVLTPAGFTDYKVAD---------ISLADWGRKELIIAESEMPAL
SAHH_PSEAE      -------------MSAVMTPAGFTDYKVAD---------ITLAAWGRRELIIAESEMPAL
SAHH_PSEA8      -------------MSAVMTPAGFTDYKVAD---------ITLAAWGRRELIIAESEMPAL
SAHH_PSEAB      -------------MSAVMTPAGFTDYKVAD---------ITLAAWGRRELIIAESEMPAL
SAHH_STRAZ      --------------MPSQPPADFTDFKVAD---------LSLAAFGRKEITLAEHEMPGL
SAHH_STRGG      ----------------MTTATNRQDFKVAD---------LSLAPFGRKEITLAEHEMPGL
SAHH_STRAA      ------------------MSADFTDFKVAD---------LSLAEFGRKEITLAEHEMPGL
SAHH_STRAW      ----------------MTTVDNRQDFKVAD---------LSLAEFGRKEITLAEHEMPGL
SAHH_STRCO      ----------------MTTVDNRQDFKVAD---------LSLAAFGRKEITLAEHEMPGL
SAHH_CORDI      --------------------MAAFDYNVKD---------LSLAEAGRHQIRLAEYEMPGL
SAHH_COREF      -------------------MAKVTDFKVAD---------LSLAEAGRHQIRLAEYEMPGL
SAHH_CORGL      -----------------------MDFKVAD---------LSLAEAGRHQIRLAEYEMPGL
SAHH_CORGB      -------------------MAQVMDFKVAD---------LSLAEAGRHQIRLAEYEMPGL
SAHH_MYCPA      --------MTTTENALTPDVRNGIEFKVAD---------LSLADYGRRDIELSEQEMPGL
SAHH_MYCLE      --------MTTTENSLMPDVRNGIDFKVAD---------LSLANFGRKELDLAEYEMPGL
SAHH_MYCLB      --------MTTTENSLMPDVRNGIDFKVAD---------LSLANFGRKELDLAEYEMPGL
SAHH_MYCBO      -----MTGNLVTKNSLTPDVRNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_MYCBP      -----MTGNLVTKNSLTPDVRNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_MYCBT      -----MTGNLVTKNSLTPDVRNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_MYCTU      -----MTGNLVTKNSLTPDVRNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_MYCTA      -----MTGNLVTKNSLTPDVRNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_MYCMM      --------MTTTETSLSADTKNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_MYCUA      --------MTTTETSLSADTKNGIDFKIAD---------LSLADFGRKELRIAEHEMPGL
SAHH_NOCFA      ----MTTSELPARTSPTPDVRNGIDYKVAD---------LTLAEFGRKEIRLAEHEMPGL
SAHH_MYCSJ      --------MTTTEQRLTVESRNGIDYKVAD---------LSLAEFGRKEIRLAEHEMPGL
SAHH_MYCSK      --------MTTTEQRLTVESRNGIDYKVAD---------LSLAEFGRKEIRLAEHEMPGL
SAHH_MYCSS      --------MTTTEQRLTVESRNGIDYKVAD---------LSLAEFGRKEIRLAEHEMPGL
SAHH_PELCD      ----------------MSSESISENYVVKD---------MGLAEWGRREIRMAEAEMPGL
SAHH_BDEBA      --MKKNAKMKAPTATKTAAKTPVVDYRVSKEAMENPEVFAKLAKWGREEIKIAETEMPGL
SAHH_GRAFK      ---------------MSTKTVPYTAYKVKD---------IELAEYGRREIELAEAEMPGL
SAHH_FLAJ1      ---------------MSTTTTPYVAFKVKD---------ISLAAWGRKEIELAEAEMPGL
SAHH_FLAPJ      ---------------MSTATMPYVAFKVKD---------ISLAAWGRKEIELAEAEMPGL
SAHH_RHOBA      ---------------MSQAETTKLPYKVKD---------ISLADYGRKEIELAENEMPGL
SAHH_DESAD      ----------------MLKVDSKLDYKVAD---------ISLADWGNKEMQLSEREMPGL
SAHH_DESAG      ----------MTDARKALPLDLSLENKVKD---------LSQADFGYKEMQLSEREMPGL
SAHH_DESVH      ----------MTDAKRAQKLDLSLDHKVAD---------MSLADYGRKDLQLSEREMPGL
SAHH_DESVV      ----------MTDAKRAQKLDLSLDHKVAD---------MSLADYGRKDLQLSEREMPGL
SAHH_DESVM      ----------MTDAKRAQALDLSLANKVAD---------MALADFGHKEMQLSEREVPGL
SAHH_GRABC      ------------MESSMPDTAVAEDYKVRD---------IGLADWGRKEIRMAEDEMPGL
SAHH_ZYMMO      --------------------MANEPYIVRD---------ISLAGWGRKEIDIAEGEMPGL
SAHH_NOVAD      ---------------MASVLDAQNDYVVAD---------IGLADFGRAEIRIAETEMPGL
SAHH_SPHAL      ---------------MATLAADTRDYVVAD---------IGLADFGRKEINIAETEMPGL
SAHH_ROSDO      ---------------------MTKDFIVKD---------IALAEFGRKELDIAETEMPGL
SAHH_RHOCB      ----------------------MADYIVKD---------IKLAEFGRKELDIAETEMPGL
SAHH_RHOSH      ----------------------MADFIVKD---------LSLADFGRKELDIAETEMPGL
SAHH_BARQU      --------------------MAAQDYVVKD---------IALAAYGRKEIDIAETEMPGL
SAHH_BARHE      --------------------MTAQDYVVKD---------IALAAYGRKELDIAETEMPGL
SAHH_BART1      --------------------MTAQDFVVKD---------IGLAAYGRKELDIAETEMPGL
SAHH_AGRFC      -------------------MSLEKDYIVAD---------INLAAFGRKELDIAETEMPGL
SAHH_RHIME      -------------------MSATQDYIVAD---------IGLADFGRKEIAIAETEMPGL
SAHH_SINMW      -------------------MSANQDYIVAD---------IGLADFGRKEIAIAETEMPGL
SAHH_AGRRK      -------------------MSTENDYIVAD---------IGLADFGRKEITIAETEMPGL
SAHH_RHILW      -------------------MSTEKDYVVAD---------IGLADFGRKEITIAETEMPGL
SAHH_RHIL3      -------------------MSTEKDYVVAD---------IGLADFGRKEITIAETEMPGL
SAHH_RHIEC      -------------------MSTEKDYVVAD---------IGLADFGRKEITIAETEMPGL
SAHH_RHIE6      -------------------MSTEKDYVVAD---------IGLADFGRKEITIAETEMPGL
SAHH_CHESB      --------------------MAADDYVVAD---------MSLAAWGRKEIEIAETEMPGL
SAHH_RHILO      -------------------MTGSKDYVVAD---------ISLAGWGRKELDIAETEMPGL
SAHH_OCHA4      -------------------MTASQDFVVKD---------LSLADWGRKELDIAETEMPGL
SAHH_BRUO2      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUAB      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUA2      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUA1      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUC2      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUSU      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUSI      -------------------MTASQDFVVKD---------ISLADWGRKELDIAETEMPGL
SAHH_BRUME      -------------------MTASQDFVVKD---------ISLADWGRRELDIAETEMPGL
SAHH_BRUMB      -------------------MTASQDFVVKD---------ISLADWGRRELDIAETEMPGL
SAHH_MARMM      ----------------MTQFAADKPYIVKD---------MSLAKWGRIEFDMAEIEMPGL
SAHH_HYPNA      ----------------MSAKAAPQDYFVKD---------ISLAEYGRKEIAIAETEMPGL
SAHH_CAUVC      ----------------------MADYIVKD---------ISLADFGRKEIAIAETEMPGL
SAHH_RHOPA      ------------------MTAKFTDYIVKD---------IGLAEFGRKEISLAETEMPGL
SAHH_RHOPT      ------------------MTAKFTDYIVKD---------IGLAEFGRKEISLAETEMPGL
SAHH_RHOPS      ------------------MTAKFTDYIVKD---------IGLAEFGRKEISLAETEMPGL
SAHH_RHOP2      ------------------MTAKFTDYIVKD---------IGLAEFGRKEISLAETEMPGL
SAHH_BRADU      ----------------MNAKPGFTDYIVKD---------ISLADFGRKELSLAETEMPGL
SAHH_BRASB      ----------------MTAKPGFNDYIVKD---------ISLAEFGRKEISLAETEMPGL
SAHH_METC4      -------------------MAVANDYIVKD---------IGLADYGRKEISIAETEMPGL
SAHH_METEP      -------------------MAVANDYIVKD---------IGLADYGRKEISIAETEMPGL
SAHH_METPB      -------------------MAAANDYIVRD---------IGLADYGRKEISIAETEMPGL
SAHH_METNO      -------------------MPSAQDYIVRD---------IGLADFGRKEIAIAETEMPGL
SAHH_METS4      -------------------MPSNQDYIVRD---------IGLADFGRKEIAIAETEMPGL
SAHH_PROMP      ------------MVIANSIKTSIPNYVIKD---------ISLSDFGRKEIKIAETEMPGL
SAHH_PROM9      ------------MVIANSVKSSTTNYVVAD---------ISLSDFGRKEIKIAETEMPGL
SAHH_PROM2      ------------MVISNSIKTSVPHFVISD---------ISLSDFGRKEIKIAETEMPGL
SAHH_PROM0      ------------MVIANSVKTSTPKFIISD---------ISLSDFGRKEIKIAETEMPGL
SAHH_PROM3      ---------MVAVPTSMASLQAPPQYVVAD---------IDLADFGRKELSIAETEMPGL
SAHH_PROMM      ---------MVAVPTSTASLQALPQYVVAD---------IDLADFGRKELSIAETEMPGL
SAHH_SYNS3      ---------MVATAAATAELQVAKDYVIAD---------IGLADFGRKELNIAETEMPGL
SAHH_SYNS9      ---------MVAAPTTATELKLGTDCVIAD---------INLAAFGRKELDIAETEMPGL
SAHH_SYNSC      ---------MVAAPTSPAELKLGVDCVIAD---------INLADFGRKELDIAETEMPGL
SAHH_SYNPW      ---------MVATPSATTGLQVAQDYVIAD---------INQAEFGRKELDIAETEMPGL
SAHH_SYNPX      ---------MVAAPTTATELKLGVDCVIAD---------INQAAFGRKELDIAETEMPGL
SAHH_PROMA      ---------MVTAAASTSQVVGDSDFVVAD---------ITLADFGRKELAIAEKEMPGL
SAHH_PROM4      ---------MLAASASTQQLHNHIEYEIAD---------IELAEFGRKELAIAEKEMPGL
SAHH_MYXXD      --------------MTAATKSLKQDYAIAD---------LSLADWGRKEIRIAESEMPAL
SAHH_LEPCP      -------------MNAAVKALHENDYLVAD---------LSLAAWGRKEIRIAETEMPGL
SAHH_ACISJ      ---------------MSAVLKSPADSAIAD---------ISLADWGRKEIRIAETEMPGL
SAHH_ACIET      ---------------MSAVLKSPADSAIAD---------ISLAEWGRKEIRIAETEMPGL
SAHH_DELAS      --------------MNAAVRPVSADTAIAD---------ISLAAWGRKEILIAETEMPGL
SAHH_METPP      -------------MSAVLKPTPTHDHHVAD---------LSLADWGRKEIKIAETEMPGL
SAHH_ACIAC      ---------------MSAVLKPQADLAIAD---------ISLADWGRKEIKIAETEMPGL
SAHH_VARPS      -----------MSAVLKPTPVSTADQAIAD---------LSLAAWGRKEIKIAETEMPGL
SAHH_HERAR      -----------MNAAVMTSSTNFSDYVIAD---------LSLSVWGDKEIRIAETEMPGL
SAHH_JANMA      -----------MNAAVMTSPTNFSDYVIAD---------LSLSAWGDKEIRIAETEMPGL
SAHH_BORPD      --------------MNAVSDQAVADYHVAD---------MSLAAWGRRELAIAETEMPGL
SAHH_BORBR      --------------MNAVTDKSVADYIVAD---------MALAGWGRRELAIAETEMPGL
SAHH_BORPA      --------------MNAVTDKSVADYIVAD---------MALAGWGRRELAIAETEMPGL
SAHH_BORPE      --------------MNAVTDKSVADYIVAD---------MALAGWGRRELAIAETEMPGL
SAHH_POLNS      -----------MNTVSDLSKFVATRCAIAD---------ISLADFGRKEIAIAETEMPGL
SAHH_POLAQ      -----------MNTVSDLNNFVATRCAIAD---------ISLSDFGRKEIAIAETEMPGL
SAHH_AROAE      ---------------MNSVAENFTDYVVAD---------LALAGWGRKEIRIAETEMPGL
SAHH_RALPJ      ---------------MNAVTDLKHDYLVAD---------IKLADWGRKEIAIAETEMPGL
SAHH_RALSO      ---------------MNAVTDLKHDYLVAD---------IKLADWGRKEIAIAETEMPGL
SAHH_CUPMC      ---------------MNAVTDLKQDYIVAD---------IGLAGWGRKEIAIAETEMPGL
SAHH_CUPPJ      ---------------MNAVTDLKQDYLVAD---------ISLAGWGRKEIAIAETEMPGL
SAHH_CUPTR      ---------------MNAVTDLKQDYLVAD---------INLAGWGRKEIAIAETEMPGL
SAHH_CUPNH      ---------------MNAVTDLKQDYLVAD---------INLAGWGRKEIAIAETEMPGL
SAHH_GEOSL      ----------MTQPVARDTAGTFSDYCISD---------ISLAAWGRKEMIIAETEMPGL
SAHH_NITEU      ---------MSATINPVVDNSVFTDCKVAD---------LSLADWGRKEIAIAETEMPGL
SAHH_NITEC      ---------MSATINPVVDNSVFTDCEVAD---------LSLADWGRKEIAIAETEMPGL
SAHH_METCA      -------------MNAVANAASFDDHKVAD---------LSLAGWGRKEIAIAETEMPGL
SAHH_CHRVO      -------------------MADFSDFHVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURMA      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURM9      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURM7      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURMS      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURPS      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURP0      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURP1      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURP6      ------------MNAAVIDSHSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_BURTA      ------------MNAAVIDSNSAQDYVVAD---------IALAGWGRKELNIAETEMPGL
SAHH_PARP8      ------------MNAAVIDSKHSQDFIVAD---------LSLADWGRKELDIAETEMPGL
SAHH_PARPJ      ------------MNAAVIDSKNSQDFVVAD---------MSLADWGRKELNIAETEMPGL
SAHH_PARXL      ------------MNAAVIDSKNSQDFIVAD---------MSLADWGRKELNIAETEMPGL
SAHH_HALHL      --------------------MSNQDYKVAD---------ISLADWGRKEIKIAESEMPGL
SAHH_COXB1      ------------MENDMETATMTQDYHIAN---------INLADWGRKEIEIAETEMPGL
SAHH_COXBU      ------------MENDMETATMTQDYHIAN---------INLADWGRKEIEIAETEMPGL
SAHH_COXB2      ------------MENDMETATMTQDYHIAN---------INLADWGRKEIEIAETEMPGL
SAHH_COXBN      ------------MENDMETATMTQDYHIAN---------INLADWGRKEIEIAETEMPGL
SAHH_LEPBJ      --------------MSATTQEKGLNYKVKD---------LSQAEWGRQEIILAEKEMPGL
SAHH_LEPBL      --------------MSATTQEKGLNYKVKD---------LSQAEWGRQEIILAEKEMPGL
SAHH_LEPIN      --------------MSVTTQEKDLSYKVKD---------LSQAEWGRQEIILAEKEMPGL
SAHH_LEPIC      --------------MSVTTQEKDLSYKVKD---------LSQAEWGRQEIILAEKEMPGL
SAHH_SOLUE      -------------MGTATEKLSDATFKVAD---------LSLAEWGRKEISVSEFEMPGL
SAHH_XYLFM      -------------MNTHPQTSPNTHYKIAD---------ISLADWGRKEIDIAEHEMPGL
SAHH_XYLFA      -------------MNTHPQTSPNTHYKIAD---------ISLTDWGRKEIDIAEHEMPGL
SAHH_XYLF2      -------------MNTHPQTSPNTHYKIAD---------ISLADWGRKEIDIAEHEMPGL
SAHH_XYLFT      -------------MNTHPQTSPNTHYKIAD---------ISLADWGRKEIDIAEHEMPGL
SAHH_XANCP      -------------MNAVAKTVPHTDYKIAD---------ISLADWGRKELDIAEHEMPGL
SAHH_XANC8      -------------MNAVAKTVPHTDYKIAD---------ISLADWGRKELDIAEHEMPGL
SAHH_XANOM      -------------MNAVTKITPHADYKIAD---------ISLADWGRKELDIAEHEMPGL
SAHH_XANOP      -------------MNAVTKITPHADYKIAD---------ISLADWGRKELDIAEHEMPGL
SAHH_XANC5      -------------MNAVTKITPHTDYKIAD---------ISLADWGRKELDIAEHEMPGL
SAHH_XANAC      -------------MNAVTKITPHTDYKIAD---------ISLADWGRKELDIAEHEMPGL
SAHH_BACFR      MFYLCTTLYFKQFTFMSTELFSTLPYKVAD---------ITLADFGRKEIDLAEKEMPGL
SAHH_BACTN      -----------MIYNMSTELFSTLPYKVAD---------ITLADFGRKEIDLAEKEMPGL
SAHH_CHLL2      ----------------MTTEATALAYKVAD---------ITLAEWGRKEIEIAEKEMPGL
SAHH_CHLPD      ----------------MTIEAEVLAYKVAD---------MSLAEWGRKEIDIAEKEMPGL
SAHH_PELPB      ----------------MTTLTEVLDYKVAD---------LSLAEWGRKEIDVAEKEMPGL
SAHH_PELLD      ----------------MTIEATALAYKVAD---------ISLAEWGRKEIDIAEKEMPGL
SAHH_CHLPM      ----------------MTIAATALDYKVAD---------ISLAEWGRKEIDIAEKEMPGL
SAHH_CHLCH      ----------------MSTVAEALAYKVAD---------ISLAEWGRKEIEIAEKEMPGL
SAHH_CHLP8      ----------------MTTEAAVLDYKVAD---------ISLAEWGRKEIEIAEKEMPGL
SAHH_CHLTE      ----------------MTTEAAVLDYKVAD---------ISLAEWGRKEIEIAEKEMPGL
SAHH_THEAC      ----------------------------------------MTESKGFLRLAWARDHMPVI
SAHH_THEVO      ----------------------------------------MAEGKGFLRLEWARDHMPVI
SAHH_HALSA      -----------------MTTAPAISSRLDD--------PESARETGRAKIDWAFEHMPIL
SAHH_HALWD      -----------MSAYSPLSAQLDADTDVDV---------ESTRTEGRRKMEWTLQHMPIL
SAHH_THEMA      ------------------------------------------MNTGEMKINWVSRYMPLL
SAHH_GLOVI      --------------MTAVKTPIQVRYEVRN---------LELAAEGRQRIEWAAREMPVL
SAHH_GLOC7      ------------MTVTPIRAKEELKYEIKD---------ISLAPSGRQRIEWAGREMPVV
SAHH_NOSS1      ----------------MTATSPRLKHEVKD---------LALAPLGRQRIEWAGREMPVL
SAHH_THEEB      ------------MVSSPIKSEAPVRHDVKD---------LSLAPLGQQRIEWASREMPVL
SAHH_SYNY3      ----------------MVATPVKQKYDIKD---------ISLAPQGRQRIEWAAREMPVL
SIHH_METTH      -----------------------MPYKVKD---------ISLAPQGEKKIRWVQEHMPVL
SAHH_AERPE      ---------------------MAQGFKVRD---------LSLAGEGRMQIEWAERHMPVL
SIHH_METKA      -----------------MVVVKEGEYAIRD---------PSLAPKGRDMIEWARDHMPVL
SAHH_PYRAE      ----------------------MPESRVKD---------SSLADRGREQLYWAELNMPVL
SAHH_SACS2      -----------------------MSYKIKD---------LSLASEGKKQIEWAERHMPTL
SAHH_SULAC      -----------------------MDYRVKD---------LSLAEQGRKQIEWAELHMPAL
SAHH_SULTO      -----------------------MDYKVKD---------LSLAEQGKKQIEWAEIHMPAL
SAHH_AQUAE      -----------------------MEFDVKD---------LSLAEEGLKRIEWAEMDMPVL
SAHH_THEKO      -------------------MDCTKDYCVKD---------ISLAPSGEKKIDWVSRFMPVL
SAHH_PYRAB      ------------------MVNCTSDYCVKD---------ISLAPEGMKKIDWVSRFMPVL
SAHH_PYRFU      -------------------MDCGKDYCVKD---------LSLAEEGWKKIDWVSRFMPVL
SAHH_PYRHO      -------------------MDCGRDYCVKD---------LSLADEGWKKIDWVSRFMPVL
SIHH_METAC      ---------------------------MTE---------QELVESGNMKMEWARNHMPVI
SIHH_METMA      ---------------------------MTE---------KELIESGNMKMEWARNHMPVL
SAHH_ARCFU      ----------------------------ME---------------GFRKIEWAERYMKVL
SIHH_METJA      ------------------------MYEVRD---------INLWKEGERKIQWAKQHMPVL
SIHH_METMP      ------------------------MSNVKD---------MSLAPSGHLKMEWAKRHMPVL
                                                             *          :  :

SAHH_ACIAD      IGLRKRYAAEKPLAGAKILGCIHMTIQTAVLIETLVELGAEVRWTSCNIFSTQDHAAAAI
SAHH_HAHCH      MTLREKYRAQQPLAGARILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDHAAAAI
SAHH_PSEE4      MGLRRKYQAEQPLKGAKIIGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSE14      MGLRRKYAGDQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEU2      MGLRRKYAGDQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSESM      MGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEFS      MGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEF5      MGLRRKYLAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASI
SAHH_PSEPF      MGLRRKYASEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASI
SAHH_PSEPW      MGLRRKYLAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASI
SAHH_PSEP1      MGLRRKYLAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASI
SAHH_PSEPG      MGLRRKYLTEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASI
SAHH_PSEU5      MGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLIALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEMY      MGLRRKYAASQPLKGAKILGCIHMTIQTGVLIETLTALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEAE      MGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEA8      MGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_PSEAB      MGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAI
SAHH_STRAZ      MSIREEYAAAQPLAGARITGSLHMTVQTAVLIETLVALGADVRWVSCNIYSTQDHAAAAI
SAHH_STRGG      MSIRKEFAAAQPLAGARITGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_STRAA      MSIRREYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAQVRWASCNIFSTQGHAAAAI
SAHH_STRAW      MSIRKEYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_STRCO      MAIRKEYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_CORDI      MQLREEYQQEQPLAGARITGSIHMTVQTAVLIETLVALGAQVRWASCNIFSTQDEAAAAV
SAHH_COREF      MQLRREYAEEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIFSTQDEAAAAI
SAHH_CORGL      MQLRKEFADEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIFSTQDEAAAAI
SAHH_CORGB      MQLRKEFADEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIFSTQDEAAAAI
SAHH_MYCPA      MSLRREYHDVQPLKGARISGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCLE      MSLRHEYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCLB      MSLRHEYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCBO      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCBP      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCBT      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCTU      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCTA      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCMM      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCUA      MSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAV
SAHH_NOCFA      MALRREYADVQPLKGARISGSLHMTVQTAVLIETLTALGAQVRWASCNIFSTQDHAAAAV
SAHH_MYCSJ      MALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCSK      MALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAV
SAHH_MYCSS      MALRREYAEVAPLKGARISGSLHMTVQTAVLIETLVSLGAEVRWASCNIFSTQDHAAAAV
SAHH_PELCD      MAIREEYRGTKPLAGARITGSLHMTIQTAVLIETLAELGADLRWASCNIYSTQDHAAAAI
SAHH_BDEBA      MALRKEYKKQQPLKGARIAGCLHMTIQTAVLIETLVELGAEIRWSSCNIFSTQDHAAAAI
SAHH_GRAFK      MALRKEYGASKPLKGARIAGCLHMTIQTAVLIETLVELGANVTWSSCNIFSTQDHAAAAI
SAHH_FLAJ1      MALRAEYKDEQPLKGARIAGCLHMTIQTAVLIETLIALGAEVTWSSCNIFSTQDQAAAAI
SAHH_FLAPJ      MALRAEYKNEQPLAGARIAGCLHMTIQTAVLIETLIALGAEVTWSSCNIFSTQDQAAAAI
SAHH_RHOBA      MALRSKYGAEKPLKGARIAGCLHMTIQTAVLIETLVELGAEVTWSSCNIFSTQDHAAAAI
SAHH_DESAD      MSIREKYGKEKPLKGLKVMGSLHMTIQTAMLIETLHALGADIRWASCNIFSTQDHAAAAI
SAHH_DESAG      MELIAKHGAEKPLKGLKVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAI
SAHH_DESVH      MELIRKYGGTKPLKGLKVTGSLHMTIQTAMLIRTLYELGADIRWASCNIFSTQDHAAAAI
SAHH_DESVV      MELIRKYGGTKPLKGLKVTGSLHMTIQTAMLIRTLYELGADIRWASCNIFSTQDHAAAAI
SAHH_DESVM      MELIRMYGVSKPLKGLRVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAI
SAHH_GRABC      MALREEYGNSKPLAGARIAGCLHMTIQTAVLIETLTALGATVRWSSCNIFSTQDHAAAGI
SAHH_ZYMMO      MALREEYAAKKPLKGARITGSLHMTIQTAVLIETLVDLGAEVRWASCNIFSTQDHAAAAI
SAHH_NOVAD      MALREEFGASQPLKGARITGSLHMTIQTAVLIETLVALGAEVRWATCNIFSTQDHAAAAI
SAHH_SPHAL      MALRAEYGASQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWATCNIFSTQNHAAAAI
SAHH_ROSDO      MALRAEYGDSKPLAGARIVGSLHMTIQTAVLIETLVALGADVRWASCNIFSTQDHAAAAI
SAHH_RHOCB      MACREEFGPSQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_RHOSH      MALREEFGASKPLKGARIAGSLHMTVQTAVLIETLVALGADVRWASCNIFSTQDHAAAAI
SAHH_BARQU      MACREEFSFSQPLRGARISGSLHITIQTAVLIETLKAIGADVRWSSSNIFSTQDHAAAAI
SAHH_BARHE      MACREEFSSSQPLRGARISGSLHMTIQTAVLIETLKAIGANVRWSSSNIFSTQDHAAAAI
SAHH_BART1      MACRKEFSSSQPLRGARISGSLHMTIQTAVLIETLKAIGADIRWSSSNIFSTQDHAAAAI
SAHH_AGRFC      MSCRKEFGESKPLKGARITGSLHMTIQTGVLIETLKELGAEIRWASCNIFSTQDHAAAAI
SAHH_RHIME      MACREEFGASKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_SINMW      MACREEFGASKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_AGRRK      MACRAEFGETKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_RHILW      MSCRTEFGQAKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_RHIL3      MSCRTEFGQTKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_RHIEC      MSCRAEFGEAKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_RHIE6      MSCRAEFGDAKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_CHESB      MACREEFGEAKPLKGARITGSLHMTIQTAVLIETLKSLGAEVRWASCNIFSTQDHAAAAI
SAHH_RHILO      MACREEFGAKKPLKGARITGSLHMTIQTAVLIETLKALGADIRWASCNIFSTQDHAAAAI
SAHH_OCHA4      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLQALGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUO2      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUAB      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUA2      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUA1      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUC2      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUSU      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUSI      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUME      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_BRUMB      MAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHAAAAI
SAHH_MARMM      MALREEYKDSQPLKGARIAGSLHMTVQTAILIETLTALGAEVRWASCNIFSTQDHAAAAI
SAHH_HYPNA      MAAREEFGPSQPLKGARICGSLHMTIQTAVLIQTLEALGAQVRWVSCNIYSTQDHAAAAI
SAHH_CAUVC      MATRAEYGPQQILKGARIAGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAI
SAHH_RHOPA      MATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAI
SAHH_RHOPT      MATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAI
SAHH_RHOPS      MATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLTALGADVRWVSCNIYSTQDHAAAAI
SAHH_RHOP2      MATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLVALGADVRWVSCNIYSTQDHAAAAI
SAHH_BRADU      MATREEFGPKQPLKGARIAGSLHMTIQTGVLIETLAALGADIRWVSCNIYSTQDHAAAAI
SAHH_BRASB      MATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLAALGADIRWVSCNIYSTQDHAAAAI
SAHH_METC4      MSTRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAI
SAHH_METEP      MSTRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAI
SAHH_METPB      MATRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKHLGADIRWVSCNIYSTQDHAAAAI
SAHH_METNO      MAVRREYAASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAI
SAHH_METS4      MAVRAEYAASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAI
SAHH_PROMP      MALRDKHHSDKPLNGAKIAGSLHMTIQTAVLIETLVDLGAQVKWASCNIFSTQDHAAAAI
SAHH_PROM9      MALRDKYQSEKPLKGAKIAGSLHMTIQTAVLIETLVDLGAEVKWASCNIFSTQDHAAAAI
SAHH_PROM2      MALRDKYQSEKPLKGAKIAGSLHMTIQTAVLIETLVDLGAQVKWASCNIFSTQDHAAAAI
SAHH_PROM0      MALRDKYQSEKPLKGAKIAGSLHMTIQTAVLIETLVDLGAEVKWASCNIFSTQDHAAAAI
SAHH_PROM3      MALRVKHGSEKPLKGARIAGSLHMTIQTGVLIETLVALGADVRWASCNIFSTQDHAAAAI
SAHH_PROMM      IALRIKYGSEKPLKGARIAGSLHMTIQTGVLIETLVALGADVRWASCNIFSTQDHAAAAI
SAHH_SYNS3      MALRAKYGKDKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAM
SAHH_SYNS9      MALRAKYGNEKPLKGARIAGSLHMTIQTAVLIETLEELGADVRWASCNIFSTQDHAAAAI
SAHH_SYNSC      MALREKYGSEKPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAI
SAHH_SYNPW      MALREKYGTEKPLKGARIAGSLHMTIQTACLIETLVELGAEVRWASCNIFSTQDHAAAAM
SAHH_SYNPX      MALREKYGTEKPLKGARIAGSLHMTIQTACLIETLVELGAEVRWASCNIFSTQDHAAAAI
SAHH_PROMA      MSLRDKYGQEKPLQGARIAGSLHMTIQTGVLIETLVALGAQVRWASCNIFSTQDHAAAAI
SAHH_PROM4      MALREKYHKEKPLKGARIAGSLHMTIQTAVLIETLVALGAQVRWASCNIFSTQDHAAAAI
SAHH_MYXXD      MAIREEYAKTQPLKGARVTGSLHMTIQTAVLVETLQALGAEVRWASCNIFSTQDHAAAAL
SAHH_LEPCP      MAIREEFAAKQPLKGARVTGSLHMTIQTAVLVETLQALGAQVRWASCNIFSTQDHAAAAL
SAHH_ACISJ      MAIREEFAAKQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_ACIET      MAIREEFAAKQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_DELAS      MATREEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGAEVRWASCNIFSTQDHAAAAI
SAHH_METPP      MAIRQEFAASQPLKGARITGSLHMTIQTAVLVETLQALGAQVRWASCNIFSTQDHAAAAL
SAHH_ACIAC      MAIREEFAAAQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_VARPS      MAIREEFSKAQPLKGARITGSLHMTIQTAVLIETLQALGATVRWASCNIFSTQDHAAAAI
SAHH_HERAR      MAIREEFAAAQPLKGARITGSIHMTIQTAVLIQTLEALGAKVRWASCNIYSTQDHAAAAI
SAHH_JANMA      MAIREEFAAAQPLKGARITGSIHMTIQTAVLIQTLEALGAKVRWASCNIYSTQDHAAAAI
SAHH_BORPD      MAIREEFAASQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_BORBR      MAIRDEYAASQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_BORPA      MAIRDEYAASQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_BORPE      MAIRDEYAASQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_POLNS      IAIRDEFAAQQPLRGTRITGSLHMTIQTAVLIETLEALGAEVQWASCNIFSTQDHAAAAI
SAHH_POLAQ      IAIRDEFAAQQPLRGARITGSLHMTIQTAVLIETLEALGAEVQWASCNIFSTQDHAAAAI
SAHH_AROAE      MAIREEFAVVQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAI
SAHH_RALPJ      MAIRDEFAASQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_RALSO      MAIRDEFAASQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_CUPMC      MAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_CUPPJ      MAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_CUPTR      MAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_CUPNH      MAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_GEOSL      MAIREEYAATRPLQGARIAGSLHMTIQTAMLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_NITEU      MALREQYADKKPLAGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_NITEC      MALREQYAGKKPLAGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_METCA      MAIREEYRAAQPLKGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAI
SAHH_CHRVO      MATRDEYHAAQPLRGARIAGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAI
SAHH_BURMA      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURM9      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURM7      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURMS      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURPS      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURP0      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURP1      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURP6      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_BURTA      VQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_PARP8      VQIREEYKAQQPLKGARVAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAI
SAHH_PARPJ      VQTREEYKAQQPLKGARIAGSLHMTIQTGVLIETLTALGADVRWASCNIFSTQDHAAAAI
SAHH_PARXL      VQTREEYKVQQPLKGARIAGSLHMTIQTGVLIETLTALGADVRWASCNIFSTQDHAAAAI
SAHH_HALHL      METRREFAAQKPLKGARIAGCLHMTIQTAVLIETLQELGAEVRWSSCNIFSTQDQAAAAV
SAHH_COXB1      MALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAAL
SAHH_COXBU      MALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAAL
SAHH_COXB2      MALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAAL
SAHH_COXBN      MALRKKYKNAKPLKGARIAGCIHMTIQTAVLIETLMLLGAEVRWSSCNIFSTQDHAAAAL
SAHH_LEPBJ      MALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAI
SAHH_LEPBL      MALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAI
SAHH_LEPIN      MALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAI
SAHH_LEPIC      MALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAI
SAHH_SOLUE      MAIRRKYAKEKPLAGVRITGSLHMTIQTAVLIETLVDLGASVRWASCNIFSTQDHAAAAI
SAHH_XYLFM      MSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAI
SAHH_XYLFA      MSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAI
SAHH_XYLF2      MSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAI
SAHH_XYLFT      MSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAI
SAHH_XANCP      MSIRRKHAQTKPLKDVRITGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAI
SAHH_XANC8      MSIRRKHAQTKPLKDVRITGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAI
SAHH_XANOM      MSIRRKHAQTTPLKDVRITGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAI
SAHH_XANOP      MSIRRKHAQTTPLKDVRITGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAI
SAHH_XANC5      MSIRRKHAQTKPLKDVRITGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAI
SAHH_XANAC      MSIRRKHAQTKPLKDVRITGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAI
SAHH_BACFR      MALREKYGESKPLKGARIMGSLHMTIQTAVLIETLVALGAEVRWCSCNIYSTQDHAAAAI
SAHH_BACTN      MALREKYGESKPLKGARIMGSLHMTIQTAVLIETLVALGAEVRWCSCNIYSTQDHAAAAI
SAHH_CHLL2      MATRRKYAGQKPLKGARITGSLHMTIQTAVLIETLVDLGAEVRWASCNIFSTQDHAAAAI
SAHH_CHLPD      MATRKKYAGQKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAI
SAHH_PELPB      MATRRKYAGQYPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAI
SAHH_PELLD      MAIRKKYAGQKPLKGARVAGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAAI
SAHH_CHLPM      MAIRNKYKGQKPLAGSRISGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAI
SAHH_CHLCH      MALRKKYAGQKPLKGARIAGSLHMTIQTAVLIETLVDLGANVRWASCNIFSTQDHAAAAI
SAHH_CHLP8      MATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAI
SAHH_CHLTE      MATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAI
SAHH_THEAC      AEIRKRFQAEKPFKGIKVAMALHVEAKTGIFALLLKEGGAEVKMASCNPLSSDDSVVQSL
SAHH_THEVO      AEIRKRFLDEKPFKGINIAMALHVEAKTGIFSLLLKEGGANVRMASCNPLSSDDSVVESL
SAHH_HALSA      SALREEFDANQPLAGETIGMAMHVEAKTAALVETMADAGAEIAITGCNPLSTHDGVSAAL
SAHH_HALWD      QELRARFAETKPLAGETIGMAMHVEAKTANLVELLALGGAEVAITGCNPLSTHDDVSAAL
SAHH_THEMA      NKIAEEYSREKPLSGFTVGMSIHLEAKTAYLAITLSKLGAKVVITGSNPLSTQDDVAEAL
SAHH_GLOVI      KQLRQRFSQERPLAGIRISACCHVTTETANLAVALKAAGADALLIASNPLSTQDDVAASL
SAHH_GLOC7      KQIKDRFEKEKPFEGIRLIACCHVTTETANLAIALKAGGADAVLIASNPLSTQDDVAACL
SAHH_NOSS1      RQIRDRFAQEKPFAGLRLVACAHITTETAHLAIALKAGGADAVLIASNPLSTQDDVAASL
SAHH_THEEB      RQIRDRFEKEKPFAGIRLAACCHVTTETANLAIALKAGGADAVLIASNPLSTQDDVAASL
SAHH_SYNY3      KQIRERFAQEKPFAGIRLVACCHVTTETANLAIALHAGGADSLLIASNPLSTQDDVAACL
SIHH_METTH      ERIKSDFSEEKPFKGVTIGSCLHLEPKTINLGLTLQAGGAEVAMTGCNPLSTQDDATAAG
SAHH_AERPE      MRLRSSMGGDKPLSGVRVAACLHVTKETAVLVETLRKWGAEVYLAPSNPLSTQDEVAAAL
SIHH_METKA      GAIRERFEEERPLEGITVGMTLHLEAKTAVLVETLMAGGAEVAITGCNPLSTKDEVAAAL
SAHH_PYRAE      LEIRRRFEKEKPLSGHVIAACLHVTKETGVLVRTLAAGGAEVVLIPSNPLSTQDDVAAAL
SAHH_SACS2      MEIRKRFKAEKPLKGINISAVLHVTKETAALVKTLKIGGANVALAGSNPLSTQDDVAAAL
SAHH_SULAC      MEIRKRFNAEKPLDGIRIGAVLHVTKETAVLVETLKAGGAEIALAGSNPLSTQDDVAAGL
SAHH_SULTO      MEIRKQFEKEKPLQGLRISAVLHVTKETAVLVKTLKIGGATVALAGSNPLSTQDDVAAAL
SAHH_AQUAE      RQIRERFSKEKPLKGKKISACLHVTTETANLMRTLKEGGAEVYLTASNPLSTQDDVAAAL
SAHH_THEKO      QHIRKDFEERKPFKGVRIAATLHLEMKTAFLLLTLKAAGAEVSAAASNPLSTQDDVVAAL
SAHH_PYRAB      QHIRREFEEKKPFKGVRIAATLHLEMKTAFLLLTLKAGGAKVSAAASNPLSTQDDVVAAL
SAHH_PYRFU      QYIKREFEEKKPFKGVRIAATLHLEMKTAFLLLTLKAGGAEVSAAASNPLSTQDDVVAAL
SAHH_PYRHO      QHIRREFEEKKPFKGVRIAATLHLEMKTAFLLLTLKAGGAEVSAAASNPLSTQDDVVAAL
SIHH_METAC      AIIREKFEKEKPLKGLKVGMALHVEAKTAVLVETLAAGGAQVAISGCNPLSTQDDVARAL
SIHH_METMA      AIIREKFEKEKPLKGLKVGMALHVEAKTAVLVETLAAGGAQVAISGCNPLSTQDDVAAAL
SAHH_ARCFU      GKIREQFRKERPLEGFTVGMALHVEAKTAVLVRTLVDAGAEVAITGCNPMSTQDDVADAL
SIHH_METJA      NLIRERFKEEKPFKGITIGMALHLEAKTAVLAETLMEGGAEIAITGCNPLSTQDDVAAAC
SIHH_METMP      CRIAEEFKNDKPFEGLTIGMALHLEAKTAILAETLLEGGAKIVITGCNPLSTQDDVAAAC
                            : .  :    *:  :*  :   :   **      .*  *: . .    

SAHH_ACIAD      AAS---------GVP-VFAWKGETEEEYNWCLEQQINVNGKPW--------------DA-
SAHH_HAHCH      AAA---------GVP-VFAWKGETEEEYVWCIKQTITKDGQPW--------------NA-
SAHH_PSEE4      AAA---------GIP-VFAWKGETEQEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSE14      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSEU2      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSESM      AAA---------GIA-VYAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSEFS      AAA---------GIP-VFAWKGETEEEYEWCLEQTILKDGAPW--------------DA-
SAHH_PSEF5      AAA---------GIP-VFAWKGETEEEYEWCLEQTILKDGKPW--------------DA-
SAHH_PSEPF      AAA---------GIP-VFAWKGETEEEYEWCLEQTILKDGQPW--------------DA-
SAHH_PSEPW      AAA---------GIP-VFAWKGETEEEYEWCLEQTILKDGQPW--------------DA-
SAHH_PSEP1      AAA---------GIP-VFAWKGETEEEYEWCLEQTILKDGQPW--------------DA-
SAHH_PSEPG      AAA---------GIP-VFAWKGETEEEYEWCLEQTILKDGQPW--------------DA-
SAHH_PSEU5      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSEMY      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGKPW--------------DA-
SAHH_PSEAE      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSEA8      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_PSEAB      AAA---------GIP-VFAWKGETEEEYEWCIEQTILKDGQPW--------------DA-
SAHH_STRAZ      AAA---------GIP-VFAWKGETLEEYWWCTEQ-ALT----W--------PGHT--GP-
SAHH_STRGG      AVGPNGTPEAPAGVP-VFAWKGETLEEYWWCTEQ-ALT----W-------PNTPTG-GP-
SAHH_STRAA      AVGPDGTPDNPRAVP-VFAWKGETLEEYWWCTEQ-ALT----W-------PDSPTG-GP-
SAHH_STRAW      AVGPNGTPDNPQGVP-VFAWKGETLEEYWWCTEQ-ALT----W-------PNTPTG-GP-
SAHH_STRCO      AVGPNGTPDNPQGVP-VFAWKGETLEEYWWCTEQ-ALT----W-------PNTPTG-GP-
SAHH_CORDI      VVGPHGTPEDPQGVP-VFAWKGETLEEYWDCVDK-IFS----W-------GDE----LP-
SAHH_COREF      VVG-DGTPEDPQGVP-VFAWKGETLDEYWWCINQ-IFS----W--------EGE---LP-
SAHH_CORGL      VVG-SGTVEEPAGVP-VFAWKGESLEEYWWCINQ-IFS----W-------GDE----LP-
SAHH_CORGB      VVG-SGTVEEPAGVP-VFAWKGESLEEYWWCINQ-IFS----W-------GDE----LP-
SAHH_MYCPA      VVGPHGTPEEPRGVP-VFAWKGETLEEYWWAAEQ-ALT----W----PPLADGTEA-PA-
SAHH_MYCLE      VVGPYGTPEEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----V-
SAHH_MYCLB      VVGPYGTPEEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----V-
SAHH_MYCBO      VVGPHGTPDEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----A-
SAHH_MYCBP      VVGPHGTPDEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----A-
SAHH_MYCBT      VVGPHGTPDEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----A-
SAHH_MYCTU      VVGPHGTPDEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----A-
SAHH_MYCTA      VVGPHGTPDEPKGVP-VFAWKGETLEEYWWAAEQ-MLT----W---P--DPDKP----A-
SAHH_MYCMM      VVGPHGTPEEPKGVP-VFAWKGESLEEYWWCAEQ-MLT----W---P--DSDKP----A-
SAHH_MYCUA      VVGPHGTPEEPKGVP-VFAWKGESLEEYWWCAEQ-MLT----W---P--DSDKP----A-
SAHH_NOCFA      VVGPHGTVEEPKGVS-VFAWKGETLEEYWWAAEQ-MLT----W--------PG----EP-
SAHH_MYCSJ      VVGPHGTPEEPKGTP-VFAWKGETLEEYWWAAEQ-MLT----W--------PG----EP-
SAHH_MYCSK      VVGPHGTPEEPKGTP-VFAWKGETLEEYWWAAEQ-MLT----W--------PG----EP-
SAHH_MYCSS      VVGPHGTPEEPKGTP-VFAWKGETLEEYWWAAEQ-MLT----W--------PG----EP-
SAHH_PELCD      AAT---------GVP-VFAYKGETLEEYWEYTFK-ALA----Y--------EE----GP-
SAHH_BDEBA      AAA---------GIP-VFAWKGLTEQEFNWCIEQTIVG----W--------GK--E-GF-
SAHH_GRAFK      AAA---------GIP-VYAWKGLTEEEFNWCIEQ-TLF----F---------GEDR-KP-
SAHH_FLAJ1      AAA---------GIS-VYAWKGLDEESFDWCIEQ-TLF----F---------GEER-KP-
SAHH_FLAPJ      AAA---------GIQ-VYAWKGLNEPDFDWCIEQ-TLF----F---------GEDR-KP-
SAHH_RHOBA      AAA---------GIP-VYAWKGMTEEEFDWCIEQ-TLD----F---P----SG--E-KL-
SAHH_DESAD      AAN---------GTAKVFAWKGETLEEYWWCTEQ-ALT----W---P----DG--S-GP-
SAHH_DESAG      ADS---------GMAKVFAWKGETLEEYWWCTEM-ALT----W---P----DG--S-GP-
SAHH_DESVH      AAS---------GMAKVFAWKGETLEDYWWCTEM-ALT----W---P----DG--S-GP-
SAHH_DESVV      AAS---------GMAKVFAWKGETLEDYWWCTEM-ALT----W---P----DG--S-GP-
SAHH_DESVM      ADS---------GMAKVFAWKGETLEDYWWCTEM-ALT----W---P----DG--S-GP-
SAHH_GRABC      AAA---------GIP-VFAWKGLSEEEFWWCIEQ-TVRGPDGW--------------TP-
SAHH_ZYMMO      AEQ---------NIP-VFAVKGESLEEYWDYVDR-IFD----W---G----KG--E-TA-
SAHH_NOVAD      AAA---------GIP-VFAVKGESLAEYWDYVGS-IFD----W--------GD--Q-TA-
SAHH_SPHAL      AAS---------GVP-VFAVKGESLADYWDYVGR-IFD----WESDN----DG--R-TA-
SAHH_ROSDO      AAG---------GTP-VFAIKGQSLEEHWDYLDR-SFM----F--------ED----GP-
SAHH_RHOCB      AAG---------GTP-VFAVKGETLEEYWAYTDK-IFQ----F-------PEG----TC-
SAHH_RHOSH      AAS---------GVP-VFAIKGETLEDYWAYTDK-IFQ----F-------ADG----TC-
SAHH_BARQU      AAT---------GTA-VFGVKGETLEEYWAYIDA-IFQ----W-------PDG----NP-
SAHH_BARHE      AAT---------GTP-VFAVKGETLEEYWTYIDA-IFQ----W-------PDG----NP-
SAHH_BART1      AAT---------GIP-VFAVKGETLEEYWTYIDA-IFQ----W-------PDG----HP-
SAHH_AGRFC      AAA---------GIP-VFAVKGESLTEYWEYTDK-IFQ----W---T----DG--G-LS-
SAHH_RHIME      AAS---------GVP-VFAVKGETLEEYWTYTDK-IFQ----W---A----DG--G-VS-
SAHH_SINMW      AAS---------GVP-VFAVKGETLEEYWTYTDK-IFQ----W---A----DG--G-VS-
SAHH_AGRRK      AAS---------GVP-VYAIKGESLEDYWIYTDK-IFQ----W---A----DG--G-FS-
SAHH_RHILW      AAA---------GVP-VFAIKGESLEDYWVYTDK-IFQ----W---A----DG--G-LS-
SAHH_RHIL3      AAS---------GVP-VFAIKGESLEDYWVYTDK-IFQ----W---A----DG--G-LS-
SAHH_RHIEC      AAA---------GVP-VFAIKGESLEDYWVYTDK-IFQ----W---A----DG--G-LS-
SAHH_RHIE6      AAA---------GVP-VFAIKGESLEDYWVYTDK-IFQ----W---A----DG--G-LS-
SAHH_CHESB      AET---------GTP-VFAVKGETLEEYWTYTDR-IFQ----W-------PDG----QP-
SAHH_RHILO      AEA---------GIP-VFAVKGESLEQYWDYTDR-IFQ----W-------ADG----GL-
SAHH_OCHA4      AAT---------GTP-VFAIKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUO2      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUAB      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUA2      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUA1      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUC2      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUSU      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUSI      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUME      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_BRUMB      AAT---------GTP-VFAVKGETLEEYWTYTDQ-IFQ----W-------PDG----EP-
SAHH_MARMM      AET---------GVP-VFATKGETLEEYWDYADA-IFH----W---P----DG--E-TA-
SAHH_HYPNA      ADA---------GTA-VFAYKGETLEEYWDYTDR-MFQ----W---P----DG--E-GP-
SAHH_CAUVC      AAA---------GVP-VFAFKGENLVEYWEYAHK-IFE----W---H----DG--G-YP-
SAHH_RHOPA      AAA---------GIP-VFAVKGETLKDYWDYTAK-LFD----W---S----DG--G-TP-
SAHH_RHOPT      AAA---------GIP-VFAVKGETLKDYWDYTAK-LFD----W---S----DG--G-TP-
SAHH_RHOPS      AAA---------GIP-VFAIKGESLEDYWDYTAR-MFD----W---H----GG--G-TP-
SAHH_RHOP2      AAA---------GIP-VFAIKGESLEDYWDYTAR-MFD----W---H----GG--G-TP-
SAHH_BRADU      AAA---------GIP-VFAVKGETLTEYWDYTAK-LFD----W---H----GG--G-HP-
SAHH_BRASB      AAA---------GIP-VFAVKGETLADYWDYTAK-LFD----W---H----GG--G-HP-
SAHH_METC4      AAA---------GIP-VFAVKGETLTEYWDYTSK-LFD----W---H----DG--G-MP-
SAHH_METEP      AAA---------GIP-VFAVKGETLTEYWDYTSK-LFD----W---H----DG--G-MP-
SAHH_METPB      AAA---------GIP-VFAVKGETLTEYWDYTSK-LFD----W---H----DG--G-MP-
SAHH_METNO      AAA---------GIP-VFAVKGETLTEYWDYTAK-LFE----W---H----DG--G-MP-
SAHH_METS4      AAA---------GIP-VFAVKGETLTEYWDYTAR-LFD----W---H----DG--G-MP-
SAHH_PROMP      AEQ---------GIS-VYAKKGESLDEYWQYTHY-ILD----W---------GTD--SP-
SAHH_PROM9      ADQ---------GIS-VYAKKGETLDEYWQYTHC-ILD----W---------GAD--SP-
SAHH_PROM2      ADR---------GIP-VFAKKGETLDEYWQYTHY-ILD----W---------GSD--SP-
SAHH_PROM0      ADQ---------GIS-VFAKKGETLDEYWQYTHY-ILD----W---------GSD--FP-
SAHH_PROM3      AAS---------GVP-VFATKGETLDEYWAYTHR-ILE----W-------GDG--G-TP-
SAHH_PROMM      AAS---------GVP-VFATKGETLDEYWAYTHR-ILE----W-------GDG--G-TP-
SAHH_SYNS3      AAG---------GIP-VFAVKGETLEEYWDYTHS-ILE----W-------GDG--G-TP-
SAHH_SYNS9      AAN---------GTP-VFAVKGETLEEYWAYTHR-ILE----W-------SDG--G-AP-
SAHH_SYNSC      AAK---------GIP-VFAVKGETLEEYWDYTHS-ILE----W-------GDG--G-SP-
SAHH_SYNPW      AAR---------DIP-VFAVKGETLEEYWEYTHR-ILE----W-------GDG--G-SP-
SAHH_SYNPX      AAQ---------NIP-VFAVKGETLEEYWEYTHR-ILE----W-------GDG--G-SP-
SAHH_PROMA      AKA---------GVP-VFAKKGETLSEYWSFTHS-ILE----W--------SGEQ--GP-
SAHH_PROM4      ASS---------GIP-VFAKKGETLDEYWAYTHR-ILE----W---------GDQE-TP-
SAHH_MYXXD      VQA---------GTP-VFAHKGESLKEYWDFTHR-IFD----F------GPAGSDHEGP-
SAHH_LEPCP      AVQ---------GTP-VFAYKGETLADYWDYTHR-IFE----F------GAAGTDGEGP-
SAHH_ACISJ      AAT---------GTP-VFAIKGETLVDYWDYTHR-IFD----F------GPKGSEGEGP-
SAHH_ACIET      AAT---------GTP-VFAIKGETLVDYWDYTHR-IFD----F------GPKGSEGEGP-
SAHH_DELAS      AET---------GTP-VFAIKGESLADYWDYTHR-IFE----F------GAAGTEGEGP-
SAHH_METPP      VAA---------GTP-VFAYKGETLTDYWDYTHR-IFD----F------GAKGTDGEGP-
SAHH_ACIAC      AAG---------GTP-VFAIKGESLEDYWDYTHR-IFD----F------GAKGTPGEGP-
SAHH_VARPS      AAA---------GTP-VFAIKGESLKDYWDYTHA-IFD----F------GPKGSQGEGP-
SAHH_HERAR      AAA---------GTP-VFAVKGETLDDYWEYTHR-IFE----W----PNDDKGAPV-YS-
SAHH_JANMA      AAA---------GTP-VFAVKGETLDDYWEYTHR-IFE----W-------PNDDKGAPVY
SAHH_BORPD      AAT---------GTP-VFAVKGETLEEYWQYTHR-IFE----W---P----EG--R-HA-
SAHH_BORBR      AAT---------GTP-VFAIKGETLEEYWQYTHK-IFE----W---P----EG--R-HA-
SAHH_BORPA      AAT---------GTP-VFAIKGETLEEYWQYTHK-IFE----W---P----EG--R-HA-
SAHH_BORPE      AAT---------GTP-VFAIKGETLEEYWQYTHK-IFE----W---P----EG--R-HA-
SAHH_POLNS      AAN---------GTP-VFAIKGETLEQYWDFTHR-IFE----W---A----DG--G-YT-
SAHH_POLAQ      AAN---------GTP-VFAIKGETLEQYWDFTHR-IFE----W---A----DG--G-YT-
SAHH_AROAE      AAS---------GVP-VFAVKGESLADYWDYTHR-IFE----W---R----DG--G-YS-
SAHH_RALPJ      AAT---------GTP-VFAFKGESLQEYWDFTHR-IFE----W---A----DG--G-TP-
SAHH_RALSO      AAS---------GTP-VFAFKGESLKEYWDFTHR-IFE----W---A----DG--G-TP-
SAHH_CUPMC      AAS---------GTP-VFAFKGESLKEYWDFTHR-IFD----W---A----DG--G-TP-
SAHH_CUPPJ      AAG---------GTP-VFAFKGESLKEYWDFTHR-IFD----W---V----DG--G-TP-
SAHH_CUPTR      AAG---------GTP-VFAFKGESLKEYWDFTHR-IFD----W---A----DG--G-TP-
SAHH_CUPNH      AAG---------GTP-VFAFKGESLKEYWDFTHR-IFD----W---A----DG--G-TP-
SAHH_GEOSL      AAA---------GIP-VFAYKGESLEEYWEFTHR-IFE----W---H----DG--G-TP-
SAHH_NITEU      AAR---------NIP-VFAYKGESLEEYWDYAHQ-IFE----W------ASDG----SHT
SAHH_NITEC      AAR---------DIP-VFAYKGESLKEYWDYAHQ-IFE----W------TSDG----SHA
SAHH_METCA      AAD---------GIP-VFAYKGESLDDYWEYTHR-ILE----W---P----GD--V-GP-
SAHH_CHRVO      AAA---------GIP-VFAFKGESLDEYWEFSHK-IFE----W-------PEG----QP-
SAHH_BURMA      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURM9      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURM7      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURMS      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURPS      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURP0      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURP1      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURP6      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_BURTA      VEA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_PARP8      AKG---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_PARPJ      AKA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_PARXL      AKA---------GTP-VFAFKGESLDEYWEFSHR-IFE----W---P----NG--E-FA-
SAHH_HALHL      AAN---------GTP-VFAWKGETEEEYWWCIEQ-TINGPDGW--------------KP-
SAHH_COXB1      AQK---------GIP-IFAWKGETEEEYWRCIAS-TLEGPKGW--------------TP-
SAHH_COXBU      AQK---------GIP-IFAWKGETEEEYWRCIAS-TLEGPKGW--------------TP-
SAHH_COXB2      AQK---------GIP-IFAWKGETEEEYWRCIAS-TLEGPKGW--------------TP-
SAHH_COXBN      AQK---------GIP-IFAWKGETEEEYWRCIAS-TLEGPKGW--------------TP-
SAHH_LEPBJ      AKA---------GVP-VFAWKGETEEEYWWCIEQ-TLF----F-------GDK----GP-
SAHH_LEPBL      AKA---------GVP-VFAWKGETEEEYWWCIEQ-TLF----F-------GDK----GP-
SAHH_LEPIN      AKA---------GIP-VFAWKGETEEEYWWCIEQ-TIF----F-------GDK----GP-
SAHH_LEPIC      AKA---------GIP-VFAWKGETEEEYWWCIEQ-TIF----F---G----DK----GP-
SAHH_SOLUE      AKA---------GVP-VFAWKGESLEEYWWCTLQ-AVT----H-------PGG--K-GP-
SAHH_XYLFM      ATS---------GTP-VFAWKGETLEEYWDCTLQ-ALT----F---T--LADGTLT-GP-
SAHH_XYLFA      ATS---------GTP-VFAWKGETLEEYWDCTLQ-ALT----F---T--LSDGTLT-GP-
SAHH_XYLF2      ATS---------GTP-VFAWKGETLEEYWDCTLQ-ALT----F---T--LADGTLT-GP-
SAHH_XYLFT      ATS---------GTP-VFAWKGETLEEYWDCTLQ-ALT----F---T--LADGTLT-GP-
SAHH_XANCP      AAT---------GTP-VFAWKGETLEEYWDCTLD-ALT----F---T--LPDGTLT-GP-
SAHH_XANC8      AAT---------GTP-VFAWKGETLEEYWDCTLD-ALT----F---T--LPDGTLT-GP-
SAHH_XANOM      AAT---------GTP-VFAWKGETLEEYWDCTLD-ALT----F---T--LPDGTLT-GP-
SAHH_XANOP      AAT---------GTP-VFAWKGETLEEYWDCTLD-ALT----F---T--LPDGTLT-GP-
SAHH_XANC5      AAT---------GTP-VFAWKGETLEEYWDCTLD-ALT----F---T--LPDGTLT-GP-
SAHH_XANAC      AAT---------GTP-VFAWKGETLEEYWDCTLD-ALT----F---T--LPDGTLT-GP-
SAHH_BACFR      AAS---------GVA-VFAWKGETLADYWWCTLQ-ALN----F-------EGG--K-GP-
SAHH_BACTN      AAS---------GVA-VFAWKGENLADYWWCTLQ-ALN----F-------PGG--K-GP-
SAHH_CHLL2      AAA---------GIP-VFAWKGESLDEYWWCTRQ-ILE----F-------EDG--K-GP-
SAHH_CHLPD      AKA---------GIP-VFAWKGETLDEYWWCTRQ-ILE----F-------EGG--K-GP-
SAHH_PELPB      AKS---------GVP-VFAWKGETLEEYWWCTRQ-ILE----F-------EGG--K-GP-
SAHH_PELLD      AAT---------GVP-VFAWKGETLEDYWWCTRQ-ILD----F-------GDG--Q-GP-
SAHH_CHLPM      AVT---------GVP-VFAWKGESLEEYWWCTRQ-ILD----F-------GNG--L-GP-
SAHH_CHLCH      AQA---------GVP-VFAWKGETLDEYWWCTRQ-ILE----F--------DG--GLGP-
SAHH_CHLP8      AAA---------GVP-VFAWKGETLDEYWWCTRQ-ILE----F--------EG--GLGP-
SAHH_CHLTE      AAA---------GVP-VFAWKGETLDEYWWCTRQ-ILE----F-------EGG--L-GP-
SAHH_THEAC      KED--------YGMP-VFARKGETSEEYYEYLHR-TLD----V--------------QP-
SAHH_THEVO      KTD--------YGMP-VFARKGETQEEYYENLQR-TLE----K--------------PP-
SAHH_HALSA      DAH--------ESIT-SYAERGAEGEAYYDAIDA-VLA----H--------------EP-
SAHH_HALWD      DSN--------ENVT-SYAKRGVDEEAYYDAIEA-VVA----H--------------EP-
SAHH_THEMA      RSK---------GIT-VYARRTHDESIYRENLMK-VLD----E--------------RP-
SAHH_GLOVI      VVD--------HGIP-VFALKGEDTATYLRHVRV-ALD----H--------------RP-
SAHH_GLOC7      VAD--------YGIP-VFAIKGEDNATYHRHVQI-ALD----H--------------KP-
SAHH_NOSS1      VLD--------HEIP-VFAQKGEDNATYNRHVQI-ALD----H--------------RP-
SAHH_THEEB      VVN--------YGIP-VFAQKGEDTATYMRHVNI-ALD----H--------------RP-
SAHH_SYNY3      VAD--------YGIP-VYAIKGEDNETYHRHVQI-ALD----H--------------RP-
SIHH_METTH      AKM---------GLN-MYGWRGETNEEYYENIHR-VLD----H--------------EP-
SAHH_AERPE      AEA---------GIG-VFAWRGMTPEEYKWALST-VAG----R--------------EP-
SIHH_METKA      VEE---------GVH-VYAWRGETEEEYYQNIDR-VLS----H--------------EP-
SAHH_PYRAE      AQE---------GIH-VYAWRGMSEREYYNAIGF-ALS----F--------------NP-
SAHH_SACS2      VEE---------GIS-VFAWKGENETEYYSNIES-IVK----I---H----------EP-
SAHH_SULAC      AKN---------GIH-VYAWRGETEKDYYDNIRE-ILK----Y--------------EP-
SAHH_SULTO      VEE---------GIR-VFAWRGETEKDYYDNIKE-ILK----Y--------------EP-
SAHH_AQUAE      VKY--------FEIP-VFAIRGEDRETYYKHLRA-VIE----K--------------EP-
SAHH_THEKO      AKA---------GVK-VYAIRGEDREQYYEFMHK-ALD----V--------------KP-
SAHH_PYRAB      AKE---------GVK-VYAIRGESKEEYYEFMNK-ALD----I--------------RP-
SAHH_PYRFU      AKA---------GVK-VYAIRGESREQYYEFMHK-ALD----I--------------RP-
SAHH_PYRHO      AKA---------GVK-VYAIRGESKEQYYEFMHK-ALD----I--------------RP-
SIHH_METAC      DTR--------KNIS-CFARYGCCTSEYYEAIDK-VLD----I--------------EP-
SIHH_METMA      DTR--------ENIN-CFAKYGCCTGEYYEAIDR-VLD----I--------------EP-
SAHH_ARCFU      RES---------GIA-CYAKRGMDVEEYYEALRN-VIR----A--------------EP-
SIHH_METJA      AKK---------GMH-VYAWRGETVEEYYENLNK-VLD----H--------------KP-
SIHH_METMP      VEK---------GME-VYAWRGETNEEYYENLNK-VLD----S--------------NP-
                                 :.        .                                

SAHH_ACIAD      -NMILDDGGDLTALVH-----------------------------------------EKY
SAHH_HAHCH      -NMVLDDGGDLTEILH-----------------------------------------NEF
SAHH_PSEE4      -NMVLDDGGDLTEILH-----------------------------------------KKY
SAHH_PSE14      -NMILDDGGDLTVIIH-----------------------------------------KKY
SAHH_PSEU2      -NMILDDGGDLTEIIH-----------------------------------------KKY
SAHH_PSESM      -NMILDDGGDLTEIIH-----------------------------------------KKY
SAHH_PSEFS      -NMILDDGGDLTELLH-----------------------------------------KKY
SAHH_PSEF5      -NMILDDGGDLTQLLH-----------------------------------------DKY
SAHH_PSEPF      -NMILDDGGDLTELLH-----------------------------------------KKY
SAHH_PSEPW      -NMILDDGGDLTELLH-----------------------------------------KKY
SAHH_PSEP1      -NMILDDGGDLTELLH-----------------------------------------KKY
SAHH_PSEPG      -NMILDDGGDLTELLH-----------------------------------------KKY
SAHH_PSEU5      -NMVLDDGGDLTQILH-----------------------------------------DKY
SAHH_PSEMY      -NMVLDDGGDLTEILH-----------------------------------------KKY
SAHH_PSEAE      -NMVLDDGGDLTEILH-----------------------------------------KKY
SAHH_PSEA8      -NMVLDDGGDLTEILH-----------------------------------------KKY
SAHH_PSEAB      -NMVLDDGGDLTEILH-----------------------------------------KKY
SAHH_STRAZ      -NMILDDGGDATLLVHKGVEYRKTG--ILPEA----ENEELAVVRALLDRSG-----LDW
SAHH_STRGG      -NMILDDGGDATLLVHKGVEFEKAG-AAPDPS--TADSEEYAHILTLLNRTLGEAP-QKW
SAHH_STRAA      -NMILDDGGDATLLVHKGVEYEKDG-KVPSVD--TAENDEHRVILELLNRTITDGS-QKW
SAHH_STRAW      -NMILDDGGDATLLVHKGVEYEKDG-KVPSVD--TAESDEHRVILELLHRTITDGS-QKW
SAHH_STRCO      -NMILDDGGDATLLVHKGVEYEKDG-KVPSVD--TAESDEHRVILELLTRTVGESP-QKW
SAHH_CORDI      -NMILDDGGDATMAVIRGKQFEEAG---MVPPVEEGDSDEYQAFLGMLRKTLAEQP-GKW
SAHH_COREF      -NMILDDGGDATMAVIRGREYEKAG---VVPQPEANDSDEYIAFLGMLREVLAEEP-DKW
SAHH_CORGL      -NMILDDGGDATMAVIRGREYEQAG---LVPPAEANDSDEYIAFLGMLREVLAAEP-GKW
SAHH_CORGB      -NMILDDGGDATMAVIRGREYEQAG---LVPPAEANDSDEYIAFLGMLREVLAAEP-GKW
SAHH_MYCPA      -NMILDDGGDATMLVLRGAQYEKAG---VVPPDDEDDSAEHRVFLNLLRARFETDK-TKW
SAHH_MYCLE      -NMILDDGGDATMLVLRGVQYEKAG---VVPPAEVDDSAEWKVFLNLLRKRFETDK-GKW
SAHH_MYCLB      -NMILDDGGDATMLVLRGVQYEKAG---VVPPAEVDDSAEWKVFLNLLRKRFETDK-GKW
SAHH_MYCBO      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDPAEWKIFLNLLRTRFETDK-DKW
SAHH_MYCBP      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDPAEWKVFLNLLRTRFETDK-DKW
SAHH_MYCBT      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDPAEWKVFLNLLRTRFETDK-DKW
SAHH_MYCTU      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDPAEWKVFLNLLRTRFETDK-DKW
SAHH_MYCTA      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDPAEWKVFLNLLRTRFETDK-DKW
SAHH_MYCMM      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDSAEWKVFLGLLRSRFETDK-GKW
SAHH_MYCUA      -NMILDDGGDATMLVLRGMQYEKAG---VVPPAEEDDSAEWKVFLGLLRSRFETDK-GKW
SAHH_NOCFA      ANMILDDGGDATMLVLRGAQFEKAG---VVPPEDADHSAEYKVFLNLLRERFETDR-GKW
SAHH_MYCSJ      ANMILDDGGDATMLVLRGAQFEKAG---VVPPAEDDDSAEYKVFLNLLRERFETDK-TKW
SAHH_MYCSK      ANMILDDGGDATMLVLRGAQFEKAG---VVPPAEDDDSAEYKVFLNLLRERFETDK-TKW
SAHH_MYCSS      ANMILDDGGDATMLVLRGAQFEKAG---VVPPAEDDDSAEYKVFLNLLRERFETDK-TKW
SAHH_PELCD      -QLIVDDGGDATLLIHRGVERERAYARTGKVPEISHDNKELSIVDALLNRQLLVDA-EYW
SAHH_BDEBA      -NMILDDGGDLTNMMHE----------------------------------------PRF
SAHH_GRAFK      LNMILDDGGDLTNMVL-----------------------------------------DEY
SAHH_FLAJ1      LNMILDDGGDLTNMVI-----------------------------------------DRY
SAHH_FLAPJ      LNMILDDGGDLTNMVI-----------------------------------------DRY
SAHH_RHOBA      -NMILDDGGDLTAMVH-----------------------------------------DRF
SAHH_DESAD      -DLIVDDGGDATLLIHHGVKAEKDASILDEKT----DNKEFQCVLDRLKLSVAETP-GKW
SAHH_DESAG      -DLIVDDGGDATMLIHKGVEAEKNPALLEKSY----DNKEFQIVMNRIALSMKNDP-GKW
SAHH_DESVH      -DLLVDDGGDATLFIHKGVEVENDPSLLKKAY----DNKEFQIIMDRLALAYEQDP-GRW
SAHH_DESVV      -DLLVDDGGDATLFIHKGVEVENDPSLLKKAY----DNKEFQIIMDRLALAYEQDP-GRW
SAHH_DESVM      -DLLVDDGGDATLMIHKGVEVENNPELLKQAY----DNKEFQIIMDRLALAYQNDP-GRW
SAHH_GRABC      -NMILDDGGDLTVLMH-----------------------------------------DKY
SAHH_ZYMMO      -NMILDDGGDATMFVLWGAKLEAGV--EFPAP----QNEEEEIFQKTVRRRVAATP-GFL
SAHH_NOVAD      -NMILDDGGDATMFALWGARVEAGE--PLFEP----SNAEEIEFVRALKEFLKRKP-GYL
SAHH_SPHAL      -NLILDDGGDATMFALWGAKLEAGE--TMPPP----ENEEEVEMQRALKAFIAAKP-GYL
SAHH_ROSDO      -NLILDDGGDATLYVLLGARAEAGE-EIIPVP----TSEEEEAIKAQIKKRMAASP-GWF
SAHH_RHOCB      -NMILDDGGDATLYILLGARVEAGETDLIATP----TSEEEVCLFNQIKKRMVESP-GWF
SAHH_RHOSH      -NMILDDGGDATLYILLGARVEAGETDLIAVP----QSDEEVCLFNQIRKRMAETP-GWF
SAHH_BARQU      SNLILDDGADATNYILTGSRAEVNK-DILSYP----KTKEEEFFFKQIQKRMKITP-GFF
SAHH_BARHE      SNLILDDGADATNYILMGSRAETNK-DILSHP----KTEEEELFFKQIQRRMEATP-GFF
SAHH_BART1      SNMILDDGADATNYILVGSRAEQNK-DILSHP----KTEEEEIFFKQIQKRMDATP-GFF
SAHH_AGRFC      -NMILDDGGDATMYILLGARAEAGE-DVLSNP----GSEEEEILFAQINKRLKASP-GWF
SAHH_RHIME      -NMILDDGGDATMYILLGARAEAGE-NILTNP----GSEEEEILFAQIKKRLAATP-GWF
SAHH_SINMW      -NMILDDGGDATMYILLGARAEAGE-NILINP----GSEEEEILFAQIKKRLAATP-GWF
SAHH_AGRRK      -NMILDDGGDATMYILLGARAEAGE-DVLSDP----HSEEEEILFAQIKKRLKASP-GWF
SAHH_RHILW      -NMILDDGGDATMYILLGARAEAGE-DVLSHP----HSEEEEILFAQIKKRLAASP-GWF
SAHH_RHIL3      -NMILDDGGDATMYILLGARAEAGE-DVLSHP----HSEEEEILFAQIKKRLAASP-GWF
SAHH_RHIEC      -NMILDDGGDATMYILLGARAEAGE-DVLSNP----HSEEEEILFAQIKKRLAASP-GWF
SAHH_RHIE6      -NMILDDGGDATMYILLGARAEAGE-DVLSHP----HSEEEEILFAQIKKRLAASP-GWF
SAHH_CHESB      SNMILDDGGDATMYILLGARAEAGE-DVLSNP----DGEEEEILFQQIKKRMAETP-GFF
SAHH_RHILO      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEYFYAQVKKRLKASP-GFF
SAHH_OCHA4      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----GSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUO2      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUAB      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUA2      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUA1      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUC2      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUSU      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUSI      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUME      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_BRUMB      SNMILDDGGDATMYILIGARAEAGE-DVLSNP----QSEEEEVLFAQIKKRMAATP-GFF
SAHH_MARMM      -NMILDDGGDATMYLILGEKAENDP-SVLNHP----KSEEETFLFAQIKKRIAATP-GWF
SAHH_HYPNA      -NLILDDGGDATMYLILGEKAESDP-SFLEKP----TSEEEKYFFAQIKKRLTASP-GWF
SAHH_CAUVC      -NLILDDGGDATLLCVLGPKAEKDP-SILNNP----QNEEEEALYAVMKKYLAEKP-GFY
SAHH_RHOPA      -NMILDDGGDATMFVHQGLRAENGDTMFLDQH----NSEEEEIFFALIKRILKEKPKGYF
SAHH_RHOPT      -NMILDDGGDATMFVHQGLRAENGDTMFLDQH----NSEEEEIFFALIKRILKEKPKGYF
SAHH_RHOPS      -NMILDDGGDATMYVHLGLRAENGDTAFLDKP----GSDEEVIFFALLKKQLKEKPKGYF
SAHH_RHOP2      -NMILDDGGDATMYVHLGLRAENGDTAFLDKP----GSDEEVIFFALLKKQLKEKPKGYF
SAHH_BRADU      -NMILDDGGDATMYVHLGLRAENGDTAFLDKP----GSEEEEVFFALLKKQLKEKPKGYF
SAHH_BRASB      -NMILDDGGDATMYVHLGLRAENGDTAFLDKP----ASEEEEVFFALLKKQLKEKPKGYF
SAHH_METC4      -NMILDDGGDATMFVHLGLRAENGDTAFLDKP----ESEEEEVFFALLKKKLAEKPKGWF
SAHH_METEP      -NMILDDGGDATMFVHLGLRAENGDTAFLDKP----ESEEEEVFFALLKKKLAEKPKGWF
SAHH_METPB      -NMILDDGGDATMFVHLGLRAENGDTAFLDKP----ESEEEEVFFALLKKKLAEKPKGWF
SAHH_METNO      -NMILDDGGDATMFVHAGLRAERGDAVFLDKP----GSEEEEIFFALIKRMLKEKPQGWF
SAHH_METS4      -NMILDDGGDATMFVHAGLRAERGDTAFLDAP----GSEEEEIFFALIKRMLKEKPKGWF
SAHH_PROMP      -NMILDDGGDATGLLILGSKAEKDL-SVLKNP----SNEEEIALFNSIRSKLQEDS-SFY
SAHH_PROM9      -NMILDDGGDATGLLILGSKAEKDL-SVLDNP----GNEEEIALFNSIKYKLETDS-DFY
SAHH_PROM2      -NMILDDGGDATGLLILGSKAEKDL-SVLDNP----SNEEETALFSSIKSKLQVDG-SFY
SAHH_PROM0      -NMILDDGGDATGLLILGSKAEKDL-SVLDNP----SNEEEIALFNSIKSKLKNDG-EFY
SAHH_PROM3      -NMILDDGGDATGLVMLGSKAESDS-SVLDNP----GNEEETALFASIRTKLAQDS-SFY
SAHH_PROMM      -NMILDDGGDATGLVMLGSKAESDS-SVLDNP----GNEEETALFASIRTKLAEDS-SFY
SAHH_SYNS3      -NMILDDGGDATGLVMLGSKAEQDI-TVLDNP----SNEEETFLFASIKKKLAKDS-SFY
SAHH_SYNS9      -NMILDDGGDATGLVILGTKAEQDI-TVLDNP----SNEEETFLFASIKKKLAEDS-SFY
SAHH_SYNSC      -NMILDDGGDATGLVMLGSKAEQDI-TVLDNP----GNEEETFLFASIKKKLAQDP-TFY
SAHH_SYNPW      -NMILDDGGDATGLVMLGSKAEQDI-TVLDNP----GNEEETFLFASIKKKLAQDP-TFY
SAHH_SYNPX      -NMILDDGGDATGLVMLGSKAEQDI-TVLDNP----SNEEETFLFASIKKKLAQDP-TFY
SAHH_PROMA      -NMILDDGGDATGLVILGSKAEKDI-SVLDNP----SNEEEIALYASIKSKLSTDK-SFY
SAHH_PROM4      -NMILDDGGDATGLVILGSKAEQDL-SVLERP----NNEEEIALYSSIRNKLSDDP-SFY
SAHH_MYXXD      -NMILDDGGDATLLMHLGKRAEKDA-SVLANP----QSEEERELYAAIKAKLAEDA-TWY
SAHH_LEPCP      -NMILDDGGDATLLMHLGKRAEKDL-SLLDNP----KSEEETCLYAAIRAKLAVDP-TWY
SAHH_ACISJ      -NMILDDGGDATLLMHLGKRAEKDA-SVLAHP----GSEEERILFAAIKAKLAEDS-TWY
SAHH_ACIET      -NMILDDGGDATLLMHLGKRAEKDA-SVLANP----GSEEERILFAAIKAKLAEDS-TWY
SAHH_DELAS      -NMILDDGGDATMLLHLGMRAEKDL-SVLDNP----ASEEEKIAFAAIRAKLAQDP-TWY
SAHH_METPP      -NMILDDGGDATLLMHLGQKAEKDP-SVISKP----TSEEETCLFAAIKAKLAQDP-TWY
SAHH_ACIAC      -NMILDDGGDATLLMHLGQRAEKDL-SVVANP----TSEEERILFAAIKAKIAQDP-TWY
SAHH_VARPS      -NMILDDGGDATLLMHLGQRAEKDL-GVLSKP----TSEEERILYAAIKAKLAVDP-TWY
SAHH_HERAR      -NMILDDGGDATLLLHLGTRAEKDA-SVLNNP----GSEEEICLFNSIKKHLAVDA-TWY
SAHH_JANMA      SNMILDDGGDATLLLHLGTRAEKDA-SVLNNP----GSEEEICLFNSIKKHLAVDA-TWY
SAHH_BORPD      -NMILDDGGDATLLLHLGARAEQDA-SVLAKP----GSEEERVLFAAIKATLARDP-KWY
SAHH_BORBR      -NMILDDGGDATLLLHLGARAEQDI-SVLAKP----GSEEERVLFAAIKETLARDP-KWY
SAHH_BORPA      -NMILDDGGDATLLLHLGARAEQDI-SVLAKP----GSEEERVLFAAIKETLARDP-KWY
SAHH_BORPE      -NMILDDGGDATLLLHLGARAEQDI-SVLAKP----GSEEERVLFAAIKETLGRDP-KWY
SAHH_POLNS      -NMILDDGGDATLLLHLGARAEKDQ-ACLNHP----TSEEETILFAAIKNKLAQDP-TWY
SAHH_POLAQ      -NMILDDGGDATLLLHLGARAEKDQ-ACLNNP----TSEEETILFAAIKKKLAQDP-TWY
SAHH_AROAE      -NMILDDGGDATLLLHLGARAEKDV-SVLAKP----GSEEERVLFAAIRAKLASDP-TWY
SAHH_RALPJ      -NMILDDGGDATLLLHLGAKAEKDV-SVLAHP----GSEEETFLFAAIKEKLAKDA-TFY
SAHH_RALSO      -NMILDDGGDATLLLHLGAKAEQDA-SVIAKP----GSEEETFLFAAIKEKLAKDA-TFY
SAHH_CUPMC      -NMILDDGGDATLLLHLGARAEKDA-SLIAKP----TSEEETFLFAAIKEKLAKDS-TWY
SAHH_CUPPJ      -NMILDDGGDATLLLHLGAKAEKDA-SLIANP----GSEEETFLFAAIKEKLAKDP-SWY
SAHH_CUPTR      -NMILDDGGDATLLLHLGARAEKDQ-SVIANP----GSEEETFLFAAIKEKLAKDP-SWY
SAHH_CUPNH      -NMILDDGGDATLLLHLGARAEKDQ-SVIAKA----TSEEETYLFAAIKEKLAKDP-SWY
SAHH_GEOSL      -NMILDDGGDATLLLHLGSDAEKDP-SVIANP----TCEEEQYLFASIKKRLAEKP-GWY
SAHH_NITEU      ANMILDDGGDATLLLILGSKAERDP-SVIANP----TNEEEQVLFASIRSRLASHP-GWY
SAHH_NITEC      ANMILDDGGDATLLLILGSRAERDP-SVIANP----SNEEEQVLFASIRSRLTSHP-GWY
SAHH_METCA      -NMILDDGGDATLLVTLGARAEKDA-SLLANP----TCEEEEVLFAAIRKRLAAKP-GWY
SAHH_CHRVO      ANMILDDGGDATLLLMLGSKAEKDI-GVIAHP----TNEEETALFASIKRHLAIDP-HWY
SAHH_BURMA      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURM9      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURM7      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURMS      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURPS      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURP0      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURP1      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURP6      -NMILDDGGDATLLLILGSKAEKDR-SVIARP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_BURTA      -NMILDDGGDATLLLILGSKAEKDR-SVIAKP----TNEEEVALFKSIERHLEIDG-SWY
SAHH_PARP8      -NMILDDGGDATLLLILGSKAEKDR-SVISKP----TNEEEVALYKSIARHLDADP-VWY
SAHH_PARPJ      -NMILDDGGDATLLLILGSKAEKDR-SVISKP----TNEEEVALYKSIASHLDADP-TWY
SAHH_PARXL      -NMILDDGGDATLLLILGSKAEKDR-SVISKP----TNEEEVALYKSIERHLDADP-TWY
SAHH_HALHL      -NMLLDDGGDLTAVIH-----------------------------------------EQY
SAHH_COXB1      -NLLLDDGGDLTAHTL-----------------------------------------QKH
SAHH_COXBU      -NLLLDDGGDLTAHTL-----------------------------------------QKH
SAHH_COXB2      -NLLLDDGGDLTAHTL-----------------------------------------QKH
SAHH_COXBN      -NLLLDDGGDLTAHTL-----------------------------------------QKH
SAHH_LEPBJ      -NMILDDGGDLTAYVH-----------------------------------------EKY
SAHH_LEPBL      -NMILDDGGDLTAYVH-----------------------------------------EKY
SAHH_LEPIN      -NMILDDGGDLTAYIH-----------------------------------------EKY
SAHH_LEPIC      -NMILDDGGDLTAYIH-----------------------------------------EKY
SAHH_SOLUE      -QLVVDDGGDVTLLIHKGYELENGSDWVNTPS----GSHEEKVIKDLLKQVHAEDP-QRW
SAHH_XYLFM      -ELIVDDGGDATLLIHKGYELENGSTWVDEPS----DSLEEQVIKRLLKRIAIERP-GYW
SAHH_XYLFA      -ELIVDDGGDATLLIHKGYELENGSTWVDEPS----DSLEEQVIKRLLKRIAIERP-GYW
SAHH_XYLF2      -ELIVDDGGDATLLIHKGYELENGSTWVDEPS----DSLEEQVIKRLLKRIAIERP-GYW
SAHH_XYLFT      -ELIVDDGGDATLLIHKGYELENGSTWVDEPS----DSLEEQVIKRLLKRIAIERP-GYW
SAHH_XANCP      -ELVVDDGGDVTLLIHKGYELENGSTWVDEPA----SSHEEGVIKALLKRVAVERP-GYW
SAHH_XANC8      -ELVVDDGGDVTLLIHKGYELENGSTWVDEPA----SSHEEGVIKALLKRVAVERP-GYW
SAHH_XANOM      -ELVVDDGGDVTLLIHKGYELENGSTWVDEPA----SSHEESVIKALLKRVAVERP-GYW
SAHH_XANOP      -ELVVDDGGDVTLLIHKGYELENGSTWVDEPA----SSHEESVIKALLKRVAVERP-GYW
SAHH_XANC5      -ELVVDDGGDVTLLIHKGYELENGSTWVDEPA----SSHEEGVIKALLKRVAVERP-GYW
SAHH_XANAC      -ELVVDDGGDVTLLIHKGYELENGSTWVDEPA----SSHEEGVIKALLKRVAVERP-GYW
SAHH_BACFR      -TVIVDDGGDATMMIHVGYEAENNAAVLDKEV----HAEDEIELNAILKKVLAEDK-ERW
SAHH_BACTN      -NVIVDDGGDATMMIHVGYDAENDAAVLDKEV----HAEDEIELNAILKKVLAEDK-TRW
SAHH_CHLL2      -NLIVDDGGDATLMIHLGYKIENNPELLEKVP----GNAEEKALYQQLREVYSEDT-QRW
SAHH_CHLPD      -HLIVDDGGDATLMIHLGYKIEIDPSLLDKTP----GNIEEKALFQQLREVYEEDS-QRW
SAHH_PELPB      -NLIVDDGGDATLMIILGYKIENNPELLEKAP----ANLEEKALYQQFREVFAEDS-QRW
SAHH_PELLD      -NLIVDDGGDATLMIILGYKIENNPSMLQNAG----GNAEERALFGQLKAIYEEDS-NRW
SAHH_CHLPM      -NLIVDDGGDATMMIILGYKVENNPSMFDKGG----SNAEEKALFAQLKSIYDEDS-TRW
SAHH_CHLCH      -NLIVDDGGDATLMIILGHKIENDPKMLDKTP----GNAEEKALYQQLREVFAEDN-QRW
SAHH_CHLP8      -NLIVDDGGDATLMIHLGYKIENDPSMLDKTP----GNAEERALFAQLKEVFAEDN-QRW
SAHH_CHLTE      -NLIVDDGGDATLMIHFGYKIENDPSMLDKTP----GNAEEKALLQQLKAVFAEDN-QRW
SAHH_THEAC      -DIIIDDGGDLTKIVH-----------------------------------------TER
SAHH_THEVO      -DIIIDDGGDLTKLVH-----------------------------------------TER
SAHH_HALSA      -TVTVDDGGDLVFRVH-----------------------------------------EDH
SAHH_HALWD      -TITIDDGMDMVYAIH-----------------------------------------EDH
SAHH_THEMA      -DFIIDDGGDLTVISH-----------------------------------------TER
SAHH_GLOVI      -QIIIDDGSDVVATMI-----------------------------------------KDR
SAHH_GLOC7      -NLIIDDGGDVTATLI-----------------------------------------QER
SAHH_NOSS1      -NIIIDDGSDVVATLV-----------------------------------------QER
SAHH_THEEB      -NIIIDDGCDVVATLV-----------------------------------------KER
SAHH_SYNY3      -NIIIDDGSDVVATLV-----------------------------------------QER
SIHH_METTH      -EILIDDGADMIFLVH-----------------------------------------RER
SAHH_AERPE      -DIVIDDGADLHVLLH-----------------------------------------EEM
SIHH_METKA      -DIIVDDGADCIARVH-----------------------------------------TEF
SAHH_PYRAE      -TITMDDGADLTATIHKIGHGVRDQ---------------------TIEYVLETAGSLDA
SAHH_SACS2      -NIVMDDGADLHAYIH------------------------------------------EK
SAHH_SULAC      -HVIMDDGGDLHAYVH-------------------------------------------E
SAHH_SULTO      -QIIMDDGGDLHAYVH-----------------------------------------ENM
SAHH_AQUAE      -DVVIDDGADLISTLH-----------------------------------------KEY
SAHH_THEKO      -NIIIDDGADMVSTVL-----------------------------------------KER
SAHH_PYRAB      -NIIIDDGADMVSLVH-----------------------------------------TER
SAHH_PYRFU      -NIIIDDGADMISLVH-----------------------------------------KER
SAHH_PYRHO      -NIIIDDGADMISLVH-----------------------------------------KER
SIHH_METAC      -DITIDDGADLIFKLH-----------------------------------------KER
SIHH_METMA      -DITIDDGADLIFKLH-----------------------------------------KER
SAHH_ARCFU      -DIVIDDGADLIFLLH-----------------------------------------GEM
SIHH_METJA      -DIVIDDGCDLIFLLH-----------------------------------------TKR
SIHH_METMP      -DIIIDDGADLIFLIH-----------------------------------------TER
                  . :*** *                                                  

SAHH_ACIAD      PTLLDHIHGITEETTTGVQRLLEMWKDGSLKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_HAHCH      PQMLDHIHGISEETTTGVHRLLDMMKKGELKVPAVNVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEE4      PAMLEKIHGVTEETTTGVHRLLDMLAKGELKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSE14      PAMLDKIHGVTEETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEU2      PAMLDKIHGVTEETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSESM      PAMLDKIHGVTEETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEFS      PAILDRVHGVTEETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEF5      PQVLDRVHGVTEETTTGVHRLLDMLAKGELKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEPF      PQVLDRVHGVTEETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEPW      PAVLDRVHGVTEETTTGVHRLLDMLAKGELKVPAINVNDSVTKSKNDNKYGCRHSLSDAI
SAHH_PSEP1      PQVLDRVHGVTEETTTGVHRLLDMLAKGELKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEPG      PQVLDRVHGVTEETTTGVHRLLDMLAKGELKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEU5      PQVLERVHGITEETTTGVHRLLDMLKGGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEMY      PQMLERIHGITEETTTGVHRLLDMLKAGTLKVPAINVNDAVTKSKNDNKYGCRHSLNDAI
SAHH_PSEAE      PQMLERIHGITEETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEA8      PQMLERIHGITEETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_PSEAB      PQMLERIHGITEETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAI
SAHH_STRAZ      TAMSSEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSKFDNKYGCRHSLIDGI
SAHH_STRGG      TQLASEIRGVTEETTTGVHRLYEMHRDGSLLFPAINVNDAVTKSKFDNKYGCRHSLIDGI
SAHH_STRAA      TQLASEIRGVTEETTTGVHRLYEMQRDGVLLFPAINVNDAVTKSKFDNKYGCRHSLIDGI
SAHH_STRAW      TQLASEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSKFDNKYGCRHSLIDGI
SAHH_STRCO      TQLASEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSKFDNKYGCRHSLIDGI
SAHH_CORDI      TAIAESVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGTRHSLIDGI
SAHH_COREF      TRLADSIKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGTRHSLIDGI
SAHH_CORGL      GKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGTRHSLIDGI
SAHH_CORGB      GKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGTRHSLIDGI
SAHH_MYCPA      TKISESIKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGCRHSLIDGI
SAHH_MYCLE      TKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCLB      TKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCBO      TKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCBP      TKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCBT      TKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCTU      TKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCTA      TKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCMM      TKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCUA      TKIAESVKGVTEETTTGVLRLYQFAEAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_NOCFA      TAIAESVRGVTEETTTGVLRLYQFAAAGELVFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCSJ      TKIAESVKGVTEETTTGVLRLYQFEAAGELPFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCSK      TKIAESVKGVTEETTTGVLRLYQFEAAGELPFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_MYCSS      TKIAESVKGVTEETTTGVLRLYQFEAAGELPFPAINVNDSVTKSKFDNKYGTRHSLIDGI
SAHH_PELCD      QRMATGLLGVSEETTTGVHRLYHMARNGELLFPAFNVNDSVTKSKFDNLYGCRESLIDGI
SAHH_BDEBA      AKEMKKIIGISEETTTGVHNLEVLVKQGKLKVPAININDSVTKSKFDNLYGCRESLADGI
SAHH_GRAFK      PELAEGIKGLSEETTTGVHRLYERMKKGTLPMPAINVNDSVTKSKFDNKYGCRESAVDAI
SAHH_FLAJ1      PELVAGIKGLSEETTTGVHRLYERVKAGTLPMPAININDSVTKSKFDNKYGCKESAVDAV
SAHH_FLAPJ      PHLVEGIKGLSEETTTGVHRLYERVKAGTLPMPAINVNDSVTKSKFDNKYGCKESAVDAV
SAHH_RHOBA      PELLDNIYGISEETTAGVHRLEVLNKSGKLRVPSINVNDSATKSKFDNLYGCRESLADGV
SAHH_DESAD      TAIAEKVRGVSEETTTGVHRLYQMQEAGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_DESAG      TRVAAKVRGVSEETTTGVHRLYHMEKDGSLLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_DESVH      QRVAAKVRGVSEETTTGVHRLYQLEQEGKLLFPAINVNDAVTKSKFDNLYGCRESLADGI
SAHH_DESVV      QRVAAKVRGVSEETTTGVHRLYQLEQEGKLLFPAINVNDAVTKSKFDNLYGCRESLADGI
SAHH_DESVM      QRVAARVRGVSEETTTGVHRLYQLEQEGKLLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_GRABC      PEMLKDVRGLSEETTTGVHRLWEMAKAGKLLTPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_ZYMMO      TKTAKAIKGVSEETTTGVHRLYEIAKKGELLFPAINVNDSVTKSKFDNLYGCKESLVDAI
SAHH_NOVAD      TMSVAHIKGVSEETTTGVHRLYQIAKDGKLPFPAINVNDSVTKSKFDNLYGCKESLVDAI
SAHH_SPHAL      TKTVKAIKGVSEETTTGVHRLYHIAKKGELPFPAINVNDSVTKSKFDNLYGCKESLVDAI
SAHH_ROSDO      TKVRDQIKGVSEETTTGVHRLYDLVKQGQLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHOCB      TQQRAAIKGVSEETTTGVHRLYDLHKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHOSH      TKQRDAIKGVSEETTTGVHRLYDLHKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BARQU      TRQRTAIKGVSEETTTGVLRLYQLQKEGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BARHE      TRQRAAIKGISEETTTGVHRLHQLQKEGLLPFPAININDSVTKSKFDNKYGCRESLVDGI
SAHH_BART1      TRQRAAIKGVSEETTTGVNRLYQLQKEGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_AGRFC      TKQRDALKGVTEETTTGVHRLYDLAKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHIME      TRQRDAIKGVTEETTTGVNRLYQLQAKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_SINMW      TKQRDAIKGVTEETTTGVNRLYQLQAKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_AGRRK      TKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHILW      TKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHIL3      TKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHIEC      TKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHIE6      TKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_CHESB      TRQRAAIRGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_RHILO      TKQKAAIRGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_OCHA4      TRQRDAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUO2      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGV
SAHH_BRUAB      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUA2      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUA1      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUC2      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUSU      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUSI      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUME      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_BRUMB      TKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI
SAHH_MARMM      AKAKAAIQGVSEETTTGVMRLYQMQKRGELPFPAINVNDSVTKSKFDNRYGCRESLVDAI
SAHH_HYPNA      KKTKAGVRGVSEETTTGVNRLYQLEKRGELPFPAINVNDSVTKSKFDNKYGCKESLVDAI
SAHH_CAUVC      SAIRAAIGGVSEETTTGVHRLYQMAQKDELPFPAINVNDSVTKSKFDNLYGCRESLVDAI
SAHH_RHOPA      ATLAKNIKGVSEETTTGVHRLYDMEKAGKLLFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_RHOPT      ATLAKNIKGVSEETTTGVHRLYDMEKAGKLLFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_RHOPS      AEIAKNIRGVSEETTTGVHRLYDMQKAGTLLWPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_RHOP2      AEIAKNIRGVSEETTTGVHRLYDMQKAGTLLWPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BRADU      AEIAKSIKGVSEETTTGVHRLYDMQKAGTLLWPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BRASB      AAIAASIKGVSEETTTGVHRLYDMQKAGTLLWPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_METC4      AGLADSIKGVSEETTTGVHRLYNLAKEGKLLFPAINVNDSVTKSKFDNLYGCKESLVDGI
SAHH_METEP      AGLADSIKGVSEETTTGVHRLYNLAKEGKLLFPAINVNDSVTKSKFDNLYGCKESLVDGI
SAHH_METPB      AGLADSIKGVSEETTTGVHRLYNLAKEGKLLFPAINVNDSVTKSKFDNLYGCKESLVDGI
SAHH_METNO      AGLAESIKGVSEETTTGVHRLYLLAREGKLLFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_METS4      AGLAESIKGVSEETTTGVHRLYILAKEGKLLFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_PROMP      SRIKGNIIGVTEETTTGVARLYQLQKQNALPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_PROM9      SRIKSNIIGVTEETTTGVARLYQLQKQNALPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_PROM2      SRIKSNIIGVTEETTTGVARLYQLQKQKSLPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_PROM0      SRIKSNIIGVTEETTTGVARLYQLQKQNALPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_PROM3      SRIKSNIQGVTEETTTGVARLYQMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_PROMM      SRIKSSIQGVTEETTTGVARLYQMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_SYNS3      SRIKAEIQGVTEETTTGVARLYKMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_SYNS9      SRTKAAIQGVTEETTTGVARLYKMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_SYNSC      SRTKAQIQGVTEETTTGVARLYKMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_SYNPW      SRTKAQIQGVTEETTTGVARLYKMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_SYNPX      SRTKAEIQGVTEETTTGVARLYKMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_PROMA      SRIKKIILGVTEETTTGVARLYQMQKNGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_PROM4      SRIKSSIQGVTEETTTGVARLYQMQANGSLPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_MYXXD      TRKSAKILGVTEETTTGVHRLQEMSAKGTLLFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_LEPCP      SRKGAQIIGVTEETTTGVHRLKEMSAAGTLLFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_ACISJ      SRKSAQIIGVTEETTTGVHRLKEMSAKGTLLFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_ACIET      SRKSAQIIGVTEETTTGVHRLKEMSAKGTLMFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_DELAS      TRKSAHIIGVTEETTTGVHRLNEMSAKGTLKFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_METPP      TRKSAQIIGVTEETTTGVHRLNEMSAKGTLLFRAINVNDSVTKSKFDNLYGCRESLVDSI
SAHH_ACIAC      TRKSAEIIGVTEETTTGVHRLNEMSAKGTLLFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_VARPS      TRKSAEIIGVTEETTTGVHRLNEMSAKGTLLFRAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_HERAR      SKRLPQILGVTEETTTGVHRLYQMHKEGKLAFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_JANMA      SKRLPQILGVTEETTTGVHRLYQMHKEGKLAFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BORPD      STRLAQIRGVTEETTTGVHRLYQMAQKGELAFAAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BORBR      STRLAQIKGVTEETTTGVHRLYQMSQKGELAFAAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BORPA      STRLAQIKGVTEETTTGVHRLYQMSQKGELAFAAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BORPE      STRLAQIKGVTEETTTGVHRLYQMSQKGELAFAAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_POLNS      STRLEKVKGVTEETTTGVHRLYQMFARGDLKFPAINVNDSVTKSKFDNLYGCRESLVDAI
SAHH_POLAQ      STRLEKVKGVTEETTTGVHRLYQMFAKGELKFPAINVNDSVTKSKFDNLYGCRESLVDAI
SAHH_AROAE      SVRLAAIRGVTEETTTGVHRLYQMFERGELKFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_RALPJ      SRNLDAIKGVTEETTTGVHRLYQMAQRGELRFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_RALSO      SRNLDAIKGVTEETTTGVHRLYQMAQRGELRFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_CUPMC      SRNLAAIRGVTEETTTGVHRLYQMAQKGELKFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_CUPPJ      SRNLAAIRGVTEETTTGVHRLYQMAQKGDLKFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_CUPTR      SRNLAAIRGVTEETTTGVHRLYQMAQKGELRFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_CUPNH      SRNLAAIRGVTEETTTGVHRLYQMAQKGELRFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_GEOSL      SKTAAAIKGVTEETTTGVHRLYQMHEKGKLKFPAINVNDSVTKSKFDNIYGCRESLVDGI
SAHH_NITEU      SRNLAAIRGVTEETTTGVHRLYEMEKKGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_NITEC      SRNLAGIRGVTEETTTGVHRLYEMEKKGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_METCA      SRIQAGIKGVTEETTTGVHRLYEMQAKGRLPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_CHRVO      SKRLEHIQGVTEETTTGVHRLYQLEKDGHLPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURMA      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURM9      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURM7      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURMS      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURPS      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURP0      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURP1      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURP6      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_BURTA      SKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLVDGI
SAHH_PARP8      STRLAHIKGVTEETTTGVHRLYQMEKEGRLPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_PARPJ      STRLAHIQGVTEETTTGVHRLYQMEKEGRLPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_PARXL      STRLAHIKGVTEETTTGVHRLYQMEKEGRLPFPAINVNDSVTKSKFDNLYGCRESLVDGI
SAHH_HALHL      PDMMKDIYGVSEETTTGVHRLYEMSRKGELGMPAFNVNDSVTKSKFDNLYGCRESLVDSI
SAHH_COXB1      PELCQNIRGVSEETTTGVHRLYRMLKEGSLKFPAINVNDSVTKSKFDNLYGCRESLIDSI
SAHH_COXBU      PELCQNIRGVSEETTTGVHRLYRMLKEGSLKFPAINVNDSVTKSKFDNLYGCRESLIDSI
SAHH_COXB2      PELCQNIRGVSEETTTGVHRLYRMLKEGSLKFPAINVNDSVTKSKFDNLYGCRESLIDSI
SAHH_COXBN      PELCQNIRGVSEETTTGVHRLYRMLKEGSLKFPAINVNDSVTKSKFDNLYGCRESLIDSI
SAHH_LEPBJ      PKLLSEIRGISEETTTGVKSLYKLLKKGELKVPAFNVNDSVTKSKFDNLYGCRESLADGI
SAHH_LEPBL      PKLLSEIRGISEETTTGVKSLYKLLKKGELKVPAFNVNDSVTKSKFDNLYGCRESLADGI
SAHH_LEPIN      PKLLSEIRGISEETTTGVKSLYKLLKKGELKVPAFNVNDSVTKSKFDNLYGCRESLADGI
SAHH_LEPIC      PKLLSEIRGISEETTTGVKSLYKLLKKGELKVPAFNVNDSVTKSKFDNLYGCRESLADGI
SAHH_SOLUE      HKMVAEWRGVSEETTTGVHRLYKMQEQGKLLVPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_XYLFM      TRVVNDWKGVSEETTTGVHRLYQIAATGRLLVPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XYLFA      TRVVNDWKGVSEETTTGVHRLYQIAATGRLLVPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XYLF2      TRVVNDWKGVSEETTTGVHRLYQIAATGRLLVPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XYLFT      TRVVNDWKGVSEETTTGVHRLYQIAATGRLLVPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XANCP      ARVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XANC8      ARVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XANOM      ARVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XANOP      ARVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XANC5      GRVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_XANAC      GRVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
SAHH_BACFR      HRVAAEVRGVSEETTTGVHRLYQMQEEGKLLFPAFNVNDSVTKSKFDNLYGCRESLADGI
SAHH_BACTN      HRVAEEMRGVSEETTTGVHRLYQMQEEGKLLFPAFNVNDSVTKSKFDNLYGCRESLADGI
SAHH_CHLL2      HKVAAEMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_CHLPD      HNVAAEMKGVSEETTTGVHRLYQMMEKEELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_PELPB      HKVAAEMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_PELLD      HKVAKEMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_CHLPM      HKVAADMKGVSEETTTGVHRLYHMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_CHLCH      HKVAADMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_CHLP8      HKVAAGMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_CHLTE      HKVAAGMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESLADGI
SAHH_THEAC      KDLAKNILGGNEETTTGVQRLRAMERSGVLLFPMFDVNDANMKHLFDNRYGTGQSTLDGI
SAHH_THEVO      KDLSKNIMGGNEETTTGVVRLKAMEKAGVLLFPMFDVNDANMKHLFDNRYGTGQSTLDGI
SAHH_HALSA      PELIDTIIGGTEETTTGVHRLRAMDDDDALEYPVFAVNDTPMKRLFDNVHGTGESALANI
SAHH_HALWD      PDLLDTIIGGAEETTTGVHRLRAMDEDDELQYPVFAVNDTPMKRLFDNVHGTGESALATI
SAHH_THEMA      EEVLENLKGVSEETTTGVRRLKALEETGKLRVPVIAVNDSKMKYLFDNRYGTGQSTWDAI
SAHH_GLOVI      PDLIAGVIGTTEETTTGIVRLKAMLAAGVLTFPAMAVNDAETKHFFDNRYGTGQSTLDGI
SAHH_GLOC7      KDQIADIIGTTEETTTGIVRLAAMLKDGVLSFPAMNVNDADTKHFFDNRYGTGQSTLDGI
SAHH_NOSS1      QHQIADLIGTTEETTTGIVRLRAMFKDGVLTFPAVNVNDADTKHFFDNRYGTGQSTLDGI
SAHH_THEEB      QHQISDIIGTTEETTTGIVRLKAMFRDGVLTFPAINVNDADTKHFFDNRYGTGQSTLDGI
SAHH_SYNY3      QHQLSDIIGTTEETTTGIVRLRAMFNDGVLTFPAMNVNDADTKHFYDNRYGTGQSTLDGI
SIHH_METTH      PELLDGIIGACEETTTGINRLRAMAADGALKFPVMAVNDAYTKYLFDNRYGTGQSTFDSI
SAHH_AERPE      RSVGEKVWGGTEETTTGVIRLRALEREGRLLYPVIAVNDALTKFMFDNRYGTGQSTVDGV
SIHH_METKA      PDLAERVIGATEETTTGVNRLHAMHREGVLKFPVIAVNDAKTKYLMDNRYGTGQSALDGL
SAHH_PYRAE      AGLFSRIRGGTEETTTGVIRLKALKKSGKLLYPIIAVNESYTKYLFDNRYGTGQSTWDGV
SAHH_SACS2      VSSKLDIYGGTEETTTGVIRLKAMEKDGVLKYPLVAVNNAYTKYLFDNRYGTGQSAIDGI
SAHH_SULAC      NNLTSKIVGGTEETTTGVIRLKAMEEEKVLKYPVIAVNNAFTKYLFDNRIGTGQSTIDGI
SAHH_SULTO      PQL--KLFGGTEETTTGVIRLKAMEEQGVLRYPVIAVNNAFTKYLFDNRIGTGQSTIDGI
SAHH_AQUAE      PGLAEKVLGGMEETTTGVIRLRAMAEQGVLKFPIIAVNDAYTKHMFDNRYGTGQSTIDGI
SAHH_THEKO      QELIPEIWGASEETTTGVIRLRAMEKDGVLKFPIIAVNDSYTKYLFDNRYGTGQSTWDGI
SAHH_PYRAB      KELLDEIWGASEETTTGVIRLRAMERDKVLRFPVIAVNDSYMKYLFDNRYGTGQSTWDGI
SAHH_PYRFU      QEMLDEIWGGSEETTTGVIRLRAMEKAGILKFPVIAVNDSYMKYLFDNRYGTGQSTWDGI
SAHH_PYRHO      QELLDEIWGGSEETTTGVIRLRAMERDGVLRFSVIAVNDSYMKYLFDNRYGTGQSTWDGV
SIHH_METAC      TDLLPKILGGCEETTTGVHRLHAMEKEGALKMPVIAVNDAMTKYLFDNRYGTGQSAWDGI
SIHH_METMA      QEMLAKILGGCEETTTGVHRLHAMEKDGALKMPVIAVNDAMTKYLFDNRYGTGQSAWDGI
SAHH_ARCFU      ESYAEKVKGASEETTTGVIRLRAMEREGVLKFPVIAVNDAYTKYLFDNRYGTGQSAIDGV
SIHH_METJA      TELLDNIMGGCEETTTGIIRLKAMEKEGALKFPVMDVNDAYTKHLFDNRYGTGQSALDGI
SIHH_METMP      TELIGKIMGGCEETTTGIIRLKSMAEEGALKFPVVNVNDAYTKHLFDNRYGTGQSAMDGI
                        *  ****:*:  *        *    . :*::  *   **  *   *    :

SAHH_ACIAD      KRATDMLLSGRRALVIGYGDVGKGSAQSLRQEGM-IVRVTEVDPICAMQACMDGYEVVSP
SAHH_HAHCH      KRATDHLLAGKKALVIGYGDVGKGSAASLRQEGM-IVKISEIDPICAMQACMDGYEVVSP
SAHH_PSEE4      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVTEVDPICAMQACMDGFEVVSP
SAHH_PSE14      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVTEVDPICAMQACMDGFELVSP
SAHH_PSEU2      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVTEVDPICAMQACMDGFELVSP
SAHH_PSESM      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVTEVDPICAMQACMDGFELVSP
SAHH_PSEFS      KRGTDHLLSGKQALVIGYGDVGKGSSQSLRQEGM-IVKVSEVDPICAMQACMDGFEVVSP
SAHH_PSEF5      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVSEVDPICAMQACMDGFELVSP
SAHH_PSEPF      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVSEVDPICAMQACMDGFELVSP
SAHH_PSEPW      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVTEVDPICAMQACMDGFELVSP
SAHH_PSEP1      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVSEVDPICAMQACMDGFELVSP
SAHH_PSEPG      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVTEVDPICAMQACMDGFELVSP
SAHH_PSEU5      KRATDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVSEVDPICAMQACMDGFELVSP
SAHH_PSEMY      KRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGM-IVKVSEIDPICAMQACMDGFELVSP
SAHH_PSEAE      KRGTDHLLSGKQALVIGYGDVGKGSSQSLRQEGM-IVKVAEVDPICAMQACMDGFEVVSP
SAHH_PSEA8      KRGTDHLLSGKQALVIGYGDVGKGSSQSLRQEGM-IVKVAEVDPICAMQACMDGFEVVSP
SAHH_PSEAB      KRGTDHLLSGKQALVIGYGDVGKGSSQSLRQEGM-IVKVAEVDPICAMQACMDGFEVVSP
SAHH_STRAZ      NRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGA-RVIITEIDPICALQAAMDGYQVATL
SAHH_STRGG      NRATDVLIGGKTAVVFGYGDVGKGCAESLRGQGA-RVIITEIDPICALQAAMDGYQVATL
SAHH_STRAA      NRATDVLIGGKTAVVFGYGDVGK-AARSLRGQGA-RVIVTEIDPICALQAAMDGYQVTTL
SAHH_STRAW      NRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGA-RVIVTEIDPICALQAAMDGYQVTTL
SAHH_STRCO      NRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGA-RVIITEIDPICALQAAMDGFQVTTL
SAHH_CORDI      NRATDMLMGGKNVLICGYGDVGKGCAEAMAGQGA-RVKVTEADPINALQALMDGFPVVHV
SAHH_COREF      NRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGA-RVRVTEADPINALQALMDGYSVVTV
SAHH_CORGL      NRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGA-RVKVTEADPINALQALMDGYSVVTV
SAHH_CORGB      NRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGA-RVKVTEADPINALQALMDGYSVVTV
SAHH_MYCPA      NRGTDVLIGGKNVLVCGYGDVGKGSVESLAGQGA-RVTVTEIDPINALQALMEGYNVKRV
SAHH_MYCLE      NRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGA-RVTITEIDPINALQALMEGFDVKRV
SAHH_MYCLB      NRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGA-RVTITEIDPINALQALMEGFDVKRV
SAHH_MYCBO      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_MYCBP      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_MYCBT      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_MYCTU      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_MYCTA      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_MYCMM      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_MYCUA      NRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGA-RVSVTEIDPINALQAMMEGFDVVTV
SAHH_NOCFA      NRGTDVLIGGKKVLICGYGDVGKGCAESLAGQGA-RVQVTEIDPINALQALMDGYDVVTV
SAHH_MYCSJ      NRGTDVLIGGKKVLICGYGDVGKGCAESLAGQGA-RVQVTEIDPINALQALMDGFDVVTV
SAHH_MYCSK      NRGTDVLIGGKKVLICGYGDVGKGCAESLAGQGA-RVQVTEIDPINALQALMDGFDVVTV
SAHH_MYCSS      NRGTDVLIGGKKVLICGYGDVGKGCAESLAGQGA-RVQVTEIDPINALQALMDGFDVVTV
SAHH_PELCD      KRATDVMIAGKKCVVLGYGDVGKGCAQAFKGMGA-LVSVTEVDPICALQAAMEGFAVVDM
SAHH_BDEBA      KRATDVMVAGKICVVAGYGDVGKGSAHSLRGLGA-RVLVTEIDPICALQAAMEGFEVTTM
SAHH_GRAFK      RRATDVMLAGKRVVVCGYGDVGKGTAQSFKGAGS-IVTVTEIDPICALQAAMDGFEVKQL
SAHH_FLAJ1      RRATDLMLAGKRVVVCGYGDVGKGTAASFRGAGS-IVTVTEIDPICALQAAMDGYEVKKL
SAHH_FLAPJ      RRATDIMLAGKRVVVCGYGDVGKGTAASFRGAGS-IVTVTEIDPICALQAAMDGFEVKKL
SAHH_RHOBA      KRATDVMLAGKVAVVCGYGDVGKGCAHSLKSYGC-RVLVTEIDPINALQAAMEGFEVTTM
SAHH_DESAD      KRATDVMIAGKVVVVVGYGDVGKGCAQSMRGFGA-RVLVTEIDPICALQAAMEGFEVCTM
SAHH_DESAG      KRATDVMIAGKTVVVLGYGDVGKGCAHSMRGFGA-RVLVTEIDPICALQAAMEGFEVVTM
SAHH_DESVH      KRATDVMVAGKVVVVAGYGDVGKGCAQSMRGFGA-RVLVTEIDPICALQAAMEGYEVTTM
SAHH_DESVV      KRATDVMVAGKVVVVAGYGDVGKGCAQSMRGFGA-RVLVTEIDPICALQAAMEGYEVTTM
SAHH_DESVM      KRATDVMVAGKVVVVAGYGDVGKGCAQSMRGFGA-RVLVTEIDPICALQAAMEGYEVTTM
SAHH_GRABC      RRGTDVMMAGKIAVVAGFGDVGKGSAASLRNAGC-RVLVTEIDPICALQAAMEGYEVVTM
SAHH_ZYMMO      RRATDVMLAGKVACVAGFGDVGKGSAASLRNGGA-RVLVTEVDPICALQAAMEGYEVVTL
SAHH_NOVAD      RRATDVMLAGKVACVAGFGDVGKGSAASLRQGGA-RVMVTEIDPICALQAAMEGYEVVTM
SAHH_SPHAL      RRGTDVMLAGKVATVAGFGDVGKGSAQSLRNGGA-RVLVTEIDPICALQAAMEGFEVVTM
SAHH_ROSDO      RRATDTMMAGKVAVVMGYGDVGKGSAASLRGAGA-RVKVTEVDPICALQAAMDGFEVVLL
SAHH_RHOCB      RRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGA-RVKVTEVDPICALQAAMDGFEVVVL
SAHH_RHOSH      RRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGA-RVKVTEVDPICALQAAMDGFEVVVL
SAHH_BARQU      RRGTDVMIAGKTAIVCGYGNVGKGSAASLSGAGA-RVKITEIDPICALQAAMDGYEVVTL
SAHH_BARHE      RRATDVMIAGKTAIVCGYGDVGKGSAASLSGAGA-RVKVTEIDPICALQAAMDGYEVVNL
SAHH_BART1      RRGTDVMIAGKTAIVCGYGDVGKGSAASLSGAGA-RVKVTEIDPICALQAAMDGYEVVNL
SAHH_AGRFC      RRATDVMMAGKVAVVCGYGDVGKGSAASLQGAGA-RVKVTEIDPICALQAAMDGFEVVRL
SAHH_RHIME      RRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEVDPICALQAAMDGYEVVQL
SAHH_SINMW      RRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEVDPICALQAAMDGYEVVQL
SAHH_AGRRK      RRATDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEVDPICALQAAMDGYEVVLL
SAHH_RHILW      RRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEADPICALQAAMDGYEVVLL
SAHH_RHIL3      RRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEADPICALQAAMDGYEVVLL
SAHH_RHIEC      RRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEADPICALQAAMDGYEVVLL
SAHH_RHIE6      RRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGA-RVKVTEADPICALQAAMDGYEVVLL
SAHH_CHESB      RRATDVMMAGKVAIVCGYGDVGKGSAQSLAGAGA-RVKVTEADPICALQAAMDGFEVVTL
SAHH_RHILO      RRGTDTMMAGKVAVVCGYGDVGKGSSASLKGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_OCHA4      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUO2      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUAB      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUA2      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUA1      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUC2      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUSU      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUSI      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUME      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_BRUMB      RRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGA-RVKVTEVDPICALQAAMDGFEVVTL
SAHH_MARMM      RRGTDVMMAGKKALVFGYGDVGKGSAESLAGAGA-RVYVTEIDPICALQACMDGFEVVRA
SAHH_HYPNA      RRGTDVMMAGKKAFVAGYGDVGKGSAASLAGSGA-RVGVSEVDPICALQAAMDGFEVLTM
SAHH_CAUVC      RRGTDVMLSGKVAVVCGYGDVGKGSAASLRQGGA-RVIVTEVDPICALQAAMEGYEVQTL
SAHH_RHOPA      RRGTDVMLSGKVAMVAGFGDVGKGSAASLRQAGC-RVMVSEVDPICALQAAMEGYQVVTM
SAHH_RHOPT      RRGTDVMLSGKVAMVAGFGDVGKGSAASLRQAGC-RVMVSEVDPICALQAAMEGYQVVTM
SAHH_RHOPS      RRGTDVMMSGKVAMVAGFGDVGKGSAASLRQAGA-RVMVSEVDPICALQAAMEGYQVVTM
SAHH_RHOP2      RRGTDVMLSGKVAMVAGFGDVGKGSAASLRQAGC-RVMVSEVDPICALQAAMEGYQVVTM
SAHH_BRADU      RRGTDVMMSGKVAMVAGFGDVGKGSAASLRQAGC-RVMVSEVDPICALQAAMEGYEVVTM
SAHH_BRASB      RRGTDVMMSGKVAMVAGFGDVGKGSAASLRQAGC-RVLVSEIDPICALQAAMEGYEVVTM
SAHH_METC4      RRGTDVMMAGKVAMVAGFGDVGKGSAASLRNAGC-RVLVSEIDPICALQAAMEGYEVVTM
SAHH_METEP      RRGTDVMMAGKVAMVAGFGDVGKGSAASLRNAGC-RVLVSEIDPICALQAAMEGYEVVTM
SAHH_METPB      RRGTDVMMAGKVAMVAGFGDVGKGSAASLRNAGC-RVLVSEIDPICALQAAMEGYEVVTM
SAHH_METNO      RRGTDVMMAGKVAMVAGFGDVGKGSAASLRNAGC-RVLVSEVDPICALQAAMEGYEVTTM
SAHH_METS4      RRGTDVMMAGKVAMVAGFGDVGKGSAASLRNAGC-RVMVSEVDPICALQAAMEGYEVTTM
SAHH_PROMP      KRATDVMIAGKVALVMGFGDVGKGSAQSLRGLGA-IVKVAEVDPICALQAAMEGFSVVTL
SAHH_PROM9      KRATDVMIAGKVALVMGFGDVGKGSAQSLRGLGA-IVKVAEVDPICALQAAMEGFSVVTL
SAHH_PROM2      KRATDVMIAGKVALVIGFGDVGKGSAQSLRGLGA-IVKVAEVDPICALQAAMEGYSVVRL
SAHH_PROM0      KRATDVMIAGKTALVMGFGDVGKGSAQSLRGLGA-IVKVAEIDPICALQAAMEGYSVVRL
SAHH_PROM3      KRATDVMVAGKVALVMGYGDVGKGSAQSLRGLGA-TVMIAEIDPICALQAAMEGYRVVRL
SAHH_PROMM      KRATDVMVAGKVALVMGYGDVGKGSAQSLRGLGA-TVMIAEIDPICALQAAMEGYRVVRL
SAHH_SYNS3      KRATDVMVAGKQALVVGYGDVGKGSAQSLRGLGA-TVCIAEVDPICALQAAMEGYRVVRL
SAHH_SYNS9      KRATDVMVAGKQALVVGYGDVGKGSAQSLRGLGA-TVCIAEVDPICALQAAMEGYRVVRL
SAHH_SYNSC      KRATDVMVAGKQALVIGYGDVGKGSAQSLRGLGA-TVCIAEVDPICALQAAMEGYRVVRL
SAHH_SYNPW      KRATDVMVAGKQALVMGYGDVGKGSAQSLRGLGA-TVCIAEVDPICALQAAMEGYRVVRL
SAHH_SYNPX      KRATDVMVAGKQALVMGYGDVGKGSAQSLRGLGA-TVCIAEVDPICALQAAMEGYRVVRL
SAHH_PROMA      KRATDVMVAGKVALVIGYGDVGKGSAQSLRGLGA-TVMIAEIDPICALQAAMEGYRVVRL
SAHH_PROM4      KRATDVMVAGKIALVIGYGDVGKGSAQSLRGLGA-TVMIAEIDPICALQASMEGYRVVRL
SAHH_MYXXD      KRATDVMVAGKIAVVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_LEPCP      KRATDVMIAGKVACVAGYGDVGKGSAQALRALSA-QVWVTEIDPINALQAAMEGYKVVTM
SAHH_ACISJ      KRATDVMIAGKVAVVAGYGDVGKGSAQALRALSA-QVWVTEIDPINALQAAMEGFKVVTM
SAHH_ACIET      KRATDVMIAGKVAVVCGYGDVGKGSAQALRALSA-QVWVTEIDPINALQAAMEGFKVVTM
SAHH_DELAS      KRATDVMIAGKVAVVAGYGDVGKGCAQALRALSA-QVWVTEIDPINALQAAMEGYKVVTM
SAHH_METPP      KRATDVMIAGKVACVAGYGDVGKGSAQALRALSA-QVWVTEIDPINALQAAMEGYKVVTM
SAHH_ACIAC      KRATDVMIAGKVALVAGYGDVGKGCAQALAALRA-QVWVTEIDPINALQAAMEGYKVVTM
SAHH_VARPS      KRATDVMIAGKVACVAGYGDVGKGSAQALRALSA-QVWVTEIDPINALQAAMEGYKVVTM
SAHH_HERAR      KRATDVMIAGKVAVIAGYGDVGKGSAQAMRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_JANMA      KRATDVMIAGKVAVIAGYGDVGKGSAQAMRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_BORPD      KRATDVMVAGKIAVVAGYGDVGKGCAQALAALRA-QVWVTEIDPICALQAAMEGYKVVTM
SAHH_BORBR      KRATDVMVAGKIAVVAGYGDVGKGCAQALAALRA-QVWVTEIDPICALQAAMEGFKVVTM
SAHH_BORPA      KRATDVMVAGKIAVVAGYGDVGKGCAQALAALRA-QVWVTEIDPICALQAAMEGFKVVTM
SAHH_BORPE      KRATDVMVAGKIAVVAGYGDVGKGCAQALVALRA-QVWVTEIDPICALQAAMEGFKVVTM
SAHH_POLNS      KRATDVMVAGKVAVVCGYGDVGKGSAQALRALSA-QVWVTEVDPICALQAAMEGYRVVTM
SAHH_POLAQ      KRATDVMVAGKVAVVCGYGDVGKGSAQALRALSA-QVWVTEVDPICALQAAMEGYRVVTM
SAHH_AROAE      KRATDVMVAGKVAVVCGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_RALPJ      KRATDVMIAGKVAIVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_RALSO      KRATDVMIAGKVAVVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_CUPMC      KRATDVMIAGKIAVVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_CUPPJ      KRATDVMIAGKIAIVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_CUPTR      KRATDVMIAGKIAVVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_CUPNH      KRATDVMIAGKVAIVAGYGDVGKGSAQALRALSA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_GEOSL      KRATDVMIAGKVAVICGYGEVGKGCAQAMRGLQA-QVWVTEIDPICALQAAMEGYRVVTM
SAHH_NITEU      KRATDVMIAGKIAVVCGYGDVGKGCAQSLRGLGA-TVWITEIDPICALQAAMEGYRVVTM
SAHH_NITEC      KRATDVMIAGKIAVICGYGDVGKGCAQSLRGLGA-TVWITEIDPICALQAAMEGYRVVTM
SAHH_METCA      KRATDVMIAGKIAVVLGYGDVGKGCAQSLRGLGA-TVWITEIDPICALQAAMEGYRVVTM
SAHH_CHRVO      KRATDVMVAGKVAVVLGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVRM
SAHH_BURMA      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURM9      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURM7      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURMS      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURPS      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURP0      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURP1      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURP6      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_BURTA      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_PARP8      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_PARPJ      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_PARXL      KRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGA-TVWVTEIDPICALQAAMEGYRVVTM
SAHH_HALHL      KRATDVMIAGKVAVVAGFGDVGKGSAQSLRGLGA-QVWVTEVDPICALQASMDGYKVVTM
SAHH_COXB1      KRATDVMIAGKRVVVCGYGDVGKGCAQSLRAYGA-TVYITEIDPICALQAAMEGYRVVTM
SAHH_COXBU      KRATDVMIAGKRVVVCGYGDVGKGCAQSLRAYGA-TVYITEIDPICALQAAMEGYRVVTM
SAHH_COXB2      KRATDVMIAGKRVVVCGYGDVGKGCAQSLRAYGA-TVYITEIDPICALQAAMEGYRVVTM
SAHH_COXBN      KRATDVMIAGKRVVVCGYGDVGKGCAQSLRAYGA-TVYITEIDPICALQAAMEGYRVVTM
SAHH_LEPBJ      KRATDVMLAGKVALVCGFGDVGKGSAASLRNFGA-RVIVTEIDPICALQASMEGYQVLRV
SAHH_LEPBL      KRATDVMLAGKVALVCGFGDVGKGSAASLRNFGA-RVIVTEIDPICALQASMEGYQVLRV
SAHH_LEPIN      KRATDVMLAGKVALVCGFGDVGKGSAASLRNFGA-RVIVTEIDPICALQASMEGYQVLRV
SAHH_LEPIC      KRATDVMLAGKVALVCGFGDVGKGSAASLRNFGA-RVIVTEIDPICALQASMEGYQVLRV
SAHH_SOLUE      KRATDVMVAGKVAVICGYGDVGKGSAHSLRGMGA-RVIVTEIDPINALQAAMEGFEVTTI
SAHH_XYLFM      KRAMDVMLAGKLAVVCGYGDVGKGSAHSLRAYGA-RVIVTEIDPICALQAAMEGFEVRTV
SAHH_XYLFA      KRAMDVMLAGKLAVVCGYGDVGKGSAHSLRAYGA-RVIVTEIDPICALQAAMEGFEVTTV
SAHH_XYLF2      KRAMDVMLAGKLAVVCGYGDVGKGSAHSLRAYGA-RVIVTEIDPICALQAAMEGFEVTTV
SAHH_XYLFT      KRAMDVMLAGKLAVVCGYGDVGKGSAHSLRAYGA-RVIVTEIDPICALQAAMEGFEVTTV
SAHH_XANCP      KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGA-RVIVTEIDPICALQASMEGFEVNTI
SAHH_XANC8      KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGA-RVIVTEIDPICALQASMEGFEVNTI
SAHH_XANOM      KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGA-RVVVTEIDPICALQASMEGFEVNTI
SAHH_XANOP      KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGA-RVVVTEIDPICALQASMEGFEVNTI
SAHH_XANC5      KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGA-RVIVTEIDPICALQASMEGFEVNTI
SAHH_XANAC      KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGA-RVIVTEIDPICALQASMEGFEVNTI
SAHH_BACFR      KRATDVMIAGKVVVVCGYGDVGKGCSHSMRSYGA-RVLVTEVDPICALQAAMEGFEVVTM
SAHH_BACTN      KRATDVMIAGKVVVVCGYGDVGKGCSHSMRSYGA-RVLVTEVDPICALQAAMEGFEVVTM
SAHH_CHLL2      KRATDVMIAGKVVVVLGYGDVGKGCAHSMRTYGA-RVIVTEIDPICALQASMEGFEVTTM
SAHH_CHLPD      KRATDVMVAGKVVVVLGYGDVGKGSARSMRAYGA-RVIVTEIDPICALQAAMEGYEVNTM
SAHH_PELPB      KRATDVMVAGKVVVVLGYGDVGKGSARSMRAYGA-RVIVTEIDPICALQAAMEGYEVSTM
SAHH_PELLD      KRATDVMIAGKVAVVLGYGDVGKGCAHSMRSYGA-RVIVTEIDPICALQAAMEGFEVTTM
SAHH_CHLPM      KRATDVMIAGKVAVVLGYGDVGKGCAHSMRSYGA-RVIVTEIDPICALQAAMEGFEVTTM
SAHH_CHLCH      KRATDVMIAGKVTVVLGYGDVGKGCAHSMRSYGA-RVIVTEIDPICALQAAMEGFEVATM
SAHH_CHLP8      KRATDVMIAGKVAVVLGYGDVGKGCAHSMRSYGA-RVIVTEIDPICALQAAMEGFQVTTI
SAHH_CHLTE      KRATDVMIAGKVVVVLGYGDVGKGCAHSMRSYGA-RVIVTEIDPICALQAAMEGFEVTTM
SAHH_THEAC      MNATNLLIAGRTVVVAGYGYCGRGIAMRLKGMGA-NVIVTEIDPIKANEAIMDGFQVRRM
SAHH_THEVO      MNSTNLLIAGRNVVVAGYGYCGRGIAMRLKGMGA-NVIVTEIDPIKANEAIMDGFQVRRM
SAHH_HALSA      AMTTNLSWAGKDVVVAGYGDCGRGVAKKAAGQNA-NVIVTEVEPRRALEAHMEGYDVMPM
SAHH_HALWD      AMTTNLSYAGKNVVVAGYGYCGKGVAQKAAGQNA-NVIVTEVEPRRALEAHMEGYEVMPM
SAHH_THEMA      MRNTNLLVAGKNVVVAGYGWCGRGIALRAAGLGA-RVIVTEVDPVKAVEAIMDGFTVMPM
SAHH_GLOVI      IRATNILLAGKTIVVAGYGWCGKGVALRARGMGA-NVVVTEINPVRAIEAAMDGLQVMPM
SAHH_GLOC7      IRATNVLLAGKTVVVAGYGWCGKGTAMRARGLGA-NVIVTEINAVKAIEAVMDGFRVMPM
SAHH_NOSS1      IRATNILLAGKNVVVVGYGWCGKGTALRARGMGA-NVIVTEIDPIKAIEAVMDGFRVLPM
SAHH_THEEB      IRATNILLAGKTVVVAGYGWCGKGTALRARGMGA-NVIVTEIDPVRAIEAVMDGFRVMPM
SAHH_SYNY3      IRATNILLAGKTIVVAGYGWCGKGVAMRAKGMGA-DVIVTEISPVPAIEAAMDGFRVMPM
SIHH_METTH      MGTTNMLIAGKTVVVCGYGWCGRGIAMRAEGLGA-SVIVTEVDPIRALEARMDGFRVMKV
SAHH_AERPE      LRATNILIAGKTVVVAGYGWVGRGIAARFRGMGA-KVVVTEVDPVRALEAAMDGFTVTTM
SIHH_METKA      MRATNILLAGKTVVVVGYGWCGRGIARRARGLGA-NVIVVEVDPIKAMEAIFDGFRVMPM
SAHH_PYRAE      MRATNLLIAGKNVVIAGYGWVGRGIAIRARGLGARRVIVVEVDPIRALEAVFDGYEVMPM
SAHH_SACS2      LRATNILIAGKIAVVAGYGWVGRGIANRLRGMGA-RVIVTEVDPIRALEAVMDGFDVMPI
SAHH_SULAC      LRATNILIAGKVAVVIGYGWVGRGIASRFKGMGA-RVIVVESSPFRALEALMDGFDVMTM
SAHH_SULTO      LRATNILIAGKVAVVAGYGWVGRGIAQRLRGMGA-RVIVVEVSPLRALEAVMDGFDVMPM
SAHH_AQUAE      LRATNRLLAGSYFVVAGYGWCGKGVAQRARGMGA-IVIVTEVDPIKALEARMDGFLVMPM
SAHH_THEKO      IRTTNLLVAGKNVVVVGYGWCGRGIAMRARGLGA-TVIVVEVDPIRALEARMDGFLVMDM
SAHH_PYRAB      MRATNLLVAGKNVVVVGYGWCGRGIAMRARGLGA-TVIVVEVDPIKALEARMDGFLVMSM
SAHH_PYRFU      MRATNLLIAGKNVVVVGYGWCGRGIAMRARGLGA-TVIVVEVDPIKALEARMDGFLVMDM
SAHH_PYRHO      MRATNLLIAGKNVVVVGYGWCGRGIAMRARGLGA-TVIVVEVDPIKALEARMDGFLVMNM
SIHH_METAC      NRTTNLLVAGKNVVVGGYGWCGRGVAMRAAGLGA-NVIVTEVDPIRALEARMDGYRVMRM
SIHH_METMA      NRTTNLLVAGKNVVVAGYGWCGRGVAMRATGLGA-SVIVTEIDPIRALEARMDGHRVMKM
SAHH_ARCFU      IRATNLLMAGKIVVVAGYGWCGRGIAMRARGMGA-SVVVTEVDEIRALEAVMDGFRVMRM
SIHH_METJA      LRATNLLIAGKTVVVAGYGWCGRGVAMRAKGLGA-EVVVTEVNPIRALEARMDGFRVMKM
SIHH_METMP      IRTTNLLIAGKNVVVGGYGWCGRGVASRAAGHGA-NVIITEVNPIRALEAKMDGFTVLKM
                    :   .*    : *:*  *.             * : * .   * :* ::*  :   

SAHH_ACIAD      YKNGVQTGKKEDINLDLLKNTDLIVTTTGNYHVCDSAMLDTLKAGAVVCNIGHFDTEIDT
SAHH_HAHCH      YIDGVNTGAADGVNRDLLGHTDLLVTTTGNVNVCDKYMLQALKSGAVVCNIGHFDNEIDT
SAHH_PSEE4      FKDGINTGTEAGINKDLLGRIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSE14      FIDGENDGTEASIDKALLGKIDLIVTTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEU2      FIDGENDGTEASIDKALLGKIDLIVTTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSESM      FIDGENDGTEASIDKALLGKIDLIVTTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEFS      FIDGVNDGTEASIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEF5      FIDGINHGTEASIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEPF      FIDGINDGTEASIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEPW      FIDGINDGTEASIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEP1      FIDGINDGTEASIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEPG      FIDGINDGTEASIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEU5      YKNGINDGTEASVDAALLGKIDLIVTTTGNVNVCDAGMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEMY      YKNGINDGTESSVDAALLGKIDLIVTTTGNVNVCDAGMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEAE      YKNGINDGTEASIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEA8      YKNGINDGTEASIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_PSEAB      YKNGINDGTEASIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT
SAHH_STRAZ      --------------DEVVDKADIFVTTTGNKDIIMASDMAKMKHQAIVGNIGHFDNEIDM
SAHH_STRGG      --------------DDVVEQADIFVTTTGNKDIIMAKDMARMKHQAIVGNIGHFDNEIDM
SAHH_STRAA      --------------DEVVDKADIFITTTGNKDIIMAADMARMKHQAIVGNIGHFDNEIDM
SAHH_STRAW      --------------DEVIDKADIFVTTTGNKDIIMASDMAKMKHQAIVGNIGHFDNEIDM
SAHH_STRCO      --------------DEVVDKADIFVTTTGNKDIIMAKDMAKMKHQAIVGNIGHFDNEIDM
SAHH_CORDI      --------------DQAIGDADIVITATGNMGIISFEQMLAMKDHAVLGNIGHFDNEIDM
SAHH_COREF      --------------DEAIADADIVITATGNKDIISYEQMLKMKDHALLGNIGHFDNEIDM
SAHH_CORGL      --------------DEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDM
SAHH_CORGB      --------------DEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDM
SAHH_MYCPA      --------------EDVIGEADIVITATGNKDIITLEHMKAMKDKAILGNIGHFDNEIQI
SAHH_MYCLE      --------------EDVIADSDIVVTATGNKDIILLEHMKAMKDHAILGNIGHFDNEIDM
SAHH_MYCLB      --------------EDVIADSDIVVTATGNKDIILLEHMKAMKDHAILGNIGHFDNEIDM
SAHH_MYCBO      --------------EEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDM
SAHH_MYCBP      --------------EEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDM
SAHH_MYCBT      --------------EEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDM
SAHH_MYCTU      --------------EEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDM
SAHH_MYCTA      --------------EEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDM
SAHH_MYCMM      --------------EDAIGDADIVVTSTGNKDIIMLEHIKAMKDHSILGNIGHFDNEIDM
SAHH_MYCUA      --------------EDAIGDADIVVTSTGNKDIIMLEHIKAMKDHSILGNIGHFDNEIDM
SAHH_NOCFA      --------------EQAIGEADIVITATGNKDIITLDHMKAMKDQAILGNIGHFDNEIDM
SAHH_MYCSJ      --------------EQAIGSADIVITSTGNKDIITLDHMKAMKDKAILGNIGHFDNEIDM
SAHH_MYCSK      --------------EQAIGSADIVITSTGNKDIITLDHMKAMKDKAILGNIGHFDNEIDM
SAHH_MYCSS      --------------EQAIGSADIVITSTGNKDIITLDHMKAMKDKAILGNIGHFDNEIDM
SAHH_PELCD      --------------DEACQWGDIFVTTTGNVDVITRSHMDVMKNEAIVCNIGHFDSEIQV
SAHH_BDEBA      --------------EDAAPLGDIFVTATGCCDIITDKHFMKMKNNAIVCNIGHFDIEIDM
SAHH_GRAFK      --------------ETVLPKADIVITTTGNKDIVRPEHFEAMKDKTIVANIGHFDNEIAV
SAHH_FLAJ1      --------------NTVIANADIIITTTGNKDIVLGEHFEQMKDKTVVCNIGHFDNEIDM
SAHH_FLAPJ      --------------NTVVGNADIIITTTGNKDIVLGSHFEQMKDKTIVCNIGHFDNEIDM
SAHH_RHOBA      --------------EEACKEGRLYVTTTGNKDIILGEHMKQMPNDAILCNIGHFDTEIDI
SAHH_DESAD      --------------ANAVERGDVFVTCTGNYHVITGEHISKMKDEAIICNIGHFDNEIEM
SAHH_DESAG      --------------DEAAPEGDIFVTATGNFKVITGEHMERMKDEAIVCNIGHFDNEIDM
SAHH_DESVH      --------------EEAVRTGDIFVTATGNCNVITGAHMEAMKDEAIVCNIGHFDNEIDM
SAHH_DESVV      --------------EEAVRTGDIFVTATGNCNVITGAHMEAMKDEAIVCNIGHFDNEIDM
SAHH_DESVM      --------------EKAVEEGDIFVTATGNYKVITGEHMEAMKDEAIVCNIGHFDNEIDM
SAHH_GRABC      --------------DEAASRGDLFVTATGNVDVITIDHMRAMKNRAIVCNIGHFDSEIQI
SAHH_ZYMMO      --------------EEAAPRADIFVTCTGNADIITLDHMRAMKQHAIVCNIGHFDSEIQI
SAHH_NOVAD      --------------EEAVQRCDIFVTATGNEDVITAEHMKAMKPMSIVCNIGHFDSEIQI
SAHH_SPHAL      --------------DEAVKRSDIFVTATGNADVITAEHMAAMKNMAIVCNIGHFDSEIQI
SAHH_ROSDO      --------------EDVVGSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQV
SAHH_RHOCB      --------------EDVVADADIFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQV
SAHH_RHOSH      --------------EDVVQDADIFITTTGNRDVIRIEHMREMKDMAIVGNIGHFDNEIQV
SAHH_BARQU      --------------DDAASSADIIITTTGNKDVVRLDHMRQVKDMCILGNIGHFDNEIQV
SAHH_BARHE      --------------DDAASSADIIITTTGNKDIVRLDHMRKVKDMCILGNIGHFDNEIQV
SAHH_BART1      --------------DDAASSADIIITTTGNKDVVRLDHMRQVKDMCILGNIGHFDNEIQV
SAHH_AGRFC      --------------EDVVSSADIFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQV
SAHH_RHIME      --------------EDVVSSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQV
SAHH_SINMW      --------------EDVVSSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQV
SAHH_AGRRK      --------------EDVVSSADIFISTTGNKDVIRIDHMRAMKDMAIVGNIGHFDNEIQV
SAHH_RHILW      --------------EDVVSSADIFITTTGNKDVIRIDHMRQMKDMAIVGNIGHFDNEIEV
SAHH_RHIL3      --------------EDVVSSADIFITTTGNKDVIRIDHMRAMKDMAIVGNIGHFDNEIEV
SAHH_RHIEC      --------------EDVVSSADIFITTTGNKDVIRIDHMRQMKDMAIVGNIGHFDNEIEV
SAHH_RHIE6      --------------EDVVSSADIFITTTGNKDVIRIDHMREMKDMAIVGNIGHFDNEIEV
SAHH_CHESB      --------------DEAIATADIIITATGNKDVVSLDHMRKMKDMVILGNIGHFDNEIQV
SAHH_RHILO      --------------EDAAPTADIVITTTGNKDVVTLDHMRSMKDMVIVGNIGHFDNEIQV
SAHH_OCHA4      --------------DDAASTADIIVTTTGNKDVITIDHMRKFKDMAIVGNIGHFDNEIQV
SAHH_BRUO2      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUAB      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUA2      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUA1      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUC2      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUSU      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUSI      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUME      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_BRUMB      --------------DDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQV
SAHH_MARMM      --------------EDVIGEMDIFVTATGNKDILTVDHMRAMKDMAIVCNIGHFDNEIQV
SAHH_HYPNA      --------------DEAAPKFDIFVTATGNKDILTVDHMRAMKDMAIVCNIGHFDNEIQV
SAHH_CAUVC      --------------NDVADKADIFVTATGNKDVITVDDMRKMKNNAIVCNIGHFDSEIQI
SAHH_RHOPA      --------------EDAAPIADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQV
SAHH_RHOPT      --------------EDAAPIADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQV
SAHH_RHOPS      --------------EDAAPIADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQI
SAHH_RHOP2      --------------EDAAPLADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQI
SAHH_BRADU      --------------EDAAPRADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQI
SAHH_BRASB      --------------EDAAPRADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQV
SAHH_METC4      --------------EDAAPRADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQV
SAHH_METEP      --------------EDAAPRADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQV
SAHH_METPB      --------------EEAAPRADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQV
SAHH_METNO      --------------EDAAPRADIFVTATGNKDVITLDHMRAMKDRAIVCNIGHFDNEIQV
SAHH_METS4      --------------EDAAPRADIFVTATGNKDVITIDHMRSMKDRAIVCNIGHFDNEIQV
SAHH_PROMP      --------------NDVVEDIDIFVTATGNYQVITNDNLIKMKDEAIVCNIGHFDNEIDV
SAHH_PROM9      --------------DDVVEDIDIFVTATGNYQVITNKNLVKMKDEAIVCNIGHFDNEIDV
SAHH_PROM2      --------------EDVVEDIDIFVTATGNYQVITKENLVKMKNEAIVCNIGHFDNEIDV
SAHH_PROM0      --------------EDVVEDIDIFVTATGNYQVITHENLVKMKDEAIVCNIGHFDNEIDV
SAHH_PROM3      --------------DEVVQDVDIFVTSTGNFQVIRHEHLIRMKDEAIVCNIGHFDNEIDV
SAHH_PROMM      --------------DEVVQDVDIFVTSTGNFQVIRHEHLIRMKDEAIVCNIGHFDNEIDV
SAHH_SYNS3      --------------EDVVDQMDIFVTATGNYQVIRNEHLVKMKDEAIVCNIGHFDNEIDV
SAHH_SYNS9      --------------DDVVDQMDIFVTATGNYQVIRNEHLVKMKDEAIVCNIGHFDNEIDV
SAHH_SYNSC      --------------EDVVEDMDIFVTATGNYQVIRNEHLVKMKDEAIVCNIGHFDNEIDV
SAHH_SYNPW      --------------EDVVEDMDIFVTATGNYQVIRNEHLLKMKDEAIVCNIGHFDNEIDV
SAHH_SYNPX      --------------EDVVEEMDIFVTATGNYQVIRNEHLEKMKDEAIVCNIGHFDNEIDV
SAHH_PROMA      --------------DDVVEEIDIFVTATGNFQVICHDHLIRMKDEAIVSNIGHFDNEIDV
SAHH_PROM4      --------------NDVVQNVDIFVTATGNFNVITHDHLIRMKDEAIVCNIGHFDNEIDV
SAHH_MYXXD      --------------DYAADKADIFVTATGNKGVITHDHMAKMKDQAIVCNIGHFDNEIEV
SAHH_LEPCP      --------------EYAADKADIFVTTTGNRDVIRHEHMAAMKDQAIVCNIGHFDNEIDV
SAHH_ACISJ      --------------EWAADKADIFVTTTGNRDVITFEHMKAMKDQAIVCNIGHFDNEIQV
SAHH_ACIET      --------------EWAADKADIFVTTTGNRDVITFEHMKAMKDQAIVCNIGHFDNEIQV
SAHH_DELAS      --------------EWAADKADIFVTTTGNRDIIRHEHMVAMKNEAIVCNIGHFDNEIDV
SAHH_METPP      --------------EYAADKADIFVSATGNKNVIRYEHMAAMKDEAIVCNIGHFDNEIDV
SAHH_ACIAC      --------------EYAADKADIFVTTTGNKDVIRHEHMVAMKNEAIVCNIGHFDNEIDV
SAHH_VARPS      --------------EYAADKADIFVTTTGNRDVIRHEHMAAMKDQAIVCNIGHFDNEIDV
SAHH_HERAR      --------------DYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIEV
SAHH_JANMA      --------------EYAAEHGDIFVTCTGNYHVITHEHMKKMKDQAIVCNIGHFDNEIEV
SAHH_BORPD      --------------EEAAPHADIFVTATGNYHVITREHMQAMKDQAIVCNIGHFDNEIDV
SAHH_BORBR      --------------EEAAAHADIFVTATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDV
SAHH_BORPA      --------------EEAAAHADIFVTATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDV
SAHH_BORPE      --------------EEAAAHADIFVTATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDV
SAHH_POLNS      --------------DYAADKADIFVSATGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDV
SAHH_POLAQ      --------------DYAADKADIFVSATGNYHVITHDHMAKMKNQAIVCNIGHFDNEIDV
SAHH_AROAE      --------------DYAAEHADIFVTCTGNYHVIRHDHMARMKDQAIVCNIGHFDNEIDV
SAHH_RALPJ      --------------DYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDI
SAHH_RALSO      --------------DYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDI
SAHH_CUPMC      --------------DYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDI
SAHH_CUPPJ      --------------DYAAEHGDIFVTCTGNYHVITHDHMARMKDQAIVCNIGHFDNEIDI
SAHH_CUPTR      --------------DYAAEHGDIFVTCTGNYHVITHEHMAKMKDQAIVCNIGHFDNEIDI
SAHH_CUPNH      --------------DYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDI
SAHH_GEOSL      --------------EYAADKADIFVTTTGNINVITHDHMKAMRHNAIVCNIGHFDNEIEV
SAHH_NITEU      --------------DDACDKADIFVTATGNLRVITHDHMLKMKDQSIICNIGHFDSEIDI
SAHH_NITEC      --------------DDACDKADIFVTATGNLRVITHDHMLKMKNQAIVCNIGHFDSEIDI
SAHH_METCA      --------------DEACDKADIFVTATGNVGVITHDHMVKMKDQAIVCNIGHFDSEIEV
SAHH_CHRVO      --------------DEVADQADIFVTATGNVGVITHEHMKKMRNNAIICNIGHFDSEIEV
SAHH_BURMA      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURM9      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURM7      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURMS      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURPS      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURP0      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURP1      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURP6      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_BURTA      --------------EYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_PARP8      --------------EYAADKADIFVTATGNYHVIGHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_PARPJ      --------------EYAADKADIFVTATGNYHVIGHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_PARXL      --------------EYAADKADIFVTATGNYHVIGHDHMKAMRHNAIVCNIGHFDSEIDV
SAHH_HALHL      --------------EEAAPVADIFVTATGNYNVITHDHMKAMKDEAIVCNIGHFDNEIDV
SAHH_COXB1      --------------DEMADSADIFVTATGNTDIITHEHMLKMKDQAIVCNIGHFDNEIDI
SAHH_COXBU      --------------DEMADSADIFVTATGNTDIITHEHMLKMKDQAIVCNIGHFDNEIDI
SAHH_COXB2      --------------DEMADSADIFVTATGNTDIITHEHMLKMKDQAIVCNIGHFDNEIDI
SAHH_COXBN      --------------DEMADSADIFVTATGNTDIITHEHMLKMKDQAIVCNIGHFDNEIDI
SAHH_LEPBJ      --------------EDIIEQVDIVVTATGNDDIITLEHMKAMKDGAILCNIGHFDTEIQM
SAHH_LEPBL      --------------EDIIEQVDIVVTATGNDDIITLEHMKAMKDGAILCNIGHFDTEIQM
SAHH_LEPIN      --------------EDIIEQVDIVVTATGNDDIITLEHMKAMKDGAILCNIGHFDTEIQM
SAHH_LEPIC      --------------EDIIEQVDIVVTATGNDDIITLEHMKAMKDGAILCNIGHFDTEIQM
SAHH_SOLUE      --------------EDTLGRGDIYVTCTGNCEIITLEHMRLMKDQAIVCNIGHFDNEIQM
SAHH_XYLFM      --------------EDTLGQADIYVTTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQV
SAHH_XYLFA      --------------EDTLGQADIYVTTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQV
SAHH_XYLF2      --------------EDTLGQADIYVTTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQV
SAHH_XYLFT      --------------EDTLGQADIYVTTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQV
SAHH_XANCP      --------------ESTLGRGDIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQV
SAHH_XANC8      --------------ESTLGRGDIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQV
SAHH_XANOM      --------------ESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQV
SAHH_XANOP      --------------ESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQV
SAHH_XANC5      --------------ESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQV
SAHH_XANAC      --------------ESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQV
SAHH_BACFR      --------------EDACKEGNIFVTTTGNIDIIRIDHMEQMKDQAIVCNIGHFDNEIQV
SAHH_BACTN      --------------EDACTEGNIFVTTTGNIDIIRIDHMEKMKDQAIVCNIGHFDNEIQV
SAHH_CHLL2      --------------EDAVGEGNIFVTTTGNKDVITLEHMKQMRDEAIVCNIGHFDNEIQV
SAHH_CHLPD      --------------DEAVTEGNIFVTTTGNKDVITLEHMKKMKGEAIICNIGHFDNEIQV
SAHH_PELPB      --------------DEAVKEGNIFVTTTGNKDVITLEHMKQMKDEAIVCNIGHFDNEIQV
SAHH_PELLD      --------------DKAVKEGNIFVTTTGNKDVVTLEHMKQMPDEAIVCNIGHFDNEIQV
SAHH_CHLPM      --------------DRAVKEGNIFVTTTGNKDVITLEHMKQMPDEAIVCNIGHFDNEIQV
SAHH_CHLCH      --------------EDAVHEGNIFVTTTGNKDVITLEHMKQMRDEAIVCNIGHFDNEIQV
SAHH_CHLP8      --------------EEALEEGNIYVTTTGNKDVITLEHMKKMKDEAIVCNIGHFDNEIQV
SAHH_CHLTE      --------------EEAVKEGNIFVTATGNKDVITLDHIKQMRDEAIVCNIGHFDNEIQV
SAHH_THEAC      --------------NNAIRDADMVITATGMKDVVKYEDALVAKKNIVLANAGHFNNEVAV
SAHH_THEVO      --------------NDAIRYADMVITATGMKDVVKYEDALVAKKNIVLANAGHFDNEVAV
SAHH_HALSA      --------------AEAAEVGDVFLTTTGNKNVITRAHFERMDDGVVLANAGHFDVEVNL
SAHH_HALWD      --------------NEAATRGDVFVTTTGNRDVITQEDFEVMSDGAILANAGHFDVEINL
SAHH_THEMA      --------------KEAVKIADFVITASGNTDVLSKEDILSLKDGAVLANAGHFNVEIPV
SAHH_GLOVI      --------------AEAACLGDLFITVTGNKHVIRREHFAMMKDGAIVCNSGHFDIEIDL
SAHH_GLOC7      --------------IEAAPLGDLFVTVTGNKHVIRPEHFDVMKDGAIVCNSGHFDIEIDL
SAHH_NOSS1      --------------AEAAPQGDIFITVTGNKHVVRGEHFDVMKDGAIVCNSGHFDLELDL
SAHH_THEEB      --------------LDAAPLGDIFITVTGNKHVIRAEHFAVMKDGAMVANSGHFDIEIDL
SAHH_SYNY3      --------------AEAAHQGDIFITVTGNKHVIRPEHFAVMKDGAIVCNSGHFDIEIDL
SIHH_METTH      --------------SDAVKEADILITATGNTDVVSESEFMNMKDGCVMANSGHFNVEINR
SAHH_AERPE      --------------DEAASLGDVFITATGNINVIDARHMEKMKDGAILANAGHFNVEINV
SIHH_METKA      --------------DRAAEEGDIFITATGNRDVIRGEHIEKMKDGVILANAGHFDVEIDK
SAHH_PYRAE      --------------DKAAEVGDIFITATGNIRAISLGHIFKMKDGAVLANAGHFNVEIDV
SAHH_SACS2      --------------AEASKVGDIFVTATGNTKAIRVEHMLNMKDGAILSNAGHFNVEVDV
SAHH_SULAC      --------------NRASEIGDIFVTATGNLNVVSRDHILRMKDGAVLANSGHFNVEIDV
SAHH_SULTO      --------------SKAAELGEIFITATGNINVIRKEHILKMKDGAILANSGHFNVEIDV
SAHH_AQUAE      --------------EEAAKLGDFFVTVTGNIHVIRREHFEVMKDGAIVANSGHFNVEIDI
SAHH_THEKO      --------------MEAAKVGDIFITATGDINCIRKEHFELMKDGAILANAGHFDVEISK
SAHH_PYRAB      --------------KEAAKIGDIFVTATGNIKCIRREHFELMKDGAIMANAGHFDVEIWK
SAHH_PYRFU      --------------KEAAKIGDIFVTATGNIKCIRREHFELMKDGAIMANAGHFDVEIWK
SAHH_PYRHO      --------------KEAAKIGDIFITATGDIKCIRREHFELMKDGAIMANAGHFDVEIWK
SIHH_METAC      --------------ADAARLGEIFVTTTGNRDILTAEHFKVMPDGAVLANSGHFNVEIDM
SIHH_METMA      --------------SEAAKIGDLFVTATGNRDILTADNFKVMKDGAILANSGHFNVEIDM
SAHH_ARCFU      --------------EDAAKIGDIFITATGNRDIIREEHIRLMKDGAILANAGHFNVEIDI
SIHH_METJA      --------------EKAAEIGDIFITTTGCKDVIRKEHILKMRNGAILANAGHFDNEINK
SIHH_METMP      --------------EEAAKIGDIFVTTTGCKDILRMEHFLLMKDGAVLSNAGHFDNEINK
                                      . :: :*                 :: * ***: *:  

SAHH_ACIAD      NYLRGY----KWV--EVKPQ----VHQVY------RSENENDYLILLSEGRLVNLGN--A
SAHH_HAHCH      RFMRDN---WEWE--EVKPQ----VHVIY------RNKDQNDHLLLLSEGRLVNLGN--A
SAHH_PSEE4      AFMRKH---WAWE--EVKPQ----VHKIHRTGAGTFDPQNDDYLILLAEGRLVNLGN--A
SAHH_PSE14      AFMRKN---WAWE--EVKPQ----VHKIHRTGPGSFDAQNDDYLILLAEGRLVNLGN--A
SAHH_PSEU2      AFMRKN---WAWE--EVKPQ----VHKIHRTGPGSFDAQNDDYLILLAEGRLVNLGN--A
SAHH_PSESM      AFMRKN---WAWE--EVKPQ----VHKIHRTGAGAFDAQNDDYLILLAEGRLVNLGN--A
SAHH_PSEFS      AFMRKN---WAWE--EVKPQ----VHKVHRTGAGAFDAQNDDYLILLAEGRLVNLGN--A
SAHH_PSEF5      AFMRKN---WAWE--EVKPQ----VHKIHRTGPGDFDAQNDDYLILLAEGRLVNLGN--A
SAHH_PSEPF      AFMRKN---WAWE--EVKPQ----VHKIHRTGAGSFDPQNDDYLILLAEGRLVNLGN--A
SAHH_PSEPW      AFMRKN---WAWE--EVKPQ----VHKIHRTGAGDFDPQNDDYLILLAEGRLVNLGN--A
SAHH_PSEP1      AFMRKN---WAWE--EVKPQ----VHKVHRTGAGSFDPQNDDYLILLAEGRLVNLGN--A
SAHH_PSEPG      AFMRKN---WAWE--EVKPQ----VHKIHRTGAGSFDPQNDDYLILLAEGRLVNLGN--A
SAHH_PSEU5      AFMRQN---WGWE--EVKPQ----VHKIHRTGKT-VDPTNDDYLILLAEGRLVNLGN--A
SAHH_PSEMY      AFMRKN---WAWE--EVKPQ----VHKIHRTGAGQFDPTNDDYLILLAEGRLVNLGN--A
SAHH_PSEAE      AFMRKN---WAWE--EVKPQ----VHKIHRTGKDGFDAHNDDYLILLAEGRLVNLGN--A
SAHH_PSEA8      AFMRKN---WAWE--EVKPQ----VHKIHRTGKDGFDAHNDDYLILLAEGRLVNLGN--A
SAHH_PSEAB      AFMRKN---WAWE--EVKPQ----VHKIHRTGKDGFDAYNDDYLILLAEGRLVNLGN--A
SAHH_STRAZ      AGLAQI---PGIVKDEVKPQ----VHTWK------F-PD-GKVLIVLSEGRLLNLGN--A
SAHH_STRGG      AGLAKI---DGIVKDEVKPQ----VHTWT------F-PD-GKVLIVLSEGRLLNLGN--A
SAHH_STRAA      AGLAKV---PGIVKDEIKPQ----VHTWT------F-PD-GKKIIVLSEGRLLNLGN--A
SAHH_STRAW      AGLAQI---PGIVKDEVKPQ----VHTWK------F-PD-GKVLIVLSEGRLLNLGN--A
SAHH_STRCO      AGLAQT---PGIVKDEVKPQ----VHTWT------Y-PD-GKVLIVLSEGRLLNLGN--A
SAHH_CORDI      ASLLHR---DDVSRVTIKPQ----VDEFT------L-PN-GKSIVVLSEGRLLNLGN--A
SAHH_COREF      HSLLHR---DDVIRTTIKPQ----VDEFT------F-PN-GKSIIVLSEGRLLNLGN--A
SAHH_CORGL      HSLLHR---DDVTRTTIKPQ----VDEFT------F-ST-GRSIIVLSEGRLLNLGN--A
SAHH_CORGB      HSLLHR---DDVTRTTIKPQ----VDEFT------F-ST-GRSIIVLSEGRLLNLGN--A
SAHH_MYCPA      ARLEKS----GAIKTNIRPQ----VDLWT------F-PDTGKSIIVLSEGRLLNLGN--A
SAHH_MYCLE      AALERS----GATRLNIKPQ----VDLWT------F-GDSGKSIIVLSEGRLLNLGN--A
SAHH_MYCLB      AALERS----GATRLNIKPQ----VDLWT------F-GDSGKSIIVLSEGRLLNLGN--A
SAHH_MYCBO      AGLERS----GATRVNVKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_MYCBP      AGLERS----GATRVNVKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_MYCBT      AGLERS----GATRVNVKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_MYCTU      AGLERS----GATRVNVKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_MYCTA      AGLERS----GATRVNVKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_MYCMM      AGLERS----GATRTNIKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_MYCUA      AGLERS----GATRTNIKPQ----VDLWT------F-GDTGRSIIVLSEGRLLNLGN--A
SAHH_NOCFA      AALERS----GATRLTIKPQ----VDLWT------F-GESGKSIIVLSEGRLLNLGN--A
SAHH_MYCSJ      AALERS----GATRINIKPQ----VDEWT------F-DD-GHSIVVLSEGRLLNLGN--A
SAHH_MYCSK      AALERS----GATRINIKPQ----VDEWT------F-DD-GHSIVLLSEGRLLNLGN--A
SAHH_MYCSS      AALERS----GATRINIKPQ----VDEWT------F-DD-GHSIVLLSEGRLLNLGN--A
SAHH_PELCD      DALYDD---PSLTVHEVKPQ----VDQIE------W-PD-GKRITVLAKGRLVNLGC--A
SAHH_BDEBA      AWLNKN---SKMR--EVKPQ----VDIHT------L-KN-GKQVIILAKGRLVNLGC--A
SAHH_GRAFK      SWLNEK---HGDSKVEIKPQ----VDKYT--------IN-GKDIILLAEGRLVNLGC--A
SAHH_FLAJ1      AWLNKN---HGASKIEIKPQ----VDKYN--------IN-GKDIIILAEGRLVNLGC--A
SAHH_FLAPJ      AWLNKN---HGASKIEIKPQ----VDKYT--------IA-GKDILILAEGRLVNLGC--A
SAHH_RHOBA      AWAEQQVADGKATVSEIKPSDIGAVDRFT------F-NDTGRSIIILAKGRLVNLGC--A
SAHH_DESAD      GYLENS---KTAKKIEIKPQ----VDKWV------M-ES-GKSVIVLAEGRLVNLGC--A
SAHH_DESAG      AYLEDS---TECSCLNIKPQ----VDKWT------L-KS-GRSIIVLAEGRLVNLGC--A
SAHH_DESVH      HYLENT---EGCVCLNIKPQ----VDKWT------L-RS-GRSIIVLAEGRLVNLGC--A
SAHH_DESVV      HYLENT---EGCVCLNIKPQ----VDKWT------L-RS-GRSIIVLAEGRLVNLGC--A
SAHH_DESVM      HYLETT---PGCTCLNIKPQ----VDKWT------L-KS-GRSIIVLAEGRLVNLGC--A
SAHH_GRABC      ESLRNY----RWE--NVKPQ----VDEVV------F-PD-GKRLIILSEGRLVNLGN--A
SAHH_ZYMMO      NSLANM----KWT--EIKPQ----VDLVK------F-PD-GKEIIVLAKGRLVNLGC--A
SAHH_NOVAD      SALNNY----KWT--EIKPG----TDLVE------F-PD-GKQIIILAKGRLVNLGC--A
SAHH_SPHAL      AALANY----KWT--EVKPQ----VDLVE------F-PD-GKQIIILSKGRLVNLGN--A
SAHH_ROSDO      AALKNH----KWT--NIKEQ----VDMIE------M-PN-GNRLILLSEGRLLNLGN--A
SAHH_RHOCB      AALKNH----KWT--NIKDQ----VDMIE------M-PS-GARIILLSEGRLLNLGN--A
SAHH_RHOSH      AALKNH----KWT--NIKDQ----VDMIE------M-PS-GSRIILLSEGRLLNLGN--A
SAHH_BARQU      SALRNL----PWT--NIKPQ----VDIVT------F-PD-GKRIILLSEGRLLNLGN--A
SAHH_BARHE      AALQNL----PWT--NIKPQ----VDMIT------F-PD-GKRIILLSEGRLLNLGN--A
SAHH_BART1      AALRNL----PWT--NIKPQ----VDMIT------F-PD-GKRIILLSEGRLLNLGN--A
SAHH_AGRFC      ASLRNL----KWT--NIKPQ----VDMIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_RHIME      SALRNL----KWT--NVKPQ----VDLIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_SINMW      SALRNL----KWT--NVKPQ----VDLIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_AGRRK      AALRNL----KWT--NVKPQ----VDLIE------F-AK-GNRIILLSEGRLLNLGN--A
SAHH_RHILW      AALRNL----KWT--NVKPQ----VDLIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_RHIL3      AALRNL----KWT--NVKPQ----VDLIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_RHIEC      AALRNL----KWT--NVKPQ----VDLIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_RHIE6      AALRNL----KWT--NVKPQ----VDLIE------F-PK-GNRIILLSEGRLLNLGN--A
SAHH_CHESB      AALRNF----KWV--NIKPQ----VDLIE------F-PD-GKRIILLSEGRLLNLGN--A
SAHH_RHILO      ASLRNL----KWT--NVKPQ----VDMIT------F-PD-GKRMILLSEGRLLNLGN--A
SAHH_OCHA4      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRIILLSEGRLLNLGN--A
SAHH_BRUO2      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUAB      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUA2      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUA1      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUC2      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUSU      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUSI      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUME      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_BRUMB      AALRNL----KWT--NVKPQ----VDLIE------F-PD-GKRLILLSEGRLLNLGN--A
SAHH_MARMM      ESLKNY----QWT--NVKPQ----VDLVN------F-PE-GHRIILLSEGRLVNLGN--A
SAHH_HYPNA      EGLRNF----QWT--NIKPQ----VDMIT------F-PD-GKRIILLSEGRLVNLGN--A
SAHH_CAUVC      AGLRNF----KWD--EIKPQ----VHHVE------F-PD-GKKLIVLSEGRLVNLGN--A
SAHH_RHOPA      ATLKNM----KWD--NIKPQ----VDEIT------F-PD-GKRMILLSEGRLVNLGN--A
SAHH_RHOPT      ATLKNM----KWD--NIKPQ----VDEIT------F-PD-GKRMILLSEGRLVNLGN--A
SAHH_RHOPS      AHLKNL----KWD--NIKPQ----VDEIT------F-PD-GKRMILLSEGRLVNLGN--A
SAHH_RHOP2      AHLKNL----KWD--NIKPQ----VDEIT------F-PD-GKRMILLSEGRLVNLGN--A
SAHH_BRADU      AGLRNL----KWT--NIKPQ----VDEIE------F-PD-KHRIIMLSEGRLVNLGN--A
SAHH_BRASB      ASLKNL----KWT--NIKPQ----VDEIT------F-PD-GKRMILLSEGRLVNLGN--A
SAHH_METC4      AGLKNL----KWQ--NIKPQ----VDEIE------F-AD-GHRIILLSEGRLVNLGN--A
SAHH_METEP      AGLKNL----KWQ--NIKPQ----VDEIE------F-AD-GHRIILLSEGRLVNLGN--A
SAHH_METPB      AGLKNL----KWQ--NIKPQ----VDEIE------F-AD-GHRIILLSEGRLVNLGN--A
SAHH_METNO      AGLRNL----KWT--NIKPQ----VDEIE------F-AD-GHRIILLSEGRLVNLGN--A
SAHH_METS4      AGLKNL----KWS--NIKPQ----VDEIE------F-PD-GHRIILLSEGRLVNLGN--A
SAHH_PROMP      ASLKDY----PWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_PROM9      ASLKDY----PWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_PROM2      ASLKNY----PWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_PROM0      ASLKNY----QWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_PROM3      ASLKDY----SWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_PROMM      ASLKDY----PWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_SYNS3      ASLKSY----EWD--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_SYNS9      ASLKDY----KWD--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_SYNSC      ASLKEY----EWE--NIKPQ----VDHIT------L-PS-GNRIILLAEGRLVNLGC--A
SAHH_SYNPW      ASLKDY----EWE--NIKPQ----VDHIT------L-PS-GNRIILLAEGRLVNLGC--A
SAHH_SYNPX      ASLKGY----EWD--NIKPQ----VDHIT------L-PS-GNRIILLAEGRLVNLGC--A
SAHH_PROMA      ASLKSY----QWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_PROM4      ASLKPY----QWE--NIKPQ----VDHIT------L-PS-GNKIILLAEGRLVNLGC--A
SAHH_MYXXD      ASLEKY----KWE--EIKPQ----VDHII------F-PD-NKRIILLAKGRLVNLGC--G
SAHH_LEPCP      ASLEGY----EWD--EIKPQ----VDHII------F-PD-GKKIILLAKGRLVNLGC--A
SAHH_ACISJ      AKLEEH---CQWE--EIKPQ----VDHVI------F-PD-GKRIILLAKGRLVNLGC--G
SAHH_ACIET      AKLEEH---CQWE--EIKPQ----VDHVI------F-PD-GKRIILLAKGRLVNLGC--G
SAHH_DELAS      ASIEQY----QWE--EIKPQ----VDHIT------F-PD-GKKIILLAKGRLVNLGC--A
SAHH_METPP      ASLEKL----KWD--EIKPQ----VDHVV------F-PD-GKKITLLAKGRLVNLGC--A
SAHH_ACIAC      ASIEKY----RWE--EVKPQ----VDHVI------F-PD-GKRITLLAKGRLVNLGC--A
SAHH_VARPS      ASIEKY----EWE--EIKPQ----VDHIT------F-PD-GKKIILLAKGRLVNLGC--G
SAHH_HERAR      AALKQY----TWE--NIKPQ----VDHII------F-PD-GKRIILLAEGRLVNLGC--G
SAHH_JANMA      AALKQY----TWE--NIKPQ----VDHII------F-PD-GKRIILLAEGRLVNLGC--G
SAHH_BORPD      AALDDC----QWE--EIKPQ----VDHVV------F-PD-GKRIILLAKGRLVNLGC--A
SAHH_BORBR      AGLENC----QWE--EIKPQ----VDHVI------F-PD-GKRIILLAKGRLVNLGC--A
SAHH_BORPA      AGLENC----QWE--EIKPQ----VDHVI------F-PD-GKRIILLAKGRLVNLGC--A
SAHH_BORPE      AGLENC----QWE--EIKPQ----VDHVI------F-PD-GKRIILLAKGRLVNLGC--A
SAHH_POLNS      AGIEKY----KWE--EIKPQ----VDHVIFPAANGM-PE--KRIIILAKGRLVNLGC--G
SAHH_POLAQ      AGIEKY----KWE--EIKPQ----VDHVIFPAANGK-PE--KRIIILAKGRLVNLGC--G
SAHH_AROAE      ASIEGY----EWE--EIKPQ----VDHVI------F-PD-GKRIILLAKGRLVNLGC--A
SAHH_RALPJ      ASVEKY----QWE--EIKPQ----VDHVI------F-PD-GKKIIILAKGRLVNLGC--A
SAHH_RALSO      ASVEQY----QWE--EIKPQ----VDHVI------F-PD-GKKIIILAKGRLVNLGC--A
SAHH_CUPMC      ASVEKY----EWD--EIKPQ----VDHVK------F-PD-GKKIIILAKGRLVNLGC--A
SAHH_CUPPJ      ASIEKY----EWD--EIKPQ----VDHVK------F-PD-GKKIIILAKGRLVNLGC--A
SAHH_CUPTR      ASIEKY----EWD--EIKPQ----VDHVK------F-PD-GKKLIILAKGRLVNLGC--A
SAHH_CUPNH      ASIEKY----EWD--EIKPQ----VDHVK------F-PD-GKKLIILAKGRLVNLGC--A
SAHH_GEOSL      AALKQY----QWE--NIKPQ----VDHII------F-PD-SKRIILLAEGRLVNLGC--A
SAHH_NITEU      ASVQKY----QWE--NIKPQ----VDHVI------F-PT-GRRIIVLAQGRLVNLGC--A
SAHH_NITEC      ASVQKY----QWE--NIKPQ----VDHVI------F-PT-GRRIIVLAQGRLVNLGC--A
SAHH_METCA      AAMRQY----TWE--NIKPQ----VDHIV------L-PN-GRRIILLAEGRLVNLGC--A
SAHH_CHRVO      ASLRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURMA      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURM9      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURM7      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURMS      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURPS      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURP0      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURP1      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURP6      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_BURTA      ASTRQY----QWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_PARP8      ASTRQY----TWE--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_PARPJ      ASTRQY----QWD--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_PARXL      ASTRQY----QWD--NIKPQ----VDHII------F-PD-GKRVILLAEGRLVNLGC--A
SAHH_HALHL      ASLKQY----KWD--EIKPQ----VDHVE------F-PD-GKKITLLAEGRLVNLGC--A
SAHH_COXB1      ASLQDY----QWM--NIKPQ----VDQVI------F-PD-GKRLMVLAQGRLVNLGC--A
SAHH_COXBU      ASLQDY----QWM--NIKPQ----VDQVI------F-PD-GKRLTVLAQGRLVNLGC--A
SAHH_COXB2      ASLQDY----QWM--NIKPQ----VDQVI------F-PD-GKRLTVLAQGRLVNLGC--A
SAHH_COXBN      ASLQDY----QWM--NIKPQ----VDQVI------F-PD-GKRLTVLAQGRLVNLGC--A
SAHH_LEPBJ      SRLNSE---KGVTKKEIKPQ----VDKYT------F-PD-GKSIVVLAEGRLVNLGC--A
SAHH_LEPBL      SRLNSE---KGVTKKEIKPQ----VDKYT------F-PD-GKSIVVLAEGRLVNLGC--A
SAHH_LEPIN      SRLNNE---KGVTKKEIKPQ----VDKYT------F-PD-GKSIIVLAEGRLVNLGC--A
SAHH_LEPIC      SRLNNE---KGVTKKEIKPQ----VDKYT------F-PD-GKSIIVLAEGRLVNLGC--A
SAHH_SOLUE      DRLNES----DAKRLQIKPQ----VDMYT------F-PG-GSSIFILAEGRLVNLGC--A
SAHH_XYLFM      DALNTL---TGVQKINIKPQ----VDKFI------L-PN-GNTLFLLAEGRLVNLGC--A
SAHH_XYLFA      DALNAL---AGVQKINIKPQ----VDKFI------L-PN-GNTLFLLAEGRLVNLGC--A
SAHH_XYLF2      DALNAL---TGVQKINIKPQ----VDKFI------L-PN-GNTLFLLAEGRLVNLGC--A
SAHH_XYLFT      DALNAL---TGVQKINIKPQ----VDKFI------L-PN-GNTLFLLAEGRLVNLGC--A
SAHH_XANCP      DALNAL---KGVEKINIKPQ----VDKYV------F-GN-GNAIFLLADGRLVNLGC--A
SAHH_XANC8      DALNAL---KGVEKINIKPQ----VDKYV------F-GN-GNAIFLLADGRLVNLGC--A
SAHH_XANOM      DALKAL---KDVQKINIKPQ----VDKYV------F-PN-GNAIFLLADGRLVNLGC--A
SAHH_XANOP      DALKAL---KDVQKINIKPQ----VDKYV------F-PN-GNAIFLLADGRLVNLGC--A
SAHH_XANC5      DALKAL---KDVQKINIKPQ----VDKYV------F-PN-GNAIFLLADGRLVNLGC--A
SAHH_XANAC      DALKAL---KDVQKINIKPQ----VDKYV------F-PN-GNAIFLLADGRLVNLGC--A
SAHH_BACFR      DALKHY---PGIKRVNIKPQ----VDRYY------F-PD-GHSIILLADGRLVNLGC--A
SAHH_BACTN      DALKHY---SGIKCVNIKPQ----VDRYY------F-PD-GHSILLLADGRLVNLGC--A
SAHH_CHLL2      EQLNSF---AGATKLNIKPQ----VDKYT------F-ES-GNSIYLLAEGRLVNLGC--A
SAHH_CHLPD      EPLNNY---AGATKLNIKPQ----VDKYT------F-ED-GHAIYLLAEGRLVNLGC--A
SAHH_PELPB      EQLYAY---AGATRLNIKPQ----VDKYT------F-EN-GNCIYLLAEGRLVNLGC--A
SAHH_PELLD      EPLNEY---KGATKLNIKPQ----VDKYT------F-ED-GHCIYLLAEGRLVNLGC--A
SAHH_CHLPM      EPLNEY---KGATKLNIKPQ----VDKYT------F-ED-GHCIYMLAEGRLVNLGC--A
SAHH_CHLCH      DKLNND---PTVKIINIKPQ----VDKYI------F-PN-GNCMYLLAEGRLVNLGC--A
SAHH_CHLP8      DALNNF---KGATRINIKPQ----VDKYV------F-ED-GRCIYLLAEGRLVNLGC--A
SAHH_CHLTE      DALNNF---KGATRINIKPQ----VDKYV------F-EN-GNCIYLLAEGRLVNLGC--A
SAHH_THEAC      SEIEKR----SLEVNEVREF----VKRYR------L-EN-GNTVDIIADGRLVNLAA--G
SAHH_THEVO      KEIEKH----SLEKREVREF----VKRYR------L-EN-GNTVDVIADGRLVNLAA--G
SAHH_HALSA      DHLSEL----AVSEREAREG----VREYE------L-AD-GRRLNVLAEGRLVNLASPIG
SAHH_HALWD      EELSEL----AIDTYEARDG----VQAYE------L-GD-GRRLNVLAEGRLVNLAAPIA
SAHH_THEMA      RVLEEI----AVEKFEARPN----VTGYT------L-EN-GKTVFLLAEGRLVNLAA--G
SAHH_GLOVI      VALGEL----SSERRMVRPF----TEEYT------L-EG-GKSVIVLGEGRLINLAA--A
SAHH_GLOC7      QSLGEK----ASEIKEVRNF----TQQYT------L-AS-GKSIVVLGEGRLINLAA--A
SAHH_NOSS1      KYLAAN----AKEIKEVRPF----TEEYK------L-TN-GKSVVVLGQGRLINLAA--A
SAHH_THEEB      ATLKTL----AKQVRVVRNF----TEEYI------L-PS-GKSIIVLGEGRLINLAA--A
SAHH_SYNY3      KSLKEQ----AKEVKEVRNF----TEQYI------L-PN-GKSIIVIGEGRLVNLAA--A
SIHH_METTH      EALEEL----SRETGKVKED----IEVFI------M-PD-GRKIYLLAEGRLVNLASERG
SAHH_AERPE      AALEEM----SVSKRRVRRY----LDEYR------L-PD-GRRLYLIGEGRLVNLVA--A
SIHH_METKA      EYLEEH----CEEKIDRRGG---LVTEYR------M-PD-GKRVYLIAEGRLVNLAA--G
SAHH_PYRAE      AGLERV----AVAKRRIRPY----LEEYT------L-PN-GKRVYLIGEGRLVNLVA--A
SAHH_SACS2      KGLKET----AVKVRNIRPY----VDEYT------L-PN-GKRVYLLADGRLVNLAA--A
SAHH_SULAC      KGLKEI----SVETREVRQN----LEEYK------L-RN-GKRIYLLADGRLVNLVA--A
SAHH_SULTO      KGLKEM----AKSSRLIRPN----LEEYE------L-PN-GKRIYLLAEGRLVNLAA--A
SAHH_AQUAE      PALEEM----AVEKREIRKE----VTEYK------L-KD-GRRIYLLAEGRLVNLAA--A
SAHH_THEKO      PDLEAL----AVEISEPRPN----ITEYK------M-AD-GRRLYLLAEGRLVNLAA--A
SAHH_PYRAB      PDLEEL----AVEISNPRPN----VTEYK------L-KD-GRRLYLLADGRLVNLVA--A
SAHH_PYRFU      PDLEKL----AVEINNPRPN----VTEYK------L-KD-GRRLYLLADGRLVNLVA--A
SAHH_PYRHO      PDLEEL----AVEISNPRPN----VTEYK------L-KD-GRRLYLLADGRLVNLVA--A
SIHH_METAC      EALTSL----AKSVKTVRHN----IKEYD------I-GD--RRINVIAEGRLVNLAA--G
SIHH_METMA      EALDSL----AKSTRTVRHN----IKEYD------I-GN--RRINVIAEGRLVNLAA--G
SAHH_ARCFU      PALERM----AKAKREARKY----VTEYD------L-GD--KRVYLLAEGRLVNLVA--A
SIHH_METJA      KHLEEL----AKSIKEVRNC----VTEYD------L-GN--KKIYLLGEGRLVNLAC--A
SIHH_METMP      NDLKEL----SKSVKEARFN----IEEYD------L-GN--KKIYLLGEGRLVNLAC--A
                                 .                         : ::..***:**    .

SAHH_ACIAD      TGHPSRVMDGSFANQVLGQIHLFQEKFADLPASEKAAQIRVEVLPKKLDEEVAAAMVLGF
SAHH_HAHCH      TGHPSRIMDGSFANQVLAQMYLFERKFADLPADEKPKNLYVRVLPKQLDEEVARYMVQGF
SAHH_PSEE4      TGHPSRIMDGSFANQVLAQIFLFEQKFAELPAAKKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSE14      TGHPSRIMDGSFANQVLAQIFLFEQKYADLAPAKKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEU2      TGHPSRIMDGSFANQVLAQIFLFEQKYADLAPAKKSERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSESM      TGHPSRIMDGSFANQVLAQIFLFDQKYADLAPAKKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEFS      TGHPSRIMDGSFANQVLAQIFLFGQKYADLSPAQKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEF5      TGHPSRIMDGSFANQVLAQIFLFGQKYADLSPAQKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEPF      TGHPSRIMDGSFANQVLAQIFLFGQKYADLSPAQKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEPW      TGHPSRIMDGSFANQVLAQIFLFEQKFADLSAEKKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEP1      TGHPSRIMDGSFANQVLAQIFLFEQKFADLPAEKKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEPG      TGHPSRIMDGSFANQVLAQIFLFEQKYADLSAEKKAERLTVEVLPKKLDEEVALEMVRGF
SAHH_PSEU5      TGHPSRIMDGSFANQVLAQIHLYNEKFADLPVAEKTQNVTVMVLPKKLDEEVALEMVKGF
SAHH_PSEMY      TGHPSRIMDGSFANQVLAQIFLFEQKFADLPAEKKAERLTVEVLPKKLDEEVALEMVKGF
SAHH_PSEAE      TGHPSRIMDGSFANQVLAQIHLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGF
SAHH_PSEA8      TGHPSRIMDGSFANQVLAQIHLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGF
SAHH_PSEAB      TGHPSRIMDGSFANQVLAQIHLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGF
SAHH_STRAZ      TGHPSFVMSNSFADQTLAQIELFTK-------PDEYPTD-VYVLPKHLDEKVARLHLDAL
SAHH_STRGG      TGHPSFVMSNSFADQTLAQIELFTK-------PEDYPTD-VYVLPKHLDEKVARLHLDAL
SAHH_STRAA      TGHPSFVMSNSFADQTLAQIELFTK-------PGDYPTG-VYTLPKHLDEKVARLHLDAL
SAHH_STRAW      TGHPSFVMSNSFADQTLAQIELFTK-------PDEYPTD-VYVLPKHLDEKVARLHLDSL
SAHH_STRCO      TGHPSFVMSNSFADQTLAQIELFTK-------PDEYPTD-VYVLPKHLDEKVARLHLDSL
SAHH_CORDI      TGHPSFVMSTSFADQTIAQIELFQN-------DGRYVNE-VYRLPKILDEKVARIHVEAL
SAHH_COREF      TGHPSFVMSTSFADQTIAQIELFQN-------EGQYENQ-VYRLPKILDEKVARIHVEAL
SAHH_CORGL      TGHPSFVMSNSFADQTIAQIELFQN-------EGQYENE-VYRLPKVLDEKVARIHVEAL
SAHH_CORGB      TGHPSFVMSNSFADQTIAQIELFQN-------EGQYENE-VYRLPKVLDEKVARIHVEAL
SAHH_MYCPA      TGHPSFVMSNSFSNQVIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCLE      TGHPSFVMSNSFANQTIAQIELWTK-------NDDYDNE-VYRLPKHLDEKVARVHVEAL
SAHH_MYCLB      TGHPSFVMSNSFANQTIAQIELWTK-------NDDYDNE-VYRLPKHLDEKVARVHVEAL
SAHH_MYCBO      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCBP      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCBT      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCTU      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCTA      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCMM      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCUA      TGHPSFVMSNSFANQTIAQIELWTK-------NDEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_NOCFA      TGHPSFVMSNSFSNQVIAQIELWTK-------PEEYDNE-VYRLPKHLDEKVARIHVEAL
SAHH_MYCSJ      TGHPSFVMSNSFSNQVIAQIELWTK-------NDEYDNA-VYRLAKHLDEKVARIHVEAL
SAHH_MYCSK      TGHPSFVMSNSFSNQVIAQIELWTK-------NDEYDNA-VYRLAKHLDEKVARIHVEAL
SAHH_MYCSS      TGHPSFVMSNSFSNQVIAQIELWTK-------NDEYDNA-VYRLAKHLDEKVARIHVEAL
SAHH_PELCD      TGHPSFVMSNSFTNQVLAQIELWQN-------SDRYENK-VYVLPKQLDEKVARLHLANL
SAHH_BDEBA      TGHPSFVMSNSFTNQVLAQMELFNN-------RDKYQDIAVYRLPKHLDEKVAALHLDKL
SAHH_GRAFK      TGHPSFVMSNSFTNQTLAQIELWKN-------TDEYKNE-VYMLPKHLDEKVAKLHLERI
SAHH_FLAJ1      TGHPSFVMSNSFTNQTLAQIELWNN-------SAAYKNE-VYMLPKHLDEKVAALHLAKL
SAHH_FLAPJ      TGHPSFVMSNSFTNQTLAQIELWKN-------SAAYNND-VYMLPKHLDEKVAFLHLAKL
SAHH_RHOBA      TGHPSFVMSSSFTNQVLAQMELYQN-----RDNDKYGVQ-VYLLPKELDEEVARLHLEAI
SAHH_DESAD      TGHPSFVMSNSFTNQALAQIDLAKN---------EYEPK-VMILSKKLDEEVARLHLERL
SAHH_DESAG      TGHPSFVMSNSFTNQVLAQLELASN--------PDLERK-VYILPKKLDEEVARLHLARL
SAHH_DESVH      TGHPSFVMSASFTNQTLAQIELATN--------PDLERK-VYTLPKKLDEEVARLHLDRL
SAHH_DESVV      TGHPSFVMSASFTNQTLAQIELATN--------PDLERK-VYTLPKKLDEEVARLHLDRL
SAHH_DESVM      TGHPSFVMSNSFTNQTLAQIELATN--------PDLERK-VYILPKKLDEQVARLHLARL
SAHH_GRABC      TGHPSFVMSASFTNQVLAQIELWQA------KPGQYLPNHVYTLPKHLDEKVAALHLAKV
SAHH_ZYMMO      TGHPSFVMSASFTNQVLAQIELFCN-------TDKYQKD-VYMLPKHLDEKVAALHLPKL
SAHH_NOVAD      TGHPSFVMSSSFTNQVLAQIELFTK-------NAEYKNE-VYVLPKHLDEKVAALHLEKL
SAHH_SPHAL      TGHPSFVMSASFTNQTLAQIELWTR-------SEQYQND-VYVLPKHLDEKVAALHLEKL
SAHH_ROSDO      TGHPSFVMSASFTNQVLAQIELWTR-------ADAYDNE-VYILPKHLDEKVARLHLDRI
SAHH_RHOCB      TGHPSFVMSASFTNQVLAQIELWTK-------GAEYQPG-VYILPKSLDEKVARLHLKKI
SAHH_RHOSH      TGHPSFVMSASFTNQVLAQIELWTK-------GADYQPG-VYILPKALDEKVARLHLKKI
SAHH_BARQU      TGHPSFVMSASFTNQVLAQIELFTR-------AEHYKNE-VTVLPKRLDEKVARLHLDRL
SAHH_BARHE      TGHPSFVMSASFTNQVLAQIELFTR-------SGHYKNE-VTVLPKYLDEKVARLHLDQL
SAHH_BART1      TGHPSFVMSASFTNQVLAQIELFTR-------AEHYTNE-VTVLPKNLDEKVARLHLDRL
SAHH_AGRFC      TGHPSFVMSASFTNQVLGQIELFTK-------PGEYKNE-VYVLPKHLDEKVARLHLEKL
SAHH_RHIME      TGHPSFVMSASFSNQVLAQIELFTK-------GEQYKNE-VYVLPKQLDEKVARLHLAKL
SAHH_SINMW      TGHPSFVMSASFSNQVLAQIELFTK-------GENYKNE-VYVLPKQLDEKVARLHLAKL
SAHH_AGRRK      TGHPSFVMSASFTNQTLAQIELFTK-------PGQYQNQ-VYVLPKHLDEKVARLHLGKL
SAHH_RHILW      TGHPSFVMSASFTNQTLAQIELFTK-------PDQYSNQ-VYILPKHLDEKVARLHLDKL
SAHH_RHIL3      TGHPSFVMSASFTNQTLAQIELFTK-------PDQYSNQ-VYILPKHLDEKVARLHLDKL
SAHH_RHIEC      TGHPSFVMSASFTNQTLAQIELFTK-------PGQYENK-VYILPKHLDEKVARLHLDKL
SAHH_RHIE6      TGHPSFVMSASFTNQTLAQIELFTK-------PGQYENK-VYILPKHLDEKVARLHLDKL
SAHH_CHESB      TGHPSFVMSASFTNQVLAQIELWTR-------GSQYENK-VYVLPKHLDEKVARLHLAKL
SAHH_RHILO      TGHPSFVMSASFTNQVLAQIELFTK-------GEQYQNQ-VYVLPKHLDEKVARLHLDKL
SAHH_OCHA4      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUO2      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUAB      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUA2      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUA1      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUC2      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUSU      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUSI      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUME      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_BRUMB      TGHPSFVMSASFTNQVLGQIELFTR-------TDAYKNE-VYVLPKHLDEKVARLHLDKL
SAHH_MARMM      TGHPSFVMSASFTNQTLAQIELWTK-------GENYTNE-VYILPKHLDEKVAALHLDKL
SAHH_HYPNA      TGHPSFVMSASFTNQTLAQIELHLR-------GNEYDNK-VYTLPKHLDEKVARLHLDKL
SAHH_CAUVC      TGHPSFVMSASFTNQTLAQIELWTN-------KAKYENQ-VYTLPKHLDEKVAFLHLEKL
SAHH_RHOPA      MGHPSFVMSASFTNQTLAQIELFQN-------QGKYEKK-VYVLPKTLDEKVARLHLAKI
SAHH_RHOPT      MGHPSFVMSASFTNQTLAQIELFQN-------QGKYEKK-VYVLPKSLDEKVARLHLAKI
SAHH_RHOPS      TGHPSFVMSASFTNQTLAQIELFAN-----NKDGKYKKE-VYVLPKSLDEKVARLHLAKI
SAHH_RHOP2      MGHPSFVMSASFTNQTLAQIELFAN-----NKDGKYKKE-VYVLPKSLDEKVARLHLAKI
SAHH_BRADU      MGHPSFVMSASFTNQTLAQIELFAN-----NKDGKYKKE-VYVLPKTLDEKVARLHLAKI
SAHH_BRASB      MGHPSFVMSASFTNQTLAQIELYAN-----NKDGKYKKE-VYVLPKSLDEKVARLHLAKI
SAHH_METC4      TGHPSFVMSASFTNQTLAQIELWTN-------PGKYERQ-VYTLPKALDEKVAALHLEKI
SAHH_METEP      TGHPSFVMSASFTNQTLAQIELWTN-------PGKYERQ-VYTLPKALDEKVAALHLEKI
SAHH_METPB      TGHPSFVMSASFTNQTLAQIELWTN-------PGKYERQ-VYTLPKTLDEKVAALHLEKI
SAHH_METNO      MGHPSFVMSASFTNQTLAQIELWTN-------QGKYDRQ-VYTLPKALDEKVAALHLEKI
SAHH_METS4      MGHPSFVMSASFTNQTLAQIELWTN-------QGKYENQ-VYTLPKTLDEKVAALHLEKI
SAHH_PROMP      TGHPSFVMSNSFTNQVLAQIELFNK-------SDEYSKE-VYVLPKHLDEMVARLHLDKI
SAHH_PROM9      TGHPSFVMSNSFTNQVLAQIELFNK-------SEKYAKE-VYVLPKHLDEMVARLHLDKI
SAHH_PROM2      TGHPSFVMSNSFTNQVLAQIELFNK-------SEQYAKE-VYVLPKHLDEMVARLHLDKI
SAHH_PROM0      TGHPSFVMSNSFTNQVLAQIELFNK-------SEQYAKE-VYVLPKHLDEMVARLHLDKI
SAHH_PROM3      TGHPSFVMSNSFTNQVLAQIELFSK-------GDKYADQ-VYVLPKHLDEMVARLHLEKI
SAHH_PROMM      TGHPSFVMSNSFTNQVLAQIELFSK-------GDQYADQ-VYVLPKHLDEMVARLHLEKI
SAHH_SYNS3      TGHPSFVMSNSFTNQVLAQIELFTK-------GSEYGKE-VYVLPKHLDEMVARLHLEKI
SAHH_SYNS9      TGHPSFVMSNSFTNQVLAQIELFTK-------ANEYGKE-VYVLPKHLDEMVARLHLSKI
SAHH_SYNSC      TGHPSFVMSNSFTNQVLAQIELFTK-------GDEYAKE-VYVLPKHLDEMVARLHLGRI
SAHH_SYNPW      TGHPSFVMSNSFTNQVLAQIELFTK-------GNEYGKE-VYVLPKHLDEMVARLHLDRI
SAHH_SYNPX      TGHPSFVMSNSFTNQVLAQIELFTK-------GNEYGKE-VYVLPKHLDEMVARLHLDRI
SAHH_PROMA      TGHPSFVMSNSFTNQVLAQIELFKK-------GDSYQNN-VYVLPKHLDEMVARLHLDKI
SAHH_PROM4      TGHPSFVMSNSFTNQVLAQIELFTQ-------GSNYDNQ-VYILPKHLDELVARLHLDKI
SAHH_MYXXD      TGHPSYVMSSSFANQTIAQIELYSH-------SANYEVGKVYVLPKHLDEKVARLQLKKL
SAHH_LEPCP      TGHPSFVMSSSFANQTIAQIELFCH-------PDGYDVGKVYVLPKHLDEKVARLHLKKV
SAHH_ACISJ      TGHPSFVMSNSFANQTIAQIELFTH-------PEGYDVGKVYVLPKHLDEKVARLHLKKV
SAHH_ACIET      TGHPSFVMSNSFANQTIAQIELFTH-------PEGYDVGKVYVLPKHLDEKVARLHLKKV
SAHH_DELAS      TGHPSFVMSASFANQTIAQIELFTK-------PDAYEVGKVYVLPKILDEKVARLHLKKV
SAHH_METPP      TGHPSFVMSSSFANQTIAQIELFTK-------SADYQVGKVYVLPKHLDEKVARLHLKKV
SAHH_ACIAC      TGHPSFVMSSSFANQTIAQIELFTK-------PDAYQAGKVYVLPKVLDEKVARLHLKKV
SAHH_VARPS      TGHPSFVMSSSFANQTIAQIELFTK-------PDAYQAGKVYVLPKHLDEKVARLHLKKV
SAHH_HERAR      TGHPSYVMSSSFANQTIAQIELYAN-------TKNYPVG-VYTLPKHLDEKVARLQLKKL
SAHH_JANMA      TGHPSYVMSSSFANQTIAQIELYAN-------TKNYPVG-VYTLPKHLDEKVARLQLKKL
SAHH_BORPD      TGHPSFVMSSSFANQTIAQIELYTR-------NEAYTRGQVYVLPKHLDEKVARLHLKKL
SAHH_BORBR      TGHPSFVMSSSFANQTIAQIELFTR-------NEAYTTGQVYVLPKHLDEKVARLHLKKL
SAHH_BORPA      TGHPSFVMSSSFANQTIAQIELFTR-------NEAYTTGQVYVLPKHLDEKVARLHLKKL
SAHH_BORPE      TGHPSFVMSSSFANQTIAQIELFTR-------NEAYTTGQVYVLPKHLDEKVARLHLKKL
SAHH_POLNS      TGHPSYVMSSSFANQVIAQIELWNA-----VGTNKYPVG-VYTLPKHLDEKVARLQLKKL
SAHH_POLAQ      TGHPSYVMSSSFANQVIAQIELWNA-----VGTDKYPIG-VYTLPKHLDEKVARLQLKTL
SAHH_AROAE      TGHPSYVMSSSFANQTIAQIELFTR-------TADYPVG-VYTLPKHLDEKVARLQLKKL
SAHH_RALPJ      TGHPSYVMSSSFANQTIAQIELWTE---AVKGSNKYPVG-VYTLPKHLDEKVARLQLKKL
SAHH_RALSO      TGHPSYVMSSSFANQTIAQIELWTE---AQKGSSKYPVG-VYTLPKHLDEKVARLQLKKL
SAHH_CUPMC      TGHPSYVMSSSFANQTIAQIELWAE-----RDSGKYPVG-VYVLPKHLDEKVARLQLRKL
SAHH_CUPPJ      TGHPSYVMSSSFANQTIAQIELWQE-----RDSGKYPVG-VYTLPKHLDEKVARLQLRKL
SAHH_CUPTR      TGHPSYVMSSSFANQTIAQIELWQE-----RDSGKYPVG-VYTLPKHLDEKVARLQLRKL
SAHH_CUPNH      TGHPSYVMSSSFANQTIAQIELWQE-----RDSGKYPVG-VYTLPKHLDEKVARLQLRKL
SAHH_GEOSL      TGHPSYVMSSSFANQTLAQIELFCN-------PGKYPVG-VYMLPKELDEKVARLQLKTL
SAHH_NITEU      TGHPSFVMSSSFTNQVLAQIELWQN-------GKDYQKK-VYVLPKRLDEMVARLHLGKL
SAHH_NITEC      TGHPSFVMSSSFTNQVLAQMELWQN-------GKDYQKK-VYVLPKQLDEMVARLHLGKL
SAHH_METCA      TGHPSFVMSNSFTNQTLAQIELFCH-------GAKYENK-VYVLPKHLDEKVARLHLKKI
SAHH_CHRVO      TGHPSFVMSNSFTNQVLAQIELFAN-------GHKYEKK-VYVLPKHLDEKVARLHLARI
SAHH_BURMA      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURM9      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURM7      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURMS      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURPS      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURP0      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURP1      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURP6      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_BURTA      TGHPSFVMSNSFTNQTLAQIELFTR-------GGEYANK-VYVLPKHLDEKVARLHLARI
SAHH_PARP8      TGHPSFVMSNSFTNQTLAQIELFVE-------GSKYENK-VYVLPKQLDEKVARLHLARI
SAHH_PARPJ      TGHPSFVMSNSFTNQTLAQIELFTQ-------GEKYENK-VYVLPKHLDEKVARLHLARI
SAHH_PARXL      TGHPSFVMSNSFTNQTLAQIELFTQ-------GNKYENK-VYVLPKHLDEKVARLHLARI
SAHH_HALHL      TGHPSFVMSNSFTNQVMAQMELYNN-------PGKYEKD-VYVLPKHLDEKVAALHLGRV
SAHH_COXB1      TGHPSFVMSNSFTNQVLAQIELWQY-------PEKYPIG-VYVLPKHLDEEVARLHLERV
SAHH_COXBU      TGHPSFVMSNSFTNQVLAQIELWQY-------PEKYPIG-VYVLPKHLDEEVARLHLERV
SAHH_COXB2      TGHPSFVMSNSFTNQVLAQIELWQY-------PEKYPIG-VYVLPKHLDEEVARLHLERV
SAHH_COXBN      TGHPSFVMSNSFTNQVLAQIELWQY-------PEKYPIG-VYVLPKHLDEEVARLHLERV
SAHH_LEPBJ      TGHPSFVMSCSFTNQVLAQIELYNN---------KYELG-VYTLPKHLDEKVAALHLEQL
SAHH_LEPBL      TGHPSFVMSCSFTNQVLAQIELYNN---------KYELG-VYTLPKHLDEKVAALHLEQL
SAHH_LEPIN      TGHPSFVMSCSFTNQVLAQIELYNN---------KYELG-VYTLPKHLDEKVAALHLEQL
SAHH_LEPIC      TGHPSFVMSCSFTNQVLAQIELYNN---------KYELG-VYTLPKHLDEKVAALHLEQL
SAHH_SOLUE      TGHPSFVMSNSFANQTLAQLDLWKN-------KDTYKVG-VYTLPKKLDEEVARLHLEKI
SAHH_XYLFM      TGHPSFVMSNSFANQTLAQIDLWQN-------KDVYEKN-VYRLPKKLDEEVARLHLEKI
SAHH_XYLFA      TGHPSFVMSNSFANQTLAQIDLWQN-------KDVYEKN-VYRLPKKLDEEVARLHLEKI
SAHH_XYLF2      TGHPSFVMSNSFANQTLAQIDLWQN-------KDVYEKN-VYRLPKKLDEEVARLHLEKI
SAHH_XYLFT      TGHPSFVMSNSFANQTLAQIDLWQN-------KDVYEKN-VYRLPKKLDEEVARLHLEKI
SAHH_XANCP      TGHPSFVMSNSFANQTLAQIDLWEK-------RDSYEKK-VYILPKHLDEEVARLHLEKI
SAHH_XANC8      TGHPSFVMSNSFANQTLAQIDLWEK-------RDSYEKK-VYILPKHLDEEVARLHLEKI
SAHH_XANOM      TGHPSFVMSNSFANQTLAQIDLWEK-------RDTYEKK-VYILPKHLDEEVARLHLEKI
SAHH_XANOP      TGHPSFVMSNSFANQTLAQIDLWEK-------RDTYEKK-VYILPKHLDEEVARLHLEKI
SAHH_XANC5      TGHPSFVMSNSFANQTLAQIDLWEK-------RDTYEKK-VYILPKHLDEEVARLHLEKI
SAHH_XANAC      TGHPSFVMSNSFANQTLAQIDLWEK-------RDTYEKK-VYILPKHLDEEVARLHLEKI
SAHH_BACFR      TGHPSFVMSNSFTNQTLAQIELFNK---------KYDIN-VYRLPKHLDEEVARLHLEKI
SAHH_BACTN      TGHPSFVMSNSFTNQTLAQIELFNK---------KYEVN-VYRLPKHLDEEVARLHLEKI
SAHH_CHLL2      TGHPSFVMSNSFTNQTLAQIELWTK---------EYSID-VYRLPKELDEEVARLHLGQL
SAHH_CHLPD      TGHPSFVMSNSFTNQTLAQLELWTR---------DYAID-VYRLPKQLDEEVARLHLEQL
SAHH_PELPB      TGHPSFVMSNSFTNQTLAQIELWTK---------DYAVG-VYRLPKELDEEVARLHLEQL
SAHH_PELLD      TGHPSFVMSNSFTNQTLAQIELWKN---------DYKVD-VYRLPKALDEEVARLHLEQI
SAHH_CHLPM      TGHPSFVMSNSFTNQTLAQIELWKN---------DYEIG-VYRLPKALDEEVARLHLEQI
SAHH_CHLCH      TGHPSFVMSNSFTNQTLAQIELWQK---------EYAVD-VYRLPKALDEEVARLHLEQI
SAHH_CHLP8      TGHPSFVMSNSFTNQTLAQIELWKN---------NYDVD-VYRLPKHLDEEVARLHLGQI
SAHH_CHLTE      TGHPSFVMSNSFTNQTLAQIELWQN---------DYKVG-VYRLPKKLDEEVARLHLGQI
SAHH_THEAC      QGHPVEIMDLSFALQALTAEYLVKN-------HDKLERK-VYPVPADIDRYVAEIRLKQF
SAHH_THEVO      QGHPVEIMDLSFALQALTAEYLVKN-------HQNLEKK-VYPVPPEIDRYVAEIRLKQF
SAHH_HALSA      LGHPVGVMDQSFGVQAVCVRELVAN-------REEYAAG-VHNVPDELDIEIAEIKLAAE
SAHH_HALWD      LGHPAEVMDQSFGIQAVCVRELIEN-------KSSYDAG-VHNVPDELDREVAEIKLKAE
SAHH_THEMA      DGHPVEIMDLSFALQIFAVLYLLEN-------HRKMSPK-VYMLPDEIDERVARMKLDSL
SAHH_GLOVI      EGHPASVMDMSFANQALAVEYLIKN-------QGKLSPG-IYNIPEELDRQIAALKLAAM
SAHH_GLOC7      EGHPSAVMDMSFANQALACEYLVKN-------KGKLEPG-IYNIPTEIDQEIARLKLQGM
SAHH_NOSS1      EGHPSAVMDMSFANQALACEYLVKN-------KGKLAPG-LHSIPVEVDQEIARLKLQAM
SAHH_THEEB      EGHPASVMDMSFANQALGCEYLVKN-------KGQLAAG-IHPIPAAVDQEIARLKLQAM
SAHH_SYNY3      EGHPSAVMDMSFANQALACEHLVKN-------KGQLEPG-MHSIPVEVDQEIARLKLQAM
SIHH_METTH      QGHPAEIMDMSFAMQALSARHLLQE---------KPDPG-VYRAPDEIDLMVARMKLDAM
SAHH_AERPE      EGHPSEVMDMSFSNQALAVLKIAGE-------RGRLEKR-VHRVERIQDEMVARLKLETM
SIHH_METKA      EGHPIEIMDISFALQALSVEVLAKE-------GKEMEPG-VYKVPKDVDKRVAELKLESM
SAHH_PYRAE      EGHPSEVMDLSFANQALAAEFLAKN---------KLSVD-VYKLPDEIDREVARLKLKTM
SAHH_SACS2      EGHPSEVMDMSFANQALAVEYLVKN-------RGKLEKK-VYNMPMELDYEVARIKLKSM
SAHH_SULAC      EGHPSEVMDLSFCNQALSVEHLIKN-------KGKLENK-VYNVPIEIDEQVARLKLKAL
SAHH_SULTO      EGHPSEVMDLSFSNQALSVKYIYEN-------RGKLENK-VYNVPQEIDETVAKLKLNGM
SAHH_AQUAE      EGHPASVMDMSFSNQALSAEYIVKH-------HKELEKK-VYRVPREIDEAVARLKLNAL
SAHH_THEKO      DGHPAEIMDMSFALQAKAAEYIKEN-------RGRLEPK-VYVLPREIDEMVARIKLASM
SAHH_PYRAB      DGHPAEIMDMSFALQAKAAEYIKEN-------HERLEPR-VYVLPREIDEMVARIKLQSM
SAHH_PYRFU      DGHPAEIMDMSFALQAKAAEYIKDN-------HERLEPK-VYILPREIDEMVARIKLESM
SAHH_PYRHO      DGHPAEIMDMSFALQAKAAEYIKDN-------HGKLEPR-VYILPREIDEMVARIKLASM
SIHH_METAC      DGHPAEVMDMSFANQALCVRYIAEN---------TLLNG-VHGVPRGIDTYVAKLKLESM
SIHH_METMA      DGHPAEVMDMSFANQALCVRYIAEN---------KLSSG-VHGVPRELDTYVAKLKLESM
SAHH_ARCFU      DGHPVEVMDMSFANQALAAKYIAEN-------WQKLERK-VYRLPEELDRMVARMKLESM
SIHH_METJA      DGHPCEVMDMSFANQALAAEYILKN-------HEKLEPR-VYNIPYEQDLMIASLKLKAM
SIHH_METMP      DGHPCEVMDMSFANQALSAKFIKEN-------KGKLENE-VYEIPYEQDFKIALLKLHSM
                 ***  :*. **  *      :                  :       *  :*   :   

SAHH_ACIAD      GGVLTQLTSVQADYLGVPVEGPFKSDAYKY
SAHH_HAHCH      GGVITKLTQPQAKYIGVEVEGPYKPTDYKY
SAHH_PSEE4      GGVVTQLTPQQAEYIGVTVEGPFKPDAYRY
SAHH_PSE14      GGVVTKLTKTQADYIGVTVEGPFKPHAYRY
SAHH_PSEU2      GGVVTKLTKTQADYIGVTVEGPFKPDAYRY
SAHH_PSESM      GGVVTKLTKTQADYIGVTVEGPFKPDAYRY
SAHH_PSEFS      GGVVTQLTKTQADYIGVTVEGPFKPHAYRY
SAHH_PSEF5      GGVVTQLTKQQAEYIGVTVEGPFKPDAYRY
SAHH_PSEPF      GGVVTQLTKQQADYIGVTVEGPFKPHAYRY
SAHH_PSEPW      GGVVTKLTQQQADYIGVTVEGPFKPHAYRY
SAHH_PSEP1      GGVVTQLTKQQADYIGVTVEGPFKPHAYRY
SAHH_PSEPG      GGVVTKLTKQQADYIGVTVEGPFKPHAYRY
SAHH_PSEU5      GGVVTQLTAKQAEYIGVAVEGPFKPDSYRY
SAHH_PSEMY      GGVVTQLTKQQAEYIGVTVEGPFKPDTYRY
SAHH_PSEAE      GGVVTQLTPKQAEYIGVSVEGPFKPDTYRY
SAHH_PSEA8      GGVVTQLTPKQAEYIGVSVEGPFKPDTYRY
SAHH_PSEAB      GGVVTQLTPKQAEYIGVSVEGPFKPDTYRY
SAHH_STRAZ      GVKLTTLRPEQASYIGVEVDGPYKPDHYRY
SAHH_STRGG      GVKLTTLRPEQAAYIGVEVEGPYKPDHYRY
SAHH_STRAA      GVKLTTLRPEQASYIGVDVDGPYKSDHYRY
SAHH_STRAW      GVKLTTLRPEQAAYIGVEVEGPFKSDHYRY
SAHH_STRCO      GVKLTTLRPEQADYIGVKVEGPYKADHYRY
SAHH_CORDI      GGTITELTKEQAEYIGVDVAGPYKPEHYRY
SAHH_COREF      GGKLTELTKEQAEYIGVDVAGPFKPEHYRY
SAHH_CORGL      GGQLTELTKEQAEYIGVDVAGPFKPEHYRY
SAHH_CORGB      GGQLTELTKEQAEYIGVDVAGPFKPEHYRY
SAHH_MYCPA      GGELTKLTKEQAEYIGVDVDGPYKADHYRY
SAHH_MYCLE      GGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
SAHH_MYCLB      GGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
SAHH_MYCBO      GGHLTKLTKEQAEYLGVDVEGPYKPDHYRY
SAHH_MYCBP      GGHLTKLTKEQAEYLGVDVEGPYKPDHYRY
SAHH_MYCBT      GGHLTKLTKEQAEYLGVDVEGPYKPDHYRY
SAHH_MYCTU      GGHLTKLTKEQAEYLGVDVEGPYKPDHYRY
SAHH_MYCTA      GGHLTKLTKEQAEYLGVDVEGPYKPDHYRY
SAHH_MYCMM      GGRLTKLTKDQAEYLGVDVEGPYKPDHYRY
SAHH_MYCUA      GGRLTKLTKDQAEYLGVDVEGPYKPDHYRY
SAHH_NOCFA      GGTLTKLTKDQAEYIGVDVEGPYKPEHYRY
SAHH_MYCSJ      GGTLTKLTKEQAEYINVDVEGPYKPEHYRY
SAHH_MYCSK      GGTLTKLTKEQAEYINVDVEGPYKPEHYRY
SAHH_MYCSS      GGTLTKLTKEQAEYINVDVEGPYKPEHYRY
SAHH_PELCD      GVKLTRMTEKQADYLGVPVDGPYKPEHYRY
SAHH_BDEBA      GVKLTKLSSKQAKYLHMSPQGPFKPEHYRY
SAHH_GRAFK      GVELTELKQDQAEYIGVTVEGPYKPEYYRY
SAHH_FLAJ1      GVELEVLREDQAAYIGVEVQGPFKPEYYRY
SAHH_FLAPJ      GVELEVLRDDQAAYIGVGVDGPFKPEYYRY
SAHH_RHOBA      GVKLTKLTQEQADYIGVPVEGPYKPNHYRY
SAHH_DESAD      GVELDVLSKEQADYISVDVEGPYKPDHYRY
SAHH_DESAG      GAKLTTLTDEQAEYIGVDKTGPFKPDHYRY
SAHH_DESVH      GVKLTRLSKDQADYIGVSPEGPFKPDHYRY
SAHH_DESVV      GVKLTRLSKDQADYIGVSPEGPFKPDHYRY
SAHH_DESVM      GVTLTTLTKEQADYIGVPVDGPYKPGHYRY
SAHH_GRABC      GAKLTKLSDKQAEYIGVSQAGPFKHDLYRY
SAHH_ZYMMO      GVHLSKLTQKQADYIGVPVNGPFKPDHYRY
SAHH_NOVAD      GVKLTKLSKKQADYIGVSQEGPFKPDHYRY
SAHH_SPHAL      GVKLTKLTQKQADYIGVPVEGPFKPDHYRY
SAHH_ROSDO      GVKLTPLDPEQAAYIGVKPEGPFKPEHYRY
SAHH_RHOCB      GVKLTTLRPDQAEYIGVTVEGPFKSDHYRY
SAHH_RHOSH      GVKLTDVRPEQADYIGVKVEGPFKAEHYRY
SAHH_BARQU      GVKLSVLSEEQAVYIGVTPQGPYKPNHYRY
SAHH_BARHE      GIKLTTLSQEQAAYIGVTPQGPYKPDHYRY
SAHH_BART1      GIKLTVLSEEQAAYIGVTPQGPYKPNHYRY
SAHH_AGRFC      GVRLTELSDLQADYIGISKQGPFKAEHYRY
SAHH_RHIME      GAKLTELSEEQASYIGVKQQGPFKAEHYRY
SAHH_SINMW      GAKLTELSEEQAAYIGVKAQGPFKAEHYRY
SAHH_AGRRK      GVKLTELSGEQAAYIGVTPQGPFKSDHYRY
SAHH_RHILW      GVKLTQLSEEQAAYIGVSPKGPFKSDHYRY
SAHH_RHIL3      GVKLTELSEEQAAYIGVSPKGPFKSDHYRY
SAHH_RHIEC      GVKLTQLSEEQAAYIGVKPQGPFKSDHYRY
SAHH_RHIE6      GVKLTQLSEEQAAYIGVSPKGPFKSDHYRY
SAHH_CHESB      GANLTKLSPEQAAYIGVTPEGPFKPDHYRY
SAHH_RHILO      GARLTELSGEQAAYIGVTPQGPFKPEHYRY
SAHH_OCHA4      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUO2      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUAB      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUA2      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUA1      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUC2      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUSU      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUSI      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUME      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_BRUMB      GAKLTVLSEEQAAYIGVTPQGPFKSEHYRY
SAHH_MARMM      GAKLTVLSDEQADYIGVPQHGPFKAEHYRY
SAHH_HYPNA      GVQLTKLSGEQAAYIGVEQTGPFKPEHYRY
SAHH_CAUVC      GAKLTTLRKDQADYIGVPEAGPFKPDHYRY
SAHH_RHOPA      GVKLTELRKDQADYIGVKVEGPFKADHYRY
SAHH_RHOPT      GVKLTELRKDQADYIGVKVEGPFKADHYRY
SAHH_RHOPS      GVKLTELRKDQADYIGVKVEGPFKADHYRY
SAHH_RHOP2      GVKLTELRKDQADYIGVKVEGPFKADHYRY
SAHH_BRADU      GVKLTELRKDQADYIGVKQEGPYKSDHYRY
SAHH_BRASB      GVKLTELRPDQAAYIGVKQEGPFKSDHYRY
SAHH_METC4      GVKLSKLRPDQAAYIGVSQTGPFKPEHYRY
SAHH_METEP      GVKLSKLRPDQAAYIGVSQTGPFKPEHYRY
SAHH_METPB      GVKLSKLRPDQAAYIGVSQNGPFKPEHYRY
SAHH_METNO      GVKLTKLRPDQAAYIGVSENGPFKPDHYRY
SAHH_METS4      GVKLTTLRPDQAAYIGVQASGPFKPDHYRY
SAHH_PROMP      GAKLTKLTKDQADYINVSVEGPYKPEQYRY
SAHH_PROM9      GAKLTKLTEEQADYINVSVEGPYKPELYRY
SAHH_PROM2      GAKLTKLTKEQADYINVSVEGPYKSELYRY
SAHH_PROM0      GAKLTKLTKEQADYISVSVEGPYKSEFYRY
SAHH_PROM3      GARLTELTKQQADYISVPIEGPYKPDHYRY
SAHH_PROMM      GARLTELTKQQADYISVPVEGPYKPDHYRY
SAHH_SYNS3      GCKLTELSKDQADYINVPVEGPYKPDHYRY
SAHH_SYNS9      GANLTELSKDQADYINVPVEGPYKPDHYRY
SAHH_SYNSC      GANLTELSKDQADYINVPVEGPYKPDHYRY
SAHH_SYNPW      GAKLTELSKDQADYINVPVEGPFKPDHYRY
SAHH_SYNPX      GAKLTELSKDQADYINVPVEGPYKPDHYRY
SAHH_PROMA      GANLTELSKEQADYINVPIEGPYKSEQYRY
SAHH_PROM4      GANLTELTEEQAAYINVPIKGPYKSEQYRY
SAHH_MYXXD      NAQLTELSQEQADYIGVKTSGPYKPDTYRY
SAHH_LEPCP      GAMLTELTDDQAAYIGVPKNGPYKPDTYRY
SAHH_ACISJ      GAMLTELSDEQAAYIGVPKQGPYKPDTYRY
SAHH_ACIET      GAMLTELSDEQAAYIGVPKQGPYKPDTYRY
SAHH_DELAS      GAMLTELTDGQAAYIGVSKQGPYKPETYRY
SAHH_METPP      GAMLTELTDEQAAYIGVSKSGPYKADTYRY
SAHH_ACIAC      GAQLTELTDAQAAYIGVKKEGPYKADTYRY
SAHH_VARPS      GAMLTELTDEQAAYIGVSKNGPYKPDTYRY
SAHH_HERAR      NSQLTTLTDEQANYIGVQKAGPYKPEHYRY
SAHH_JANMA      NAQLTTLTTEQANYIGVQQTGPYKPEHYRY
SAHH_BORPD      GAKLTSLRQDQADYINVPVEGPYKPDHYRY
SAHH_BORBR      GAKLSTLSKQQADYIGVPVEGPFKPGHYRY
SAHH_BORPA      GAKLSTLSKQQADYIGVPVEGPFKPGHYRY
SAHH_BORPE      GVKLSTLSKQQADYIGVPVEGPFKPDHYRY
SAHH_POLNS      NAQLTELTDQQAAYIGVTKEGPYKADHYRY
SAHH_POLAQ      NAELTVLSDQQASYIGVTKEGPYKADHYRY
SAHH_AROAE      NAQLTELRPDQAAYIGVPVEGPYKSAHYRY
SAHH_RALPJ      NAQLTELTDQQAAYIGVSKEGPYKADHYRY
SAHH_RALSO      NAQLTVLTDKQAAYIGVSKEGPYKADHYRY
SAHH_CUPMC      NAQLTELTEQQAAYIGVKKEGPYKADHYRY
SAHH_CUPPJ      NAQLTELTEQQAAYIGVKKEGPYKADHYRY
SAHH_CUPTR      NAQLTELTDQQAAYIGVKKEGPYKADHYRY
SAHH_CUPNH      NAQLTELTEQQAAYIGVKKEGPYKADHYRY
SAHH_GEOSL      GAMLTELTDEQAAYIGVPKNGPYKSAHYRY
SAHH_NITEU      GVKLTELTDEQAHYLNLDKNGPYKPEMYRY
SAHH_NITEC      GVKLTELTDEQAHYLNLDKNGPYKPEMYRY
SAHH_METCA      GARLTELSDEQAAYIGVPKEGPYKPDHYRY
SAHH_CHRVO      GARLTELSDQQAAYISVPKQGPYKPDHYRY
SAHH_BURMA      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURM9      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURM7      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURMS      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURPS      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURP0      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURP1      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURP6      GAQLSELSDDQAAYIGVSKAGPFKPDHYRY
SAHH_BURTA      GAQLSELSDDQAAYIGVPKAGPFKPDHYRY
SAHH_PARP8      GANLTELTSEQAGYIGVDKNGPFKPNHYRY
SAHH_PARPJ      GANLTVLSDDQAGYIGVDKNGPFKPNHYRY
SAHH_PARXL      GANLTVLSDEQAGYIGVDKNGPFKPNHYRY
SAHH_HALHL      GANLTRLSEEQAGYIGVSVDGPFKPEWYRY
SAHH_COXB1      GAKLTTLTEKQADYIGVDPEGPFKSEHYRY
SAHH_COXBU      GGKLTTLTEKQADYIGVDPEGPFKSEHYRY
SAHH_COXB2      GGKLTTLTEKQADYIGVDPEGPFKSEHYRY
SAHH_COXBN      GAKLTTLTEKQADYIGVDPEGPFKSEHYRY
SAHH_LEPBJ      GVRLTKLNQKQADYLGVPLNGPFKPENYRY
SAHH_LEPBL      GVRLTKLNQKQADYLGVPLNGPFKPENYRY
SAHH_LEPIN      GVRLTKLNQKQADYLGVPINGPFKPDHYRY
SAHH_LEPIC      GVRLTKLNQKQADYLGVPINGPFKPDHYRY
SAHH_SOLUE      GVKLTTLTPAQAEYLGVPVEGPYKPDHYRY
SAHH_XYLFM      GVKLTTLTANQAAYLGISVEGPFKPEHYRY
SAHH_XYLFA      GVKLTTLTANQAAYLGISVEGPFKPEHYRY
SAHH_XYLF2      GVKLTTLTANQAAYLGISVEGPFKPEHYRY
SAHH_XYLFT      GVKLTTLTANQAAYLGISVEGPFKPEHYRY
SAHH_XANCP      GVKLTTLTKDQADYLGVDVAGPYKPDHYRY
SAHH_XANC8      GVKLTTLTKDQADYLGVDVAGPYKPDHYRY
SAHH_XANOM      GVKLTTLTKDQADYLGVDVAGPYKPDHYRY
SAHH_XANOP      GVKLTTLTKDQADYLGVDVAGPYKPDHYRY
SAHH_XANC5      GVKLTTLTKDQADYLGVPVEGPFKPDHYRY
SAHH_XANAC      GVKLTTLTKDQADYLGVDVAGPYKPDHYRY
SAHH_BACFR      GVKLTKLTPEQAAYIGVSVDGPYKADHYRY
SAHH_BACTN      GVKLTKLTPEQAAYIGVSVDGPYKAEHYRY
SAHH_CHLL2      GVKLTTLSKEQADYLGIPVEGPYKPDHYRY
SAHH_CHLPD      GVKLTTLTNEQAEYIGVPLEGPYKPEHYRY
SAHH_PELPB      GVKLTRLSDEQAAYIGVPLDGPYKPEHYRY
SAHH_PELLD      GVKLTTLSKEQAEYIGVPVTGPYKPEHYRY
SAHH_CHLPM      GVKLTTLSKEQADYIGVPVSGPYKPEHYRY
SAHH_CHLCH      GVRLTRLTPEQAEYIGVSADGPYKPEHYRY
SAHH_CHLP8      GVKLTTLSKEQADYIGVPVEGPYKPEHYRY
SAHH_CHLTE      GAKLTTLTKEQADYIGVPVEGPYKPEHYRY
SAHH_THEAC      GGELDQLNEEQIKYLNSWDEGT--------
SAHH_THEVO      GGELDTLTEDQIKYLNSWDEGT--------
SAHH_HALSA      GVEYDALTDDQAEYMDSWQHGT--------
SAHH_HALWD      GVDIDSLTQTQSEYLDSWSHGT--------
SAHH_THEMA      GVKIDELTEKQRRYLRSWQ-----------
SAHH_GLOVI      GIAIDTLTPDQLHYISSWDEGTE-------
SAHH_GLOC7      GISIDSLTPEQEAYLNSWTSGT--------
SAHH_NOSS1      GIYIDSLTPEQIEYINSWTSGT--------
SAHH_THEEB      GIAIDTLTPEQVEYMNSWTSGT--------
SAHH_SYNY3      GIAIDSLTPEQVEYINSWASGT--------
SIHH_METTH      GIEIDELTEKQRLYLENWEEGT--------
SAHH_AERPE      GVRIDSLTEEQKLYLQKWK-----------
SIHH_METKA      GIELEELTPEQREYMKSWEEGT--------
SAHH_PYRAE      GIEIEELTEEQRRYISSWELGT--------
SAHH_SACS2      GIQIDELTEEQKEYLEQWKSGT--------
SAHH_SULAC      GIEIEELTIEQKEYIKQWKYGT--------
SAHH_SULTO      GIEIEPMTQEQIEYMKQWRYGT--------
SAHH_AQUAE      GIKIDELTEEQKKYLSSWEMGT--------
SAHH_THEKO      GIKIEELTEEQKKYLESWEHGT--------
SAHH_PYRAB      GINIEELTEEQKKYLESWQHGT--------
SAHH_PYRFU      GIKIEELTEEQKKYLESWEHGT--------
SAHH_PYRHO      GIEIEELTEEQKKYLESWEHGT--------
SIHH_METAC      GISIDELTSKQECYMTGWECGT--------
SIHH_METMA      GIATDELTSKQECYMSGWECGT--------
SAHH_ARCFU      GVEIDQLTEEQVRYLSDWRCGT--------
SIHH_METJA      GIEIDELTKEQKKYLEDWREGT--------
SIHH_METMP      GADIDELSPEQRKYLSDWKEGT--------
                .     :   *  *: