CLUSTAL format seed alignment for MF_00567

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NADA_ECOLC      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECOLI      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECO24      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_SHIFL      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_SHIF8      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_SHIBS      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECOHS      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECO57      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_SHIDS      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECOK1      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECOL5      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECOUT      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_ECOL6      ------MSVMFDPD---------TAI-YPFPPK-PTPLSIDEKAYYREKIKRLLKERNAV
NADA_SALPA      ------MSVMFDPQ---------AAI-YPFPPK-PTPLNDDEKQFYREKIKRLLKERNAV
NADA_SALTY      ------MSVMFDPQ---------AAI-YPFPPK-PTPLNDDEKQFYREKIKRLLKERNAV
NADA_SALCH      ------MSVMFDPQ---------AAI-YPFPPK-PTPLSDDEKQFYREKIKRLLKERNAV
NADA_SALTI      ------MSVMFDSQ---------AAI-YPFPPK-PTPLNDDEKQFYREKIKRLLKERNAV
NADA_ENT38      ------MSVMFDPE---------AAI-YPFPPK-PLPLNLDEKQFYREKIKRMLKERDAV
NADA_PECAS      ------MNILFDSN---------ETI-YPFPPK-PRPLSVDAKQHYRSRIKTLLRERNAV
NADA_YERPE      ------MSEIFDVN---------AAI-YPFPAR-PVPLDTNEKAFYREKIKTLLKQRDAV
NADA_YERP3      ------MSEIFDVN---------AAI-YPFPAR-PVPLDTNEKAFYREKIKTLLKQRDAV
NADA_YERPP      ------MSEIFDVN---------AAI-YPFPAR-PVPLDTNEKAFYREKIKTLLKQRDAV
NADA_YERPS      ------MSEIFDVN---------AAI-YPFPAR-PVPLDTNEKAFYREKIKTLLKQRDAV
NADA_YERPA      ------MSEIFDVN---------AAI-YPFPAR-PVPLDTNEKAFYREKIKTLLKQRDAV
NADA_YERPN      ------MSEIFDVN---------AAI-YPFPAR-PVPLDTNEKAFYREKIKTLLKQRDAV
NADA_YERE8      ------MSETFDVN---------AAI-YPFPAR-PVPLDVDQKAFYREKIKTLLKQRDAV
NADA_SERP5      ------MSEMFDVN---------AAV-YPFPPK-PVPLDDAQKAFYREKIKILLKQRNAV
NADA_SODGM      ------MSELIDDF---------ATI-YPFPPK-PAALTEGEKAGLRDNIARLLKACNAV
NADA_PHOLL      ------MNQYIDFN---------STI-YPFPPK-PAFLSKDEKKHYREKIKRLLKQQDAV
NADA_WIGBR      ------MSKKKETD---------SYL-SSDIKK-SKDFKI---------ISNLLKINDAV
NADA_VIBCH      ------MSHILDTI---------NTV-YPFPPK-PIPLRDEEKQAYIAEIKQLLIEKDAV
NADA_VIBC3      ------MSHILDTI---------NTV-YPFPPK-PIPLRDEEKQAYIAEIKQLLIEKDAV
NADA_VIBVU      ------MSHILDKI---------DTV-YPFPPK-PIPLTQDEKAAYIASIKQLLNEKDAV
NADA_VIBVY      ------MSHILDKI---------DTV-YPFPPK-PIPLTQDEKAAYIASIKQLLKEKDAV
NADA_VIBPA      ------MSHILDKI---------DTV-YPFPPK-PIPLSEEEKSSYIASIKELLKQKDAV
NADA_PHOPR      ------MSLTYDPS---------ETI-YPFPQK-PVPLSEQEKLTHVEKIKALLKEKDAV
NADA_SHESM      ----MSPSPFAPTI---------ETIDYPFPPK-PIPLSDAEKADYKARIKQLLIEKDAV
NADA_SHESR      ----MSPSPFAPTI---------ETIDYPFPPK-PIPLSDAEKADYKASIKQLLIEKDAV
NADA_SHESA      ----MSPSPFAPTI---------ETIDYPFPPK-PIPLSDAEKADYKARIKQLLIEKDAV
NADA_SHEON      ----MSSSLFAPTI---------ETIDYPFPPK-PVPLSDAQKADYKARIKQLLIEKDAV
NADA_PSET1      ------MSLAQTIM---------PEG-YIFPPK-PVPLTQNEQGEYKARIKQLLQEKNAV
NADA_PSEAE      ------MTHISERL---------LVQAHLAAKQ-PRVLSEQESAEHRAAIAAELKAQNAV
NADA_PSEAB      ------MTHISERL---------LVQAHLAAKQ-PRVLSEQESAEHRAAIAAELKAQNAV
NADA_PSEA7      ------MTQISERL---------LVQAHLAAKQ-PRVLSEQESAEHRAAIAAELKAQNAV
NADA_PSEU2      ------MTQISERF---------LVQAHLDAKQ-PRTLSPAEQARYRADIAAELKKQDAV
NADA_PSESM      ------MTQISERF---------LVQAHLDAKQ-PKALSPEEQAHYRAAIAAELKKQDAV
NADA_PSEP1      ------MTQISERL---------LVQAHLDAKQ-PNPLTAEQEAEYRAAIAAELKAQNAV
NADA_PSEPG      ------MTQISERL---------LVQAHLDAKQ-PNPLTAEQEAEYRAAIAAELKAQNAV
NADA_PSEE4      ------MTQISERL---------LVQAHLDAKQ-SNPLTPEQEADYRAAIAAELKRQNAV
NADA_PSEPF      ------MTQISERL---------LVQAHLDAKQ-PKPLTAEEEAYYRSAIAAELKAQDAV
NADA_PSEMY      ------MTQISERL---------LVQAHLDAKQ-PKPLTAEEEAFYRREIAAELKKQNAV
NADA_MARHV      ------MTKAQDRI---------LVQEHLAHQAEPKPLSASEKADLEARIKVALKEKDAV
NADA_BURCA      -MQSTIKPVEYDRP----VAAGTVCGVGQAWAKVPDAPSAEERAALKARIKALLAREKAV
NADA_BURCH      -MQSTIKPVEYDRP----VAAGTVCGVGQAWAKVPDAPSAEERAALKARIKALLAREKAV
NADA_BURL3      -MQSTIKPVEYDRP----VAAGTVCGVGQAWAKVPDAPSAEERAALKERIKALLVREKAV
NADA_BURCM      -MQSTIKPVEYDRP----VAAGTVCGVGQAWAKVPDAPSAEERAALKARIKALLAREKAV
NADA_BURMA      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALAPDERDALKARIKALLVREKAV
NADA_BURM9      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALAPDERDALKARIKALLVREKAV
NADA_BURPS      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALAPDERDALKARIKALLVREKAV
NADA_BURM7      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALAPDERDALKARIKALLVREKAV
NADA_BURMS      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALAPDERDALKARIKALLVREKAV
NADA_BURP0      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALAPDERDALKARIKALLVREKAV
NADA_BURP6      -MQSAIKSVEYDRP----LAAGAACGVGEAWAKVPDALVPDERDALKARIKALLVREKAV
NADA_BURTA      -MQSAIKPVEYDRP----LAAGAACGVGEAWAKVPAPLAAGEREALKARIKALLEREKAV
NADA_RALSO      -METHIKTVEFERPNMLAEAQSGASCVAHAWAKVPPALSREERDALKARIKRLLKERNAV
NADA_NEIMA      MQTAARRSFDYDMP--LIQTPTSACQIRQAWAKVADTPDRETADRLKDEIKALLKETNAV
NADA_NEIMB      MQTAARRSFDYDMP--LIQTPTSACQIRQAWAKVADTPDRETADRLKDEIKALLKEKNAV
NADA_NEIM0      MQTAARRSFDYDMP--LIQTPTSACQIRQAWAKVADTPDRETADRLKDEIKALLKEKNAV
NADA_NEIMF      MQTAARRSFDYDMP--LIQTPTSACQIRQAWAKVADTPDRETAGRLKDEIKALLKEKNAV
NADA_NEIG1      MQTAARRSFDYDMP--LIQTPTSACQIRQAWAKVADTPDHETAGRLKDEIKVLLKRKNAV
                                                  .              *   *   .**

NADA_ECOLC      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECOLI      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECO24      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_SHIFL      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_SHIF8      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_SHIBS      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECOHS      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECO57      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_SHIDS      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECOK1      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECOL5      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECOUT      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_ECOL6      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKT
NADA_SALPA      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHAASTLLVAGVRFMGETAKILSPEKN
NADA_SALTY      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGTKHAASTLLVAGVRFMGETAKILSPEKT
NADA_SALCH      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHAASTLLVAGVRFMGETAKILSPEKT
NADA_SALTI      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHAASTLLVAGVRFMGETAKILSPEKN
NADA_ENT38      MVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHSASTLLVAGVRFMGETAKILSPEKT
NADA_PECAS      MVAHYYTDPEIQALAEETGGCVADSLEMARFGSTHSASTLLVAGVRFMGETAKILNPEKT
NADA_YERPE      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKK
NADA_YERP3      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKK
NADA_YERPP      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKK
NADA_YERPS      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKK
NADA_YERPA      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKK
NADA_YERPN      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKK
NADA_YERE8      LVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKQ
NADA_SERP5      MVAHYYTDPEIQALAEETGGCVADSLEMARFGSNHPASTLLVAGVRFMGETAKILSPEKR
NADA_SODGM      IVAHYYTDPEIQALAEATGGCVADSLEMARFGSSHPATTLLVAGVRFMGETAKILSPEKT
NADA_PHOLL      MVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKR
NADA_WIGBR      IVSHYYTTPDIQAITEATGGKVADSLEMAKFGKNHKAKTLLVAGVRFMGETAKILNPEKI
NADA_VIBCH      LIAHYYTDPEIQALAESTGGFVGDSLEMAKFGNRYPATTLIIAGVRFMGESAKILTPEKR
NADA_VIBC3      LIAHYYTDPEIQALAESTGGFVGDSLEMAKFGNRYPATTLIIAGVRFMGESAKILTPEKR
NADA_VIBVU      LIAHYYTDPEIQALAEETGGFVGDSLEMAKFGNRHPAGTLIIAGVRFMGESAKILTPEKR
NADA_VIBVY      LIAHYYTDPEIQALAEETGGFVGDSLEMAKFGNRHPAGTLIIAGVRFMGESAKILTPEKR
NADA_VIBPA      LIAHYYTDPEIQALAEETGGFVGDSLEMAKFGNRHPASTLIIAGVRFMGESAKILTPEKR
NADA_PHOPR      LVAHYYTDPEIQALAEETGGFVGDSLEMARFGNQHSAKTLIICGVRFMGESAKILTPEKN
NADA_SHESM      LVAHYYTDPEIQALAEETGGCVSDSLEMARFGRDHPAKTLIVAGVKFMGETAKILSPEKT
NADA_SHESR      LVAHYYTDPEIQALAEETGGCVSDSLEMARFGRDHPAKTLIVAGVKFMGETAKILSPEKT
NADA_SHESA      LVAHYYTDPEIQALAEETGGCVSDSLEMARFGRDHPAKTLIVAGVKFMGETAKILSPEKT
NADA_SHEON      LVAHYYTDPEIQALAEETGGCVSDSLEMARFGRDHPAKTLIVAGVKFMGETAKILSPEKT
NADA_PSET1      LVAHYYTDPEIQALAEETGGCVADSLEMARFGTRHDADMIIVAGVRFMGETAKILTPNKT
NADA_PSEAE      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGNQHPAQTVVVAGVRFMGETAKILNPEKR
NADA_PSEAB      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGNQHPAQTVVVAGVRFMGETAKILNPEKR
NADA_PSEA7      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGNQHPAQTVVVAGVRFMGETAKILNPEKR
NADA_PSEU2      LVAHYYCDPVIQALAEETGGCVADSLEMARFSNNHAASTVLVAGVRFMGETAKILNPEKR
NADA_PSESM      MVAHYYCDPVIQALAEETGGCVADSLEMARFSNNHPASTVLVAGVRFMGETAKILNPEKR
NADA_PSEP1      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGKNHPAETVIVAGVRFMGETAKILTPEKR
NADA_PSEPG      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGKNHPAETVIVAGVRFMGETAKILTPEKR
NADA_PSEE4      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGKNHSAETVVVAGVRFMGETAKILTPEKR
NADA_PSEPF      LVAHFYCDPIIQALAEETGGCVSDSLEMARFGNAHPAKTVVVAGVKFMGETAKILNPEKR
NADA_PSEMY      LVAHYYCDPVIQALAEETGGCVSDSLEMARFGNQHPAQTVVVAGVKFMGETAKILNPEKR
NADA_MARHV      LVAHYYTDPDIQRLAEETGGCVADSLEMARFGNQHPASTVVVAGVRFMGETAKILNPEKK
NADA_BURCA      LVAHYYVDAELQELADETGGCVADSLEMARFGRDHDAQTLIVAGVRFMGETAKILSPNKR
NADA_BURCH      LVAHYYVDAELQELADETGGCVADSLEMARFGRDHDAQTLIVAGVRFMGETAKILSPNKR
NADA_BURL3      LVAHYYVDAELQELADETGGCVADSLEMARFGRDHDAQTLIVAGVRFMGETAKILSPNKR
NADA_BURCM      LVAHYYVDAELQELADETGGCVADSLEMARFGRDHDAQTLVVAGVRFMGETAKILSPGKR
NADA_BURMA      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURM9      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURPS      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURM7      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURMS      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURP0      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURP6      LVAHYYVDADLQALADETGGCVADSLEMARFGRDHDAHTLVVAGVRFMGETAKILSPGKR
NADA_BURTA      LVAHYYVDAELQELADETGGCVADSLEMARFGRDHGAQTLVVAGVRFMGETAKILSPGKR
NADA_RALSO      LVAHYYVDADLQDLAEETGGCVSDSLEMARFGRDHSAKTLVVAGVRFMGETAKILSPEKT
NADA_NEIMA      LVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEAGTLVVAGVRFMGESAKILCPEKT
NADA_NEIMB      LVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEAGTLVVAGVRFMGESAKILCPEKT
NADA_NEIM0      LVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEAGTLVVAGVRFMGESAKILCPEKT
NADA_NEIMF      LVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEADTLVVAGVRFMGESAKILCPEKT
NADA_NEIG1      LVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEAGTLVVAGVRFMGESAKILCPEKT
                :::*:*  . :* ::  *** :.******:*.  : *  :::.**:****:**** * * 

NADA_ECOLC      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECOLI      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECO24      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SHIFL      ILMPTLQVECSLDLGCPVEEFNAFYDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SHIF8      ILMPTLQVECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SHIBS      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECOHS      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECO57      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SHIDS      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECOK1      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECOL5      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECOUT      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ECOL6      ILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SALPA      ILMPTLAAECSLDLGCPIDEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SALTY      ILMPTLAAECSLDLGCPIDEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SALCH      ILMPTLAAECSLDLGCPIDEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SALTI      VLMPTLAAECSLDLGCPIDEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_ENT38      ILMPTLNAECSLDLGCPIEEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_PECAS      ILMPTLEAECSLDLGCPIDAFSRFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_YERPE      VLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
NADA_YERP3      VLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
NADA_YERPP      VLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
NADA_YERPS      VLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
NADA_YERPA      VLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
NADA_YERPN      VLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELI
NADA_YERE8      VLMPTLNAECSLDLGCPADEFAAFCDSHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SERP5      VLMPTLNAECSLDLGCPEEEFNAFCDSHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_SODGM      VLMPTLHAECSLDLGCPEAEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_PHOLL      VLMPTLEAECSLDLGCPEKEFTQFCDDHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
NADA_WIGBR      VLMPTLKAECSLDLSCPEKEFNKFCDNHPDRTIVVYANTSAAIKARAHWIVTSSIAIDLI
NADA_VIBCH      ILMPTLEAECSLDLGCPADKFTEFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_VIBC3      ILMPTLEAECSLDLGCPADKFTEFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_VIBVU      ILMPTLEAECSLDLGCPADKFTEFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_VIBVY      ILMPTLEAECSLDLGCPADKFTEFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_VIBPA      ILMPTLEAECSLDLGCPADKFSEFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_PHOPR      VLMPTLEAECSLDLGCPADKFSEFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_SHESM      ILMPTLEATCSLDLGCPIDKFSAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_SHESR      ILMPTLEATCSLDLGCPIDKFSAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_SHESA      ILMPTLEATCSLDLGCPIDKFNAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_SHEON      ILMPTLEATCSLDLGCPIDKFSAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEIV
NADA_PSET1      VVMPTLEATCSLDIGCPVDEFSAFCDQHPDRTVVVYANTSTAVKARADWIVTSSCALEIV
NADA_PSEAE      VLMPTLEATCSLDLGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCAVEIV
NADA_PSEAB      VLMPTLEATCSLDLGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCAVEIV
NADA_PSEA7      VLMPTLEATCSLDLGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCAVEIV
NADA_PSEU2      VFMPTLEATCSLDVGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSGCALEIV
NADA_PSESM      VFMPTLEATCSLDVGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSGCALEIV
NADA_PSEP1      VLMPTLEATCSLDLGCPVEEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIV
NADA_PSEPG      VLMPTLEATCSLDLGCPVEEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIV
NADA_PSEE4      VLMPTLEATCSLDLGCPVEAFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIV
NADA_PSEPF      VLMPTLEATCSLDLGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIV
NADA_PSEMY      VLMPTLEATCSLDLGCPVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIV
NADA_MARHV      VLMPTLEATCSLDVGCPADEFSEFCDQHPDRTVVVYANTSAAVKARADWVVTSSCAQAIV
NADA_BURCA      ILMPDLDATCSLDLGCPVDEFSAFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURCH      ILMPDLDATCSLDLGCPVDEFSAFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURL3      ILMPDLDATCSLDLGCPVDEFSAFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURCM      VLMPDLDATCSLDLGCPADEFSAFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURMA      VLMPDLDATCSLDLGCPVDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURM9      VLMPDLDATCSLDLGCPVDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURPS      VLMPDLDATCSLDLGCPVDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURM7      VLMPDLDATCSLDLGCPVDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURMS      VLMPDLDATCSLDLGCPVDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURP0      VLMPDLDATCSLDLGCLVDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURP6      VLMPDLDATCSLDLGCPIDEFSQFCDAHPERTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_BURTA      VLMPDLDATCSLDLGCPVDEFSRFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLEIV
NADA_RALSO      VLMPDLDATCSLDLGCPPDTFAAFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLKIV
NADA_NEIMA      VLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIV
NADA_NEIMB      VLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIV
NADA_NEIM0      VLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIV
NADA_NEIMF      VLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIV
NADA_NEIG1      VLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVAVYANTSAAVKARADWVVTSSVALEIV
                :.** * . ****:.*    *  * * **::*:.******:*:**:*.*:***. .  ::

NADA_ECOLC      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECOLI      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECO24      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_SHIFL      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_SHIF8      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_SHIBS      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECOHS      DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECO57      DHLDSLGEKIIWAPDKHLGRYVQKKTGADILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_SHIDS      DHLDSLGEKIIWAPDKHLGRYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYLDAAI
NADA_ECOK1      DHLDSLGEKIIWAPDKHLGCYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECOL5      DHLDSLGEKIIWAPDKHLGCYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECOUT      DHLDSLGEKIIWAPDKHLGCYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_ECOL6      DHLDSLGEKIIWAPDKHLGRYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYPDAAI
NADA_SALPA      EHLDSLGEKIIWAPDRHLGNYVQKQTGADVLCWQGACIVHDEFKTQALTRLKKIYPDAAL
NADA_SALTY      EHLDSLGEKIIWAPDRHLGNYVQKQTGADVLCWQGACIVHDEFKTQALTRLKKIYPDAAL
NADA_SALCH      EHLDSLGEKIIWAPDRHLGNYVQKQTGADVLCWQGACIVHDEFKTQALTRLKKIYPDAAL
NADA_SALTI      EHLDSLGEKIIWAPDRHLGNYVQKQTRADVLCWQGACIVHDEFKTQALTRLKKIYPDAAI
NADA_ENT38      EHLDSLGQKIIWAPDKHLGNYVQKQTGADVLCWQGACIVHDEFKTQALVRMKALYPEAAI
NADA_PECAS      EHLDSLGEKIIWAPDRHLGSYVQKQTGADVLCWQGACIVHDEFKTQALQRMKILYPDAAI
NADA_YERPE      EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAV
NADA_YERP3      EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAV
NADA_YERPP      EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAV
NADA_YERPS      EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAV
NADA_YERPA      EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAV
NADA_YERPN      EHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAV
NADA_YERE8      EHLDSLGEKIIWAPDRHLGNYVQKRSGADVLCWKGACIVHDEFKTQALAQMKALHPDAAV
NADA_SERP5      EHLDSLGEKIIWAPDRHLGSYVQKQTGADMLCWQGACIVHDEFKTQALMRMKALYPNAAI
NADA_SODGM      DHLDSLGEKIIWAPDRHLGRYVQKQTGADMLCWQSACIVHDEFKTQALRRMKRLYPDAAV
NADA_PHOLL      DYLDSQGKKIIWAPDRHLGNYVRKQTGADILCWQGACIVHDEFKTQALIRVKGLHPDAAV
NADA_WIGBR      DYLDRLGEKIIWAPDKHLGRYIQKQTGADILIWNGTCIVHDEFKSQSLLNMKKIYPKSAI
NADA_VIBCH      EHLDSEGKPIIWGPDRHLGAYIAKKTGADMLLWQGECVVHDEFSADALRKMKALYPDAAI
NADA_VIBC3      EHLDSEGKPIIWGPDRHLGAYIAKKTGADMLLWQGECVVHDEFSADALRKMKALYPDAAI
NADA_VIBVU      EHLDAEDKPIIWGPDRHLGSYIANKTGADMLLWQGECVVHDEFSADALRKMKAVYPDAAI
NADA_VIBVY      EHLDAEDKPIIWGPDRHLGSYIANKTGADMLLWQGECVVHDEFSADALRKMKAVYPDAAI
NADA_VIBPA      EHLDAEDKPIIWGPDRHLGSYIANKTGADMLLWQGECVVHDEFSADALRKMKSVYPDAAI
NADA_PHOPR      EHLDSEGKDIIWGPDRHLGAYIQKNTGAEMLLWQGECVVHDEFSAKALRDMKALYPDAAV
NADA_SHESM      EHLDSEGKKIIWGPDRHLGSYIAKQTGAEMLMWQGDCIVHDEFKANALRDLKRVYPDAAI
NADA_SHESR      EHLDSEGKKIIWGPDRHLGSYIAKQTGAEMLMWQGDCIVHDEFKANALRDLKRVYPDAAI
NADA_SHESA      EHLDSEGKKIIWGPDRHLGSYIAKQTGAEMLMWQGDCIVHDEFKANALRDLKRVYPDAAI
NADA_SHEON      EHLDSEGKKIIWGPDRHLGSYIAKQTGAEMLMWQGDCIVHDEFKANALRDLKSVYPDAAI
NADA_PSET1      EHLDELGEKIIWGPDKHLGSYIQKNTGADMIMWNGACIVHDEFKTKALKDMKALHPDAGV
NADA_PSEAE      EHLMDNGEPILWAPDQHLGRYIQRETGADMLLWDGACIVHEEFKAKQLEDMKALYPDAAI
NADA_PSEAB      EHLMDNGEPILWAPDQHLGRYIQRETGADMLLWDGACIVHEEFKAKQLEDMKALYPDAAI
NADA_PSEA7      EHLMDNGEPILWAPDQHLGRYIQRATGADMLLWDGACIVHEEFKAKQLEDMKALYPDAAI
NADA_PSEU2      ESLMDNGEKIIWAPDKHLGRYIQRETGADMLLWDGACIVHEEFKSKQLEDMKALYPEAAI
NADA_PSESM      ESLMDNGEKIIWAPDKHLGRYIQRETGADMLLWDGACIVHEEFKSKQLEDMKALYPEAAI
NADA_PSEP1      ESLMDNGETIIWGPDQHLGRYIQKQTGADMLLWDGACIVHEEFKSRQLADMKALYPDAAI
NADA_PSEPG      ESLMDNGETIIWGPDQHLGRYIQKQTGADMLLWDGACIVHEEFKSRQLADMKALYPDAAI
NADA_PSEE4      ESLMDNGETIIWGPDQHLGRYIQKQTGADMLLWDGACIVHEEFKSRQLADMKALYPDAAI
NADA_PSEPF      ESLKDNGETIIWGPDKHLGTYIQRQTGADMLLWDGACIVHEEFKSKQLEDMKALYPDAAI
NADA_PSEMY      ESLMDNGETIIWAPDKHLGNYIQRETGADMLLWDGACIVHEEFKSKQLLDMKALYPDAAI
NADA_MARHV      EHLDAKGEKILWAPDKHLGGYVQKTTGADVLLWDGSCIVHEEFKYRGLEDLKALYPDAAI
NADA_BURCA      ADLHARGEKIIWAPDRHLGSYIQKKTGADMLLWQGSCLVHDEFKGIELDLLRAEYPDAKV
NADA_BURCH      ADLHARGEKIIWAPDRHLGSYIQKKTGADMLLWQGSCLVHDEFKGIELDLLRAEYPDAKV
NADA_BURL3      ADLHARGEKIIWAPDRHLGSYIQKKTGADMLLWQGSCLVHDEFKGIELDLLRAEYPDAKV
NADA_BURCM      ADLHARGEKIIWAPDRHLGSYIQKKTGADMLLWQGSCLVHDEFKGIELDLLRAEYPDAKV
NADA_BURMA      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRHEYPDAKI
NADA_BURM9      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRHEYPDAKI
NADA_BURPS      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRHEYPDAKI
NADA_BURM7      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRHEYPDAKI
NADA_BURMS      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRHEYPDAKI
NADA_BURP0      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRREYPDAKI
NADA_BURP6      ADLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRHEYPDAKI
NADA_BURTA      ANLHARGEKIIWAPDRHLGGYIQKKTGADMLMWQGSCLVHDEFKGIELDLLRNEYPDAKI
NADA_RALSO      QHLHEQGQKILWAPDRHLGSYIQQQTGADMLLWQGSCLVHDEFKGVELDLLRAEHPHAKV
NADA_NEIMA      SYLKSRGEKLIWGPDRHLGDYICRETGADMLLWQGSCIVHNEFKGQELAALKAEHPDAVV
NADA_NEIMB      SYLKSRGEKLIWGPDRHLGDYICRETGADMLLWQGSCIVHNEFKGQELAALKAEHPEAVV
NADA_NEIM0      SYLKSRGEKLIWGPDRHLGDYIRRETGADMLLWQGSCIVHNEFKGQELAALKAEHPDAVV
NADA_NEIMF      SYLKSRGEKLIWGPDRHLGDYICRETGADMLLWQGSCIVHNEFKGQELAALKAEHPDAVV
NADA_NEIG1      SYLKSRGEKLIWGPDRHLGDYIRRETGADMLLWQGSCIVHNEFKGQELAALKAEHPDAVV
                  *   .: ::*.**:*** *: . : .::: *.. *:**:**.   *  ::  : .: :

NADA_ECOLC      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECOLI      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECO24      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_SHIFL      LVHPESPQAIVDMADAVGSTSQLIAAAKALPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_SHIF8      LVHPESPQAIVDMADAVGSTSQLIAAAKALPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_SHIBS      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECOHS      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECO57      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_SHIDS      LVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQWLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECOK1      LVHPESPQAIVEMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECOL5      LVHPESPQAIVEMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECOUT      LVHPESPQAIVEMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ECOL6      LVHPESPQAIVEMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAP
NADA_SALPA      LVHPESPQSIVEMADAVGSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPEKELLEAP
NADA_SALTY      LVHPESPQSIVEMADAVGSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPEKELLEAP
NADA_SALCH      LVHPESPQSIVEMADAVGSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPEKELLEAP
NADA_SALTI      LVHPESPRSIVEMADAVGSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPDKELLEAP
NADA_ENT38      LVHPESPQSIVDMADAVGSTSQLINAAKTLPQQKLIVATDRGIFYKMQQAVPEKELFEAP
NADA_PECAS      LVHPESPQSVVEMADAVGSTSQLIQAAKTLPQRELIVATDRGIFYKMQQACPEKTLLEAP
NADA_YERPE      LVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAP
NADA_YERP3      LVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAP
NADA_YERPP      LVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAP
NADA_YERPS      LVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAP
NADA_YERPA      LVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAP
NADA_YERPN      LVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAP
NADA_YERE8      LVHPESPQAVVDMADAVGSTSQLIMAAKTLPQKKLIVATDRGIFYKMQQACPDKELFEAP
NADA_SERP5      LVHPESPQAVVSLADAVGSTSQLIQAAKTLPNSQLIVATDRGIFYKMQQACPDKELFEAP
NADA_SODGM      LVHPESPQAVVDLADVVGSTSQLIQAAKTLKQQQMIVATDRGIFYKMQQACPEKNLLEAP
NADA_PHOLL      LVHPESPQAVIDLADAVGSTSQLIKSAQSLPHQKLIVATDKGIFYKMQQACPEKQLFAAP
NADA_WIGBR      LAHPESPENVLNLADFIGSTSQLIQAAKSINQKTIIIATDKGIFFKMQQACPDKILIEAP
NADA_VIBCH      LVHPESPASVVELADAVGSTSQLIKAAKTLPQQKMIVATDKGIFFKMQQMVPEKELIEAP
NADA_VIBC3      LVHPESPASVVELADAVGSTSQLIKAAKTLPQQKMIVATDKGIFFKMQQMVPEKELIEAP
NADA_VIBVU      LVHPESPASVVELADAVGSTSQLIKAAKELPQQKMIVATDKGIFFKMQQLVPEKELIEAP
NADA_VIBVY      LVHPESPASVVELADAVGSTSQLIKAAKELPQQKMIVATDKGIFFKMQQLVPEKELIEAP
NADA_VIBPA      LVHPESPASVVELADAVGSTSQLIKAAKELPYQQMIVATDKGIFFKMQQLVPEKELIEAP
NADA_PHOPR      LVHPESPASVVALADAVGSTSQLIKAAKELPNTKLIVATDKGIFFKMQQMVPDKELVEAP
NADA_SHESM      LVHPESPASVVAMADAVGSTSQLIKAAQTMANERFIVATDRGIFYKMQQAAPGKTLIEAP
NADA_SHESR      LVHPESPASVVAMADAVGSTSQLIKAAQTMANERFIVATDRGIFYKMQQAAPGKTLIEAP
NADA_SHESA      LVHPESPASVVAMADAVGSTSQLIKAAQTMANERFIVATDRGIFYKMQQAAPGKTLIEAP
NADA_SHEON      LVHPESPASVVAMADAVGSTSQLIKAAQTMPNERFIVATDRGIFYKMQQAAPGKTLIEAP
NADA_PSET1      LVHPESPEEIVALADAVGSTSQLIKAAQTMSNKKFIVATDRGIFYKMQQLCPDKEFFAAP
NADA_PSEAE      LVHPESPESVVALADAVGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKDFIEAP
NADA_PSEAB      LVHPESPESVVALADAVGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKDFIEAP
NADA_PSEA7      LVHPESPESVVALANAVGSTSQLIRAAQTLPNSTFIVATDRGIFYKMQQLCPEKTFVEAP
NADA_PSEU2      LVHPESPEAVIELADVVGSTSQMIAAAQRLPNKTFIVATDRGIFYKMQQLCPDKIFIEAP
NADA_PSESM      LVHPESPEAVIELADVVGSTSQMIAAAQRLPNKMFIVATDRGIFYKMQQLCPDKIFIEAP
NADA_PSEP1      LVHPESPEAVIELADAVGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKEFVEAP
NADA_PSEPG      LVHPESPEAVIELADAVGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKEFVEAP
NADA_PSEE4      LVHPESPEAVIDLADAVGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKEFVEAP
NADA_PSEPF      LVHPESPTSVIELADAVGSTSQLIAAAQSLPNKTLIVATDRGIFYKMQQLCPDKVFIEAP
NADA_PSEMY      LVHPESPQSVVELADAVGSTSQLIKAAQTLPNSTFIVATDRGIFYKMQQLCPDKTFIEAP
NADA_MARHV      LVHPESPDAVVQMADVVGSTSQLIHAVQTLPNEEFIVATDNGIFYKMQQLAPNKTLIEAP
NADA_BURCA      LVHPESPENVVAQADVVGSTTQLIDAAVKFDAKRFIVATDLGILHKMQLAAPGKTFIAAP
NADA_BURCH      LVHPESPENVVAQADVVGSTTQLIDAAVKFDAKRFIVATDLGILHKMQLAAPGKTFIAAP
NADA_BURL3      LVHPESPENVVAQADVVGSTTQLIDAAVKFNATHFIVATDLGILHKMQLAAPGKTFIAAP
NADA_BURCM      LVHPESPENVVAQADVVGSTTQLIDAAVKLDATHFIVATDLGILHKMQLAAPGKTFIAAP
NADA_BURMA      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURM9      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURPS      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURM7      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURMS      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURP0      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURP6      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_BURTA      LVHPESPEGVVALADVVGSTTQLIDAAVKLDAQRFIVATDLGILHKMRLAAPGKTFIEAP
NADA_RALSO      LVHPESPPSVVAQADVVGSTSQLIAAAQSLPADAFIVATDNGILHKMRMAAPGKRFIEAP
NADA_NEIMA      LVHPESPQSVIELSDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQAPDKQFIAAP
NADA_NEIMB      LVHPESPQSVIELGDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQAPDKQFIAAP
NADA_NEIM0      LVHPESPQSVIELGDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQAPDKEFIAAP
NADA_NEIMF      LVHPESPQSVIELGDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQAPDKEFIAAP
NADA_NEIG1      LVHPESPQSVIELGDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQAPDKEFIAAP
                *.*****  ::  .: :***:::: :.       :*:*** **:.:*:   * * :. **

NADA_ECOLC      TAGEGATCRSCAHCPWMAMNGLQAIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_ECOLI      TAGEGATCRSCAHCPWMAMNGLQAIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_ECO24      TAGEGATCRSCAHCPWMAMNGLQSIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_SHIFL      TAGEGATCRSCAHCPWMAMNDLQAIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_SHIF8      TAGEGATCRSCAHCPWMAMNGLQAIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_SHIBS      TAGEGATCRSCAHCPWMAMNDLQAIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_ECOHS      TAGEGATCRSCAHCPWMAMNGLQAIAKALEQEG-SNHEVHVEERLRERALVPLNRMLDFA
NADA_ECO57      TAGEGATCRSCAHCPWMAMNGLQAIAEALEQEG-SNYEVHVDERLRERALVPLNRMLDFA
NADA_SHIDS      TAGEGATCRSCAHCPWMAMNGLQAIAEALEQEG-SNHEVHVDERLRERALVPLNRMLDFA
NADA_ECOK1      TAGEGATCRSCAHCPWMAMNGLQAIAEALELEG-SNHEVYVDERLLERALVPLNRMLDFA
NADA_ECOL5      TAGEGATCRSCAHCPWMAMNGLQAIAEALELEG-SNHEVYVDERLLERALVPLNRMLDFA
NADA_ECOUT      TAGEGATCRSCAHCPWMAMNGLQAIAEALELEG-SNHEVYVDERLLERALVPLNRMLDFA
NADA_ECOL6      TAGEGATCRSCAHCPWMAMNGLQAIAEALELEG-SNHEVYVDERLRERALVPLNRMLDFA
NADA_SALPA      TAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGG-AAHEIQVDAALREGALLPLNRMLDFA
NADA_SALTY      TAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGG-AAHEIQVDAALREGALLPLNRMLDFA
NADA_SALCH      TAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGG-AAHEIQVDAALREGALLPLNRMLDFA
NADA_SALTI      TAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGG-AAHEIQVDAALRESALLPLNRMLDFA
NADA_ENT38      TAGEGATCRSCAHCPWMAMNGLKAIADGLESGG-AAHEIHVDAALREGALLPLNRMLEFA
NADA_PECAS      TAGEGATCRSCAHCPWMAMNGLEAIANGLEQGG-HAHEIHVDAALREGALIPLNRMLDFA
NADA_YERPE      TAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGG-VMHEIHVDEELRQQALIPLNRMLDFA
NADA_YERP3      TAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGG-VMHEIHVDEELRQQALIPLNRMLDFA
NADA_YERPP      TAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGG-VMHEIHVDEELRQQALIPLNRMLDFA
NADA_YERPS      TAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGG-VMHEIHVDEELRQQALIPLNRMLDFA
NADA_YERPA      TAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGG-VMHEIHVDEELRQQALIPLNRMLDFA
NADA_YERPN      TAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGG-GMHEIHVDEELRQQALIPLNRMLDFA
NADA_YERE8      TAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGG-VMHEIHVDEQLRQQALIPLNRMLDFA
NADA_SERP5      TAGEGATCRSCAHCPWMAMNGLKAIADGLEHGG-VLHEIHVDAALRQKALIPLNRMLDFA
NADA_SODGM      TAGEGATCRSCAHCPWMAMNGLKAIAAGLERGG-VEHDIRVDEAVRQRALVPLDRMLSFA
NADA_PHOLL      TAGEGASCRSCAHCPWMAMNGLQAIVQGLEQGG-GQHEILVEKELREKALVPLNRMLDFA
NADA_WIGBR      TSGEGLTCLSCARCPWMKMNNINRIIKSLTNKK-KHNEINIPHDLQKKALKPLMRMLKFS
NADA_VIBCH      TAGAGATCRSCAHCPWMAMNGLQAIAQALREGG-KQHEIFVDEALRVKSLIPLNRMLDFA
NADA_VIBC3      TAGAGATCRSCAHCPWMAMNGLQAIAQALREGG-KQHEIFVDEALRVKSLIPLNRMLDFA
NADA_VIBVU      TAGAGATCRSCAHCPWMAMNGLKAIETALREGG-EQHEIFVDEALRVKSLIPLNRMLDFA
NADA_VIBVY      TAGAGATCRSCAHCPWMAMNGLKAIETALREGG-EQHEIFVDEALRVKSLIPLNRMLDFA
NADA_VIBPA      TAGAGATCRSCAHCPWMAMNGLKAIEKALSEGG-EEHEIFVDEALRVKSLIPLNRMLDFA
NADA_PHOPR      TAGAGATCRSCAHCPWMAMNGLKAIESALVEGG-EKHEIFVDEALRVKSLIPLNRMLNFA
NADA_SHESM      TGGNGATCKSCAHCPWMAMNGLKAIEASLSDSDKTTHEIFVDEDLRVKALIPLTRMLDFA
NADA_SHESR      TGGNGATCKSCAHCPWMAMNGLKAIEASLSDSDKTTHEIFVDEDLRVKALIPLTRMLDFA
NADA_SHESA      TGGNGATCKSCAHCPWMAMNGLKAIEASLSDSDKTTHEIFVDEDLRVKALIPLTRMLDFA
NADA_SHEON      TGGNGATCKSCAHCPWMAMNGLKAIEASLSNSDKTTHEIFVDEDLRVKALIPLTRMLDFA
NADA_PSET1      TAGEGASCKTCAHCPWMAMNGLKAIEEALIDPK--GKEVFVDMDLREGALKSLNRMLDFT
NADA_PSEAE      TAGNGAACRSCAHCPWMAMNTLERTLACLREGS---GEIFVDPALIPRAVRPLKRMLDFT
NADA_PSEAB      TAGNGAACRSCAHCPWMAMNTLERTLACLREGS---GEIFVDPALIPRAVRPLKRMLDFT
NADA_PSEA7      TAGNGAACRSCAHCPWMAMNTLERTLACLREGS---GEIFVDPALVPRAVRPLKRMLDFT
NADA_PSEU2      TAGNGAACRSCAHCPWMAMNTLERTLQCLREGS---NEIFVDPALIPHAVRPLQRMLDFT
NADA_PSESM      TAGNGAACRSCAHCPWMAMNTLERTLQCLREGG---NEIFVEPALIPNAVRPLQRMLDFT
NADA_PSEP1      TAGNGAACRSCAHCPWMAMNTLERVLDCLRNGT---NEIFVDPALVPKAIKPLNRMLDFT
NADA_PSEPG      TAGNGAACRSCAHCPWMAMNTLERVLDCLRKGG---DEIFVDPALVPKAIKPLNRMLDFT
NADA_PSEE4      TAGNGAACRSCAHCPWMAMNTLERVLDCLRQGS---NEIFVEPALIPKAIKPLNRMLDFT
NADA_PSEPF      TAGNGAACRSCAHCPWMAMNTLERTLKCLKEGS---NEIFVDPALIPQAIRPLKRMLDFT
NADA_PSEMY      TAGNGAACRSCAHCPWMAMNTLERVLTGLRQGS---GEIHVDPALIPKAIKPLKRMLDFT
NADA_MARHV      TAGNGATCRSCAHCPWMAMNGLENLLHVLEHGD---QEVHVDDELREDALRPLRRMLDFT
NADA_BURCA      TAGNSATCKSCAHCPWMAMNGLANLADVLERGH---NEIFVDPAIGERARLPIDRMLEFA
NADA_BURCH      TAGNSATCKSCAHCPWMAMNGLANLADVLERGH---NEIFVDPAIGERARLPIDRMLEFA
NADA_BURL3      TAGNSATCKSCAHCPWMAMNGLANLADVLERGH---NEIFVDPAIGERARLPIDRMLDFA
NADA_BURCM      TAGNSATCKSCAHCPWMAMNGLANLADVLERGH---NEIFVDPAIGVRARLPIDRMLDFA
NADA_BURMA      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURM9      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURPS      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURM7      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURMS      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURP0      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURP6      TAGNSATCKSCAHCPWMAMNALSNLADVLERGH---NEIFVEAAIAQRARMPIDRMLDFA
NADA_BURTA      TAGNSATCKSCAHCPWMAMNVLSNLADVLERGH---NEIFVDAAIAERARVPIDRMLDFA
NADA_RALSO      TAGNSATCKSCAHCPWMAMNALTNLAEVLETGR---NEIHVDPQIGQQAVRCITRMLDFA
NADA_NEIMA      TAGNGGSCKSCAFCPWMAMNSLGGIKYALTSGR---NEILLDRKLGEAAKLPLQRMLDFA
NADA_NEIMB      TAGNGGSCKSCAFCPWMAMNSLGGIKYALTSGR---NEILLDRKLGEAAKLPLQRMLDFA
NADA_NEIM0      TAGNGGSCKSCAFCPWMAMNSLGGIKYALTSGR---NEILLDRKLGEAAKLPLQRMLDFA
NADA_NEIMF      TAGNGGSCKSCAFCPWMAMNSLGGIKYALTSGR---NEILLDRKLGEAAKLPLQRMLDFA
NADA_NEIG1      TAGNGGSCKSCAFCPWMAMNSLGGIKHALTGGR---NEILLDRKLGEAAKLPLQRMLDFA
                *.* . :* :** **** ** :      *        :: :   :   :   : ***.*:

NADA_ECOLC      ATLRG---------------------
NADA_ECOLI      ATLRG---------------------
NADA_ECO24      ATLRG---------------------
NADA_SHIFL      ATLRG---------------------
NADA_SHIF8      ATLRG---------------------
NADA_SHIBS      ATLRG---------------------
NADA_ECOHS      ATLRG---------------------
NADA_ECO57      ATLRG---------------------
NADA_SHIDS      ATLRG---------------------
NADA_ECOK1      ATLRG---------------------
NADA_ECOL5      ATLRG---------------------
NADA_ECOUT      ATLRG---------------------
NADA_ECOL6      ATLRG---------------------
NADA_SALPA      ATLRA---------------------
NADA_SALTY      ATLRA---------------------
NADA_SALCH      ATLRA---------------------
NADA_SALTI      ATLRV---------------------
NADA_ENT38      ATLRS---------------------
NADA_PECAS      ASLKLRVKGNA---------------
NADA_YERPE      NQLKLQVKGNA---------------
NADA_YERP3      NQLKLQVKGNA---------------
NADA_YERPP      NQLKLQVKGNA---------------
NADA_YERPS      NQLKLQVKGNA---------------
NADA_YERPA      NQLKLQVKGNA---------------
NADA_YERPN      NQLKLQVKGNA---------------
NADA_YERE8      NELKLQTKGNA---------------
NADA_SERP5      AELRVQVKGNA---------------
NADA_SODGM      ADLKRC--------------------
NADA_PHOLL      AQLK----------------------
NADA_WIGBR      QKVI----------------------
NADA_VIBCH      EQLNLKVKGNA---------------
NADA_VIBC3      EQLNLKVKGNA---------------
NADA_VIBVU      EKLNMQVKGNA---------------
NADA_VIBVY      EKLNMQVKGNV---------------
NADA_VIBPA      EQLNMQVKGNA---------------
NADA_PHOPR      AELQLKVKGNA---------------
NADA_SHESM      KTLNMKVKGNA---------------
NADA_SHESR      KTLNMKVKGNA---------------
NADA_SHESA      KTLNMKVKGNA---------------
NADA_SHEON      KTLNMKVKGNA---------------
NADA_PSET1      ATMAK---------------------
NADA_PSEAE      QAARLRQAGNA---------------
NADA_PSEAB      QAARLRQAGNA---------------
NADA_PSEA7      QAARLRLAGNA---------------
NADA_PSEU2      QAARLRQAGNA---------------
NADA_PSESM      QAARLRQAGNA---------------
NADA_PSEP1      QAARLKLSGNA---------------
NADA_PSEPG      QAARLKLSGNA---------------
NADA_PSEE4      QAARLKVSGNA---------------
NADA_PSEPF      QAARMKLAGNA---------------
NADA_PSEMY      QAARMKVAGNA---------------
NADA_MARHV      ANMNLKAAGNA---------------
NADA_BURCA      AAHKKRVQASGDLQRDQSLFANVGAA
NADA_BURCH      AAHKKRVQASGDLQRDQSLFANVGAA
NADA_BURL3      AAHKKRVQASGDLQRDQQLFANVGAA
NADA_BURCM      AAHKKRVQASGDLQRDQQLFANVGAA
NADA_BURMA      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURM9      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURPS      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURM7      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURMS      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURP0      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURP6      ARHKQRVQASGDLQRDQALFANVGAA
NADA_BURTA      ARHKQRVQASGDLLRDQQLFANVGAA
NADA_RALSO      AREKTTVRPQGDLAANTQLFQGVGPA
NADA_NEIMA      AGLKR-----GD------VFNGMGPA
NADA_NEIMB      AGLKK-----KD------VFNGMGPA
NADA_NEIM0      AGLKR-----GD------VFNGMGPA
NADA_NEIMF      AGLKR-----GD------VFNGMGPA
NADA_NEIG1      AGLKR-----GD------VFNGMGPA