CLUSTAL format seed alignment for MF_00572

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LEU1_RHIL3       -----------------------------------------MPDAAVKYRAYPQ----VN
LEU1_RHIME       -----------------------------------------MPEAAVKYQPYPQ----IV
LEU1_AGRFC       -----------------------------------------MTDASVKYRPYPT----IN
LEU1_BRUSU       -----------------------------------------MPIAGTKYAPFPA----PQ
LEU1_BRUME       -----------------------------------------MPIAGTKYAPFPA----PQ
LEU1_RHILO       -----------------------------------------MPDAARKYQPYPT----VG
LEU1_PSEPK       --------------------------------------MTMLKDPSKKYRAFPT----ID
LEU1_PSEP1       --------------------------------------MTMLKDPSKKYRAFPT----ID
LEU1_PSEPG       --------------------------------------MTMLKDPSKKYRAFPT----ID
LEU1_PSEE4       --------------------------------------MTMLKDPSKKYRAFPT----ID
LEU1_PSE14       --------------------------------------MTMLKDPSKKYRAFPT----ID
LEU1_PSEU2       --------------------------------------MTMLKDPSKKYRAFPT----ID
LEU1_PSESM       --------------------------------------MTMLNDPSKKYRAFPT----ID
LEU1_PSEPF       --------------------------------------MSMLKDPSSKYRAFPV----IN
LEU1_PSEF5       --------------------------------------MTMLKDPSSKYRAFPT----IN
LEU1_PSEAE       --------------------------------------MSMLKDPSQKYRPFSA----IN
LEU1_PSEA7       --------------------------------------MSMLKDPSQKYRPFPA----IN
LEU1_PSEU5       --------------------------------------MTMLKNPSNKYRAFPA----ID
LEU1_PSEMY       --------------------------------------MTMLKDPSQKYRPFTP----IA
LEU12_RALSO      ----------------------------------------MLKHPATKYRPFPP----IA
LEU1_HERSS       ----------------------------------------MLTDPSQKYRAIAP----VD
LEU1_MARMS       ----------------------------------------MLTQPSIKYRPAQI----ID
LEU1_YEAST       ----------MVKESIIALAEHAASRASRVIPPVKLAYKNMLKDPSSKYKPFNA----PK
LEU1_ALCBS       -----------------------------------------MSFDHRKYRPVAV----ID
LEU12_HYDCU      -------------------------------------------MTPEKYRPTIT----PD
LEU1_MYCLE       MASFSESLSQDPADAYKSAPSITKPMGPPSPGQPQWNPQRATSMPVFRYRPFAKEVEPIR
LEU1_MYCUA       -------------------------------------------MPVNRYRPFAEEVEHIR
LEU1_CORGL       --------MSPNDAFISAPAKIETPVGPRNEGQPAWNKQRGSSMPVNRYMPFEVEVEDIS
LEU1_CORGB       --------MSPNDAFISAPAKIETPVGPRNEGQPAWNKQRGSSMPVNRYMPFEVEVEDIS
LEU1_COREF       -------------------------------------------MPVKRYLPFEVEVEDIT
LEU1_STRCO       ----------------------------------MANRQQPSPMPTAKYRGYDQ----VD
LEU1_STRAW       ----------------------------------MANRQQPTSMPIHKYRPYEQ----VD
LEU1_KINRD       ----------------------------------MQNTQTPSPMPFGKYTPFQDQIR-VE
LEU1_ARTS2       ----------------------------------MRNAQKPSGMPVHRYMPFQDQIT-VE
LEU1_BIFLS       --MGQDQSSVFDLAAVAAASNGGNNDPLLPPARFIGDPQKPSRMPYNKYASYSEQIP-FD
LEU1_CATAD       -------------------------------------------MPSHRYRSVFDRVE-VP
LEU1_NOCFA       -------------MSATAFPTLSTPAGEIPATAPAWNRQRRSQMPSHRYRDVHSRVA-VP
LEU1_STRRD       -----------------------------------------MKTTTRQTGRYGAFTP-VP
LEU1_HELHP       ----------------------------------------------MSYTKYQRGYFMPP
LEU1_DESHY       ---------------------------------------------MKNVDNYRRGYFMPP
LEU12_BACP2      ---------------------------------------------MFNHKKYEKKYFLPP
LEU1_CLOAB       ----------------------------------------------MLYNKYVK-YPKVK
LEU1_ACESD       ----------------------------------------------MNYKKYKG-YETIV
LEU1_MAGMM       ------------------------------------------MNGSMPFHKYSP-YPPVA
                                                                             

LEU1_RHIL3       IPDRTWPTK-TITKAPVWCSVDLRDGNQALVDPMGHDRKARMFHLLIEMGFKEIEIGFPS
LEU1_RHIME       LPDRTWPSK-AITEAPIWCSVDLRDGNQALVDPMGHDRKARMFHLLLDMGFKEIEIGFPS
LEU1_AGRFC       IPDRTWPGK-TIDKAPIWCSVDLRDGNQSLVNPMGHDRKARMFKLLLEMGFKEIEIGFPS
LEU1_BRUSU       LDDRTWPSK-RIEKAPIWCSVDLRDGNQALIDPMGHDRKERMFRLLIDMGFPEIEIGFPS
LEU1_BRUME       LDDRTWPSK-RIEKAPIWCSVDLRDGNQALIDPMGHDRKERMFRLLIDMGFPEIEIGFPS
LEU1_RHILO       LTDRTWPNK-VIDKAPIWCSVDLRDGNQALIDPMGHERKARMFGLLLDMGFKEIEIGFPS
LEU1_PSEPK       LPDRTWPSK-TITQAPIWCSSDLRDGNQSLIEPMDSEKKLRFWKTLVQVGVKEIEASFPS
LEU1_PSEP1       LPDRTWPSK-TITQAPIWCSSDLRDGNQSLIEPMDSEKKLRFWKTLVQVGVKEIEASFPS
LEU1_PSEPG       LPDRTWPSK-TITEAPIWCSSDLRDGNQSLIEPMDSEKKLRFWKTLVQVGVKEIEASFPS
LEU1_PSEE4       LPDRTWPSK-TITQAPIWCSSDLRDGNQSLIEPMDSEKKLRFWKTLVQVGVKEIEASFPS
LEU1_PSE14       LPDRTWPSK-TIDAAPIWCSSDLRDGNQSLIEPMDAAKKLRFWKTLVSVGVKEIEASFPS
LEU1_PSEU2       LPDRTWPSK-TIDAVPIWCSSDLRDGNQSLIEPMDAAKKLRFWKTLVSVGVKEIEASFPS
LEU1_PSESM       LPDRTWPSK-TIDAAPIWCSSDLRDGNQSLIEPMDSVKKLRFWKTLVSVGVKEIEASFPA
LEU1_PSEPF       LPDRTWPSK-TIDAAPIWCSSDLRDGNQSLIEPMDAVKKLRFWKTLVQVGVKEIEASFPA
LEU1_PSEF5       LPDRTWPSK-TITSAPIWCSSDLRDGNQSLIEPMDAVKKLRFWKTLVAVGVKEIEASFPA
LEU1_PSEAE       LPDRTWPSK-TITEVPIWCSSDLRDGNQSLIEPMDAAKKMRFFKTLVQVGLKQIEVAFPS
LEU1_PSEA7       LPDRTWPSK-TITEVPIWCSSDLRDGNQSLIEPMDAAKKMRFFKTLVQVGLKQIEVAFPS
LEU1_PSEU5       IPDRTWPSK-AITQAPIWLSSDLRDGNQSLIEPMDAAKKMRFFKTLVQVGLKEIEVGFPS
LEU1_PSEMY       LPDRTWPDK-VIDRAPIWLSTDLRDGNQSLIEPMDAEKKMRFFKCLVAVGLKEIEVGFPS
LEU12_RALSO      LPDRTWPSK-TLTRAPIWMSTDLRDGNQALFEPMNAERKMRMFKMLVQIGFKEIEAAFPA
LEU1_HERSS       LPDRRWPSR-TLRQAPTWLSTDLRDGNQALFEPMNRERKLRLFHELVRIGFKEIEVGFPA
LEU1_MARMS       FPARTWPSK-QLKTPPRWCSTDLRDGNQALANPMDHVKKMAFFKHLIECGFKEIEVAFPA
LEU1_YEAST       LSNRKWPDN-RITRAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVNIGFKEIEVSFPS
LEU1_ALCBS       KPDRRWPNQ-RIEKAPLWAAVDLRDGNQALIKPMSVAQKRRFFQMLVELGFKEIEVGFPS
LEU12_HYDCU      LPNRQWPNQ-RLTQAPIWASVDLRDGNQALANPMTVEQKLKLWDQLVAIGFKTIEIGFPA
LEU1_MYCLE       LVDRTWPDR-VIDCAPLWCAVDLRDGNQALIDPMSPICKRRMFDLLVRMGYKEIEVGFPS
LEU1_MYCUA       VTDRTWPDR-VIDRAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPS
LEU1_CORGL       LPDRTWPDK-KITVAPQWCAVDLRDGNQALIDPMSPERKRRMFELLVQMGFKEIEVGFPS
LEU1_CORGB       LPDRTWPDK-KITVAPQWCAVDLRDGNQALIDPMSPERKRRMFELLVQMGFKEIEVGFPS
LEU1_COREF       LPDRTWPDK-KITQAPQWCAVDLRDGNQALIDPMSPERKRRMFELLVKMGFKEIEVGFPS
LEU1_STRCO       IADRTWPNQ-RITTAPRWLSTDLRDGNQALIDPMSPVRKRAMFDLLVKMGYKEIEVGFPA
LEU1_STRAW       IADRTWPDN-RVTVAPRWLSTDLRDGNQALIDPMSPARKREMFDLLVKMGYKEIEVGFPA
LEU1_KINRD       LPDRTWPTR-TITKAPRWCAVDLRDGNQALIDPMNSERKLRMFTLLVQMGYKDIEVGFPS
LEU1_ARTS2       LPDRTWPDK-VITKAPRWCAVDLRDGNQALIDPMSPARKMKMFDLLVRMGYKEIEVGFPS
LEU1_BIFLS       YPERTWPGK-RLQRAPRWCSVDLRDGNQALVNPMDSERKLRFWNLLVSMGFKEIEVGFPS
LEU1_CATAD       LTDRTWPDQ-RFSAAPLWVPVDLRDGNQALAEPMDTARKTKMFDLFLRMGYKEIEVAYPS
LEU1_NOCFA       LTDRQWPTR-RLTEAPLWVPVDLRDGNQALAEPMDPARKRRFFELLVAMGYKEIEVGYPS
LEU1_STRRD       LPGRTWPNN-IIGSAPRWLSTDLRDGNQSLATPMSPDRKLAMFELLVSMGYKEIEVGFPV
LEU1_HELHP       TPSLEWSKKEYIAKAPIWCSVDLRDGNQALITPMSLEEKITFFKLLLKVGFKEIEVGFPA
LEU1_DESHY       VKSLKWAEKEYITTPPTWCSVDLRDGNQALVVPMSLEEKLEYYHMLLKIGFKEIEVGFPA
LEU12_BACP2      NLTYDWVKNETLESAPIWCSVDLRDGNQALPIPMNLEEKLEMFQLLVEIGFKEIEIAFPA
LEU1_CLOAB       LDNREWPDK-QIEKAPIWCSVDLRDGNQALPKPMNVDEKIKMFKMLVDIGFKEIEIGFPS
LEU1_ACESD       LEDRNWPSR-KIEKAPQWCSVDLRDGNQALITPMGLKQKLRFFEYLVKMGFKTIEIGFPA
LEU1_MAGMM       LANRQWPNR-TLTKAPLWCSVDLRDGNQALANPMGPQAKRRMFDLLVEIGFKEIEVGFPS
                      *  .  .   * * . *******:*  **    *   :  ::  *   ** .:* 

LEU1_RHIL3       ASQTDFDFARWCVEE-GNVPDDVSLQVLVQCRPELITRTFEALEGANR-PIVHFYNSTSE
LEU1_RHIME       ASQTDYDFARWCVEE-GNVSEDVSLQVLVQCRPELIARTFEALEGAHR-PIVHFYNSTSE
LEU1_AGRFC       ASQTDFDFARWCVEE-GNVPDDVSLQVLVQCRPELITRTFEALEGANK-PIIHFYNSTSE
LEU1_BRUSU       ASQTDFDFCRWAIEQ-GDVPDDVDLQVLVQCRPELITRTFEALEGAKT-PIIHFYNSTSE
LEU1_BRUME       ASQTDFDFCRWAIEQ-GDVPDDVDLQVLVQCRPELITRTFEALEGAKT-PIIHFYNSTSE
LEU1_RHILO       ASQTDFDFARWCIEE-GNVPADVSLQVLVQCRPELITRTFEALKGATN-PIVHFYNSTSE
LEU1_PSEPK       ASQTDFDFVRTLIED-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATSP
LEU1_PSEP1       ASQTDFDFVRTLIQD-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATSP
LEU1_PSEPG       ASQTDFDFVRTLIQD-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATSP
LEU1_PSEE4       ASQTDFDFVRTLIED-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATCP
LEU1_PSE14       ASQTDFDFVRTLIED-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATSP
LEU1_PSEU2       ASQTDFDFVRTLIED-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATCP
LEU1_PSESM       ASQTDFDFVRTLIED-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATCP
LEU1_PSEPF       ASQTDFDFVRTLIED-GHIPDDTTIQVLTQGREDLIERTFESLRGAKK-AIVHLYNATSP
LEU1_PSEF5       ASQTDFDFVRTLIEG-GHIPDDTTIQVLTQAREDLIARTFESLRGAKK-AIVHLYNATSP
LEU1_PSEAE       ASDTDFNFVRELIEG-NHIPDDVTIQVLTQAREDLITRTFESLRGAKK-AIVHVYNATAP
LEU1_PSEA7       ASDTDFNFVRELIEG-NHIPDDVTIQVLTQAREDLITRTFESLRGAKK-AIVHVYNATAP
LEU1_PSEU5       ASQTDFDFVRELIEG-GHIPDDVTIQVLTQAREDLITRTFESLKGAKQ-AIVHYYNATAP
LEU1_PSEMY       ASQTDFDFVRELIEG-GHIPDDVTIQVLTQARDDLIERTFESLKGAKR-AIVHYYNACAP
LEU12_RALSO      ASQTDYDFVRELIEG-GHIPDDVTIEVLTQAREDLIRRTMESLRGARR-AIIHVYNATSP
LEU1_HERSS       ASRIDFETVRHLIDE-HLIPDDVTPMVMTQLRADLITETVKSVAGARR-VIVHFYNAIAP
LEU1_MARMS       ASQTDFDFVRLLIEG-KHIPDDVTIQVMTQSRVDLIERTIQSLVGAKK-AIVHIYNATAP
LEU1_YEAST       ASQTDFDFTRYAVEN-A--PDDVSIQCLVQSREHLIKRTVEALTGAKK-ATIHTYLATSD
LEU1_ALCBS       ASQIDFDFCRALIEE-DLVPDDVHIQVLTQAREDLIARTFDSLKGAKN-AIVHIYNATSP
LEU12_HYDCU      ASQLEFDFARRLIEE-NRIPDDVTVQVLVQAREHLIKRTYEALQGVKQ-AVVHVYNTTST
LEU1_MYCLE       ASQTDFDFVREIITD-GTIPDDVTIQVLTQCRPELIERTFEACENASR-VIVHFYNSTSI
LEU1_MYCUA       ASQTDFDFVREIITE-GAIPDDVTIQVLTQCRPELIERTFEACAGASK-VIVHFYNSTSI
LEU1_CORGL       ASQTDFDFVREIIEK-GMIPDDVTIQVLVQAREHLIRRTFEACEGAKN-VIVHFYNSTSI
LEU1_CORGB       ASQTDFDFVREIIEK-DMIPDDVTIQVLVQAREHLIRRTFEACEGAKN-VIVHFYNSTSI
LEU1_COREF       ASQTDFDFVREIIEK-NMIPDDVTIQVLVQAREHLIRRTFEACEGAKN-VIVHFYNSTSI
LEU1_STRCO       SGQTDFDFVRSIIEEPGAIPDDVTISVLTQAREDLIERTVESLKGARR-ATVHLYNATAP
LEU1_STRAW       SGQTDFDFVRSIIEDETAIPDDVTISVLTQAREDLIERTVESLVGAKR-ATVHLYNATAP
LEU1_KINRD       ASQTDFDFVRTLIEN-DLIPDDVRIQVLTQAREHLIERTYESLRGAKQ-AIVHLYNSTSV
LEU1_ARTS2       ASQTDFDFVRQLIEG-NHIPDDVTIQVLTQAREHLIERTYESLVGAKQ-AIVHLYNSTSV
LEU1_BIFLS       ASETDFDFIRMLIER-ELIPDDVTIVVLTQCREHLIRRTYEALKGAKR-AIVHFYNSVSV
LEU1_CATAD       ASQTDFDFVRSLAVR-DDIPEDVTISVFTPARPELIERTFESVEGLPN-VLVHLYTATAP
LEU1_NOCFA       ASQTDFDFVRLLADT-DLAPDDVTVVVFTPARRDLIERTVESIRGITNPVVVHMYTATAP
LEU1_STRRD       ASQDDFDFLRVLIEQ-ERIPEDVRISVLVQARDELIRRTVESLEGAPR-ATIHLYNATSP
LEU1_HELHP       ASETEYRFLRTLIEE-DLIPDDVSVQVLTQAREHIIKKTFESLEGCKN-AIVHVYNSTSY
LEU1_DESHY       ASETEYAFLRTLIEQ-NLIPEDVTIQVLTQSRDHIIEKTFKALVGVKK-AVVHLYNSTSV
LEU12_BACP2      ASDTEFRLLRTLIDH-HMIPDDVTIMVITQAREHIIRRTFEAIKGVPK-AIVHLYNSTSE
LEU1_CLOAB       ASETEYEFTRKLIED-KLIPEDVTIQVLTQAREHLVKKTFEALKGVKT-AIVHVYNSTSE
LEU1_ACESD       ASDTEYEFTRTLIEE-GYIPEDVTIQVLTQSRIQIINKTFEALKGTKN-AVVHLYNSTST
LEU1_MAGMM       ASRDDFQFLRDLIEQ-KAIPDDVTVQMLVQSRAHLIERTFEALQGAKR-AIVHLYTPTSS
                 :.  ::   *         . *.    :.  * .:: .* .:  .      :* * . . 

LEU1_RHIL3       LQRRVVFAKDVQGIKQIAVDAAKMITDMATKAGG--------GYRFEYSPESFTGTELDV
LEU1_RHIME       LQRRVVFGKDVAGIKQIATDAAKMITDMAAKAGG--------GYRFEYSPESFTGTELEV
LEU1_AGRFC       LQRRVVFGKDVHGIKQIAVDAAKMITDMAAKAGG--------GFRFEYSPESFTGTELEV
LEU1_BRUSU       LQRRVVFAKDVGGIKQIATDAAKMIMDMAAKAGG--------GYRFQYSPESFTGTELDV
LEU1_BRUME       LQRRVVFAKDVGGIKQIATDAAKMIMDMAAKAGG--------GYRFQYSPESFTGTELDV
LEU1_RHILO       LQRRVVFEKDVGGIKRIATDAAKMITDMAAKAGG--------GYRFEYSPESFTGTELEV
LEU1_PSEPK       SFRRIVFNQDKQGVKDIAVNAAKLFVKYAAQQPE-------TQWTFQYSPETFSATEMEF
LEU1_PSEP1       SFRRIVFNQDKQGVKDIAVNAAKLFVKYAAQQPE-------TQWTFQYSPETFSATEMEF
LEU1_PSEPG       SFRRIVFNQDKQGVKDIAVNAAKLFVKYAAQQPE-------THWTFQYSPETFSATEMEF
LEU1_PSEE4       SFRRIVFNQDKQGVKDIAVNAAKLFVKYAAQQPD-------THWTFQYSPETFSATELEF
LEU1_PSE14       SFRRIVFNQDKAGVKEIAVNAAKLFVKYAAQQPE-------TQWTFEYSPETFSATELEF
LEU1_PSEU2       SFRRIVFNQDKAGVKEIAVNAAKLFVKYAAQQPE-------TQWTFQYSPETFSATELEF
LEU1_PSESM       SFRRIVFNQDKAGVKEIAVNAAKLFVKYAAQQPE-------TQWTFEYSPETFSATELEF
LEU1_PSEPF       SFRRIVFNQDKDGIKAIAVNAAKLFVKYAAMQPD-------TEWTFEYSPETFSATELEF
LEU1_PSEF5       SFRRIVFNQDKAGVKEIAVNAAKLFVKYAAQQPE-------TQWQFEYSPETFSATELEF
LEU1_PSEAE       SFRRIVFNQDKQGVVDIATNAAKLIKKLAAEQPE-------TQWSFQYSPEIFSSTELEF
LEU1_PSEA7       SFRRIVFNQDKQGVVDIATNAAKLIRKLAAEQPD-------TQWSFQYSPEIFSSTELEF
LEU1_PSEU5       SFRRIVFNQDKAGVIQIAVNAGRIIKRLAEQNPE-------TNWRFEYSPEIFSSTEPEF
LEU1_PSEMY       SFRKIVFNQDKAGVKAIAVAAGKTIKRLAAAQPD-------TQWGFEYSPEVFSSTETDF
LEU12_RALSO      VFRRTVFNTDREGVKRIAVESAKLIREIAESMPE-------TQWTYQYSPEVFSGTELDF
LEU1_HERSS       AWREIVFGMSVPQIITLVEDHIALFRRLTAVHPE-------TEWILQYSPETFCMAELEV
LEU1_MARMS       VFREIVFCQDKPATLELAVQGVKHIRQLCEQYPD-------TQWTLQYSPETFCFTEPDF
LEU1_YEAST       MFREIVFNMSREEAISKAVEATKLVRKLTKDDPSQQ----ATRWSYEFSPECFSDTPGEF
LEU1_ALCBS       TFREQVFNVDKAGCKAIAVRAAEWVKENAAKQPD-------THWSFQYSPETFSATETDF
LEU12_HYDCU      VQREKVFCKSKADIKAMAIQGAKWVQSYAKEHPE-------SDWVFQYSPESFSQTETDY
LEU1_MYCLE       LQRRVVFRADQATVKAIATDGARKCVEEAFKYPG-------THWRFEYSPESYTGTELEY
LEU1_MYCUA       LQRRVVFRADRAAVEAIATDGARRCVEEAAKYPD-------TQWRFEYSPESYTGTELEY
LEU1_CORGL       LQRNVVFRMDKVQVKKLATDAAELIKTIAQDYPD-------TNWRWQYSPESFTGTEVEY
LEU1_CORGB       LQRNVVFRMDKDQVKKLATDAAELIKTIAQDYPD-------TNWRWQYSPESFTGTEVEY
LEU1_COREF       LQRDVVFRMNKDQVKTLATDAAELIKTIAQDYPD-------TNWRWEYSPESYTGTEVEY
LEU1_STRCO       VFRRVVFRGSRDDIKQIAVDGTRLVMEYAEKLLGP-----ETEFGYQYSPEIFTDTELDF
LEU1_STRAW       VFRRVVFRGSKDQIKQIAVDGTRLVVEYAEKLLDE-----RTTFGYQYSPEIFTDTELDF
LEU1_KINRD       LQRRVVFGMDEDGIVDLALQGARLCRKFEETIPG-------TTVYYEYSPESYTGTELEF
LEU1_ARTS2       LQRRVVFNQDEDGILDIALQGARLCKKYEETLAD-------THITYEYSPESFTGTELEY
LEU1_BIFLS       LQREVVFRKNKEEIKKLATDAAELCKDLENEAKG-------IDLYYEYSPESFTGTEPEY
LEU1_CATAD       AWRDLVLRGSRAEVLALIEDAAGLVAKLADQRLGTKHGPGAGRMRFEFSPEVFNLTEPDY
LEU1_NOCFA       TWREVVLGHDRAALRALILDGGREVLRCAGD---------LPTVRFEFSPEVFNLTEPDF
LEU1_STRRD       LFRRVVFGMSRNECKDLAVQGTRLMMKYAEKTLG------DCDLGFQYSPELFSDTELDF
LEU1_HELHP       AQREQVFRKSKDEIKHIACEGAICLKESAAATKGN--------FRFEYSPESFSGTEVDY
LEU1_DESHY       AQREQVFKMSREEIVEIAVSGARLLKKYAAETEGN--------FQFEYSPESFTGTEMEF
LEU12_BACP2      AQRRQVFKKTKDEVKQMAMDGAILVKELAEKTESD--------IYFQYSPESFPGTEVDY
LEU1_CLOAB       LQRRVVFKKDKDEVKSLAIKGAQMVKKYSEYTEYSE-----SKFVFEYSPESFTGTELDY
LEU1_ACESD       LQREVVFRNSKEETIELAVFGARAIKELALKNPET-------NFTFEYSPESFTGTEMDF
LEU1_MAGMM       LQRRVVFGKSQQEIIDVAVEGTQMIKEHAQRSPET-------EIVLEFSPESFTGTELPF
                   *  *:                                       ::*** :  :    

LEU1_RHIL3       ALEICNAVIEVVKPTPDNKLIINLPSTVEMATPNVYADQIEWMCRNLDNRENLIVSLHPH
LEU1_RHIME       ALEICNAVIEIVRPTADNKLIINLPSTVEMATPNIYADQIEWMCRNLDNRENLIVSLHPH
LEU1_AGRFC       ALEICNAVVEVVKPTADNKLILNLPSTVEMATPNIYADQIEWMCRNIDNRENVIISLHPH
LEU1_BRUSU       ALEICNAVIEIVKPTPDNKLIVNLPSTVEMNTPNVYADQIEWMCRNLDNRESLIISLHPH
LEU1_BRUME       ALEICNAVIEIVKPTPDNKLIVNLPSTVEMNTPNVYADQIEWMCRNLDNRESLIISLHPH
LEU1_RHILO       ALEICNAVTEIVRPKPDNKLIINLPSTVEMSTPNIYADRIEWMCRNLDNRENLIISLHPH
LEU1_PSEPK       AKEVCDAVIEVWNPTPEHKIILNLPATVEVSTPNIYADQIEWFCRNVSRRDSVIISLHCH
LEU1_PSEP1       AKEVCDAVIEVWNPTPEHKIILNLPATVEVSTPNIYADQIEWFCRNVSRRDSVIISLHCH
LEU1_PSEPG       AKEVCDAVIEVWNPTPEHKIILNLPATVEVSTPNIYADQIEWFCRNVSRRDSVIISLHCH
LEU1_PSEE4       AKEVCDAVIEVWNPTPEHKIILNLPATVEVATPNVYADQIEWFCRNINRRDSVIISLHTH
LEU1_PSE14       AKEVCDAVIEVWNPTPENKVILNLPATVEVATPNIYADQIEWFGRNITRRDSVLISLHTH
LEU1_PSEU2       AKEVCDAVIEVWNPTPENKVILNLPATVEVATPNIYADQIEWFGRNITRRDSVLISLHTH
LEU1_PSESM       AKEVCDAVIEVWNPTPENKVILNLPATVEVATPNIYADQIEWFGRHITRRDSVLISLHTH
LEU1_PSEPF       AKEVCDAVIEVWNPTPEHKIILNLPATVECATPNVYADQIEWFHRNINRRDSVIISLHTH
LEU1_PSEF5       AKEVCDAVVEVWNATPSNKVILNLPATVEVATPNIYADQIEWFCRNINRRDSVLISLHTH
LEU1_PSEAE       SVEVCNAVIDVWQPTPDNKIILNLPATVECATPNVYADQIEWFGRHVDKRDSVIISLHTH
LEU1_PSEA7       SVEVCNAVIDVWQPTPEHKIILNLPATVECATPNVYADQIEWFGRHVNRRDSVIISLHTH
LEU1_PSEU5       AVEVCNAVIEVFQPTPEQKLILNLPATVEAATPNVYADQIEWFCRHIDRRDSVLVSLHTH
LEU1_PSEMY       AVEVCNAVIEVFQPTPANKLILNLPATVECATPNNYADQIEWFGRHVDRRDSVLISVHTH
LEU12_RALSO      ALEVCNAVTEAWDPTPAHKIIFNLPATVEMATPNVYADQIEWMHRHLARRDSILLSVHPH
LEU1_HERSS       SLEVCNAAIRAWDAGPRRRMIINLPTTVEVSTPNVFADQIEWMDRRLERREHLILSVHPH
LEU1_MARMS       ALEVCEAAAKTWQPSLERPMILNLPTTVEVNTPNVFADQIEHFITSFSSLENITISVHPH
LEU1_YEAST       AVEICEAVKKAWEPTEENPIIFNLPATVEVASPNVYADQIEYFATHITEREKVCISTHCH
LEU1_ALCBS       AIEVIDAVNAVWRPDQGQRVIINLPATVEVSTPNVFADQVEMVHDNIQYRDDVIISVHTH
LEU12_HYDCU      AVEVCQAVMDVWQPTPDNRCILNLPATVESTSPNRFADQVEYFITHLKNRESAIISIHTH
LEU1_MYCLE       AKQVCDAVGEVIQPTPDNPIIFNLPATVEMATPNVYADSIEWMSRNLANRESVILSLHPH
LEU1_MYCUA       AKQVCDAVAEVIQPTPENPIIFNLPATVEMATPNVYADSIEWMSRNLANRESVILSLHPH
LEU1_CORGL       AKEVVDAVVEVMDPTPENPMIINLPSTVEMITPNVYADSIEWMHRNLNRRDSIILSLHPH
LEU1_CORGB       AKEVVDAVVEVMDPTPENPMIINLPSTVEMITPNVYADSIEWMHRNVNRRDSIILSLHPH
LEU1_COREF       AKEVVDAVVEVMDPTPENPIIINLPATVEMITPNVYADSIEWMHRNLNRRDSIILSLHPH
LEU1_STRCO       ALEVCEAVMDTYQPGPGREIILNLPATVERSTPSTHADRFEWMGRNLSRREHVCLSVHPH
LEU1_STRAW       ALEVCEAVMDVWQPGPDREIILNLPATVERSTPSTHADRFEWMSRNLSRREYVCLSVHPH
LEU1_KINRD       AARICNAVVAVFEPTPERQVIVNLPATVEMATPNVYADSIEWMSRHLDQRENVIISLHPH
LEU1_ARTS2       AVRVCNAVADVFEASADSQVIINLPATVEMATPNVYADSIEWMSRHLHPREGIILSLHPH
LEU1_BIFLS       AVEVCNAVIGVIKPTPEHPMIINLPATVEMTTPNVFADEVEYVSTHLDDRDSVVLSLHPH
LEU1_CATAD       VIEVCDRVTEIWDACADRPVVHNLPATVEVATPNVYADQIEYMSRSLARREHVILSVHPH
LEU1_NOCFA       VLEICDAMTELWQATPQRPVILNLPATVEVATPNVYADQIEYMHRNLARRDSVILSVHPH
LEU1_STRRD       SLEVCEAVMDVWQPEPGRGIILNFPTTVERSLPNVFADQIEWLSRNLSRREHVCLSIHPH
LEU1_HELHP       ALEVCNAVIDIFEPTLEKKLIINLPVTVEMSLPHIYASQVEYMSKHLKNRENVLISLHPH
LEU1_DESHY       ALEICNQVLDVFEPTPENKVIINLPATVSLSMPHVYASQIEYMSEHLKYRDNVILSLHPH
LEU12_BACP2      ALDICNSVLDIWKPTPNHKAIINIPTTVEYSMPHIFASQIEYIHKNLSYRDSVTLSVHPH
LEU1_CLOAB       ALEVCEAVLNVWKPSKENKAIINLPSTVEMATPNIYADQIEWFCKKLLNRESVILSLHTH
LEU1_ACESD       AAEICNSVIDVWKPTKDKKVIINLPSTVEMATPNTYADQIEYMCRNLKSRENIIVSLHAH
LEU1_MAGMM       ALAISEAVQQVWQPTPAQPMILNLPATVEMSTPNIYADQIEWMLSHLSDPQSIIISLHAH
                    : :       .      : *:* **.   *  .*. .* .   .   :   :* * *

LEU1_RHIL3       NDRGTGIAAAELALLAGADRVEGTLFGNGERTGNVDMVTMALNMFTQGVDPEIDCSNIER
LEU1_RHIME       NDRGTGIAATELGLMAGADRVEGTLFGNGERTGNVDVVTLALNMFTQGVDPKLDCSDIER
LEU1_AGRFC       NDRGTGIAATELALMAGADRVEGTLFGNGERTGNVDVVTLALNMYTQGVDPELDCRDIER
LEU1_BRUSU       NDRGTGIAATELGLMAGADRVEGTLFGNGERTGNVDVVTLALNMYTQGIDPGLDCTDINR
LEU1_BRUME       NDRGTGIAATELGLMAGADRGEGTLFGNGERTGNVDVVTLALNMYTQGIDPGLDCTDINR
LEU1_RHILO       NDRGTGIATTELGLMAGADRVEGTLFGNGERTGNVDIVTLALNMYTQGVDPGIDCSDINR
LEU1_PSEPK       NDRGTGIAATELGLMAGADRAEGCLFGNGERTGNVDLVTLALNLYTQGIDPLLDFSDIDG
LEU1_PSEP1       NDRGTGIAATELGLMAGADRAEGCLFGNGERTGNVDLVTLALNLYTQGIDPLLDFSDIDG
LEU1_PSEPG       NDRGTGIAATELGLMAGADRAEGCLFGNGERTGNVDLVTLALNLYTQGIDPQLDFSDIDG
LEU1_PSEE4       NDRGTGIAATELGLMAGADRAEGCLFGNGERTGNVDLVTLALNLYTQGIDPQLDFSDIDG
LEU1_PSE14       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNLYTQGIDPELDFSDIDG
LEU1_PSEU2       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNLYTQGINPGLDFSDIDG
LEU1_PSESM       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNLYTQGINPELDFSDIDG
LEU1_PSEPF       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGINPDLDFSDIDG
LEU1_PSEF5       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNLYTQGVNPELDFSDIDG
LEU1_PSEAE       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTLALNMYTQGLHPQLDFSDIDA
LEU1_PSEA7       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTLALNMYTQGLHPQLDFSDIDA
LEU1_PSEU5       NDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGVDPQLDFSDIDA
LEU1_PSEMY       NDRGTGVAASELAVMAGADRVEGCLFGNGERTGNVCLVTLALNLYTQGVDPQLDFSDIDA
LEU12_RALSO      NDRGTAVAAAELAVMAGADRVEGCLFGNGERTGNVDLVTLALNLYSQGIDPGLDFSHVND
LEU1_HERSS       NDRGTAVACAEQAMLAGAQRVEGCLFGNGERSGNVDVVTLALNLYTQGIAPGLDFSDIAA
LEU1_MARMS       NDRGTGVATAEMAILAGAQRVEGCLFGNGERTGNVDLVTLAMNLYSQGVYPNLDFSDMRR
LEU1_YEAST       NDRGCGVAATELGMLAGADRVEGCLFGNGERTGNVDLVTVAMNMYTQGVSPNLDFSDLTS
LEU1_ALCBS       DDRGCGVAAAEMAVMAGADRVEGTLLGNGERTGNMDLVTAGMNLYSQGIDPGIDFSRMKE
LEU12_HYDCU      NDRGCAVAAAELSLLAGADRVEGTLLGNGERTGNMDIVTLAMNLYSEGIDPELNLSDPDS
LEU1_MYCLE       NDRGTAVAAAELGYHAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDE
LEU1_MYCUA       NDRGTAVAAAELGFAAGADRIEGCLFGNGERTGNVCLATLGLNLFSRGVDPQIDFSNIDE
LEU1_CORGL       NDRGTGVGAAELGYMAGADRIEGCLFGNGERTGNVCLVTLALNMLTQGVDPQLDFTDIRQ
LEU1_CORGB       NDRGTGVGAAELGYMAGADRIEGCLFGNGERTGNVCLVTLALNMLTQGVDPQLDFTDIRQ
LEU1_COREF       NDRGTGVAAAELGYMAGADRIEGCLFGNGERTGNVCLVTLALNMLTQGVDPQLDFSDIKH
LEU1_STRCO       NDRGTAVAAAELALMAGADRIEGCLFGQGERTGNVDLVTLGMNLFSQGVDPQIDFSDIDE
LEU1_STRAW       NDRGTAVAAAELALMAGADRIEGCLFGQGERTGNVDLVTLGMNLFSQGVDPQIDFSNIDE
LEU1_KINRD       NDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVDLVTLGMNLFSQGIDPQIDFSDIDH
LEU1_ARTS2       NDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVDLVTLGLNMFVQGIDPMIDFSDIDD
LEU1_BIFLS       NDEGMGVAATELAVLAGADRVEGCLLGNGERTGNVDLVTLGLNWLTQGIDPQLDLSNVPE
LEU1_CATAD       NDRGTGVACAELAVLAGAQRVEGCLFGNGERTGNVDLVTLALNLHAQGVDPMIDLSDIDA
LEU1_NOCFA       NDRGTGIACAELAVLAGAQRVEGCVFGNGERTGNVDIATLALNLHAQGVDPMIDFSDIDE
LEU1_STRRD       NDRGTAVASAELALLAGAERIEGCLFGNGERAGNVCLVTLGLNMFTHGVDPGIDFSDINE
LEU1_HELHP       NDRGCAIADAELGLLAGADRIEGTLFGNGERTGNVDIITLAMNMHSHGVDPKLDFSNIPS
LEU1_DESHY       NDRGTAVADAELGLLAGGQRIEGTLFGNGERTGNVDIVTLALNLFSHGVDPGLNFASMLE
LEU12_BACP2      NDRGSGVSDAEFGVLAGAERVEGTLFGIGERTGNVDLITLAMNMYSQGYDPKLNFNNLEA
LEU1_CLOAB       NDRGTCTASSELGILAGADRVEGTLFGNGERTGNLDIMNMALNMYSQGVDPELEFSNLND
LEU1_ACESD       NDRGTGVAATELGLMAGADRVEGTLFGNGERTGNADILNLGMNLYTQGINPELDFSDINS
LEU1_MAGMM       NDRGTAVAATELAMLAGAGRVEGTLFGNGERTGNTDVVAVAMNLHSQGIDAGLNFSEMPR
                 :*.*   . :* .  **. * ** ::* ***:**  :   .:*   .*  . ::      

LEU1_RHIL3       IKEVFEYSNQMAIGERHPYVGELVYTAFSGSHQDAINKGMKAAQVA--------------
LEU1_RHIME       IKEVYEYSNQMVIPERHPYVGELVYTAFSGSHQDAINKGMKAIKQA--------------
LEU1_AGRFC       IKAVYEYSNEMTIPERHPYVGELVYTAFSGSHQDAINKGMKAIKVA--------------
LEU1_BRUSU       MKEVYEYSNQLKIAERHPYVGELVYTAFSGSHQDAINKGMKARRSA--------------
LEU1_BRUME       MKEVYEYSNQLKIAERHPYVGELVYTAFSGSHQDAINKGMKARRSA--------------
LEU1_RHILO       MKDVYEYSNQLKIPERHPYVGELVYTAFSGSHQDAINKGMKALKKA--------------
LEU1_PSEPK       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAKQQ----------------
LEU1_PSEP1       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAKQQ----------------
LEU1_PSEPG       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAKQQ----------------
LEU1_PSEE4       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAKQQ----------------
LEU1_PSE14       VRKVVEECNQIPVHPRHPYVGDLVHTAFSGSHQDAIRKGFTQQK----------------
LEU1_PSEU2       VRKVVEECNQIPVHPRHPYVGDLVHTAFSGSHQDAIRKGFTQQK----------------
LEU1_PSESM       VRKVVEECNQIPVHPRHPYVGDLVHTAFSGSHQDAIRKGFTQQK----------------
LEU1_PSEPF       VRKVVEECNQIQVHPRHPYVGDLVHTAFSGSHQDAIRKGFAQQK----------------
LEU1_PSEF5       VRKVVEECNQIAVHPRHPYVGDLVHTAFSGSHQDAIRKGFAQQK----------------
LEU1_PSEAE       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAQQK----------------
LEU1_PSEA7       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAQQK----------------
LEU1_PSEU5       VRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFSQQD----------------
LEU1_PSEMY       VRKVVEDCNQIPVHPRHPYAGDLVHTAFSGSHQDAIRKGFAQQK----------------
LEU12_RALSO      VARTCEDCTQLPVHPRHPYVGDLVFTAFSGSHQDAIKKGFAVQK----------------
LEU1_HERSS       LARVAEECTALPIHPRHPYVGDLVFTAFSGSHQDAIAKGFAAQR----------------
LEU1_MARMS       TVELVEECNELPVHPRHPYAGALAFTAFSGSHQDAIKKGFASQKST--------------
LEU1_YEAST       VLDVVERCNKIPVSQRAPYGGDLVVCAFSGSHQDAIKKGFNLQNKKRAQ-----------
LEU1_ALCBS       IVALVEEITDIQTHPRHPYAGDLVFSAFSGSHQDAIRKCLARYQ----------------
LEU12_HYDCU      WVPVIEEVTKIDTHVRHPWVGEAVYTAYSGSHQDAIRKCLMRQK----------------
LEU1_MYCLE       IRRTVEYCNKLRVHERHPYGGDLVYTAFSGSHQDAINKGLDQMKIDADAADSDVD-----
LEU1_MYCUA       IRRTVEYCNQLPVPERHPYGGDLVYTAFSGSHQDAINKGLDAMEFDADAADSDMD-----
LEU1_CORGL       IRSTVEYCNQLRVPERHPYGGDLVFTAFSGSHQDAVNKGLDAMAAKVQPGASSTEVSWEQ
LEU1_CORGB       IRSTVEYCNQLRVPERHPYAGDLVFTAFSGSHQDAVNKGLDAMAAKVKPGANSTDVSWEE
LEU1_COREF       IRRTVEYCNQLRVPERHPYGGDLVFTAFSGSHQDAINKGLDALAAKVKPGASSTEVAWEE
LEU1_STRCO       IRRTWEYCNQMEVHPRHPYVGDLVYTSFSGSHQDAIKKGFDAMEADAAARGVTVD-----
LEU1_STRAW       VRRTAEYCNQMEVHARHPYVGDLVYTSFSGSHQDAIKKGFDAMEADAAAKGVTVD-----
LEU1_KINRD       IRRTVEHCNQLPVGERVPYGGDLVFTAFSGSHQDAIKKGLEAMERDAAAAGKTVD-----
LEU1_ARTS2       VRRTVEYCNQLPVAERSPYGGDLVFTAFSGSHQDAIKKGFEALEKDAAAAGKDVA-----
LEU1_BIFLS       IRKTVEYCNQIKISERHPYAGNFVFTAFSGSHQDAIKKGLEARQVAAERAGADLD-----
LEU1_CATAD       VKAVVEECNRIPVHVRHPYGGDLVYTAFSGTHQDAISKGMAHHAARAAELGVPAS-----
LEU1_NOCFA       IRRTVEYCNRVEIHARHPYVGDLVHTAFSGTHQDAIKKGLAEHRARAAARGVPER-----
LEU1_STRRD       IRRTVERCNGLAVHPRHPYGGDLVYTSFSGSHQDAIKKGFDALEREAAHRGAAVG-----
LEU1_HELHP       ICDVYEKVTKMQVYERQPYSGKLVFAAFSGSHQDAIAKGMAYHKEH--------------
LEU1_DESHY       ITAKYEALTRMKVHDRQPYGGKLVFAAFSGSHQDAITKGIKWREEH--------------
LEU12_BACP2      IRKQYEKLTNITVHERQPYSGEMVFTAFSGSHQDAISKGMKYRKEH--------------
LEU1_CLOAB       IVEAYEECTKMVVHERHPYAGKLVFTAFSGSHQDAIRKGLKSLKEG--------------
LEU1_ACESD       MIEIYEESTAMNVHPRHPYAGDLVFTAFSGSHQDAIKKGMARMNK---------------
LEU1_MAGMM       IIATSEACTGMSVPPRQPYAGELVFTAFSGSHQDAIRKGLHLHKQE--------------
                      *  . :    * *: *  .  ::**:****: * :                    

LEU1_RHIL3       -NHPVWEVPYLPIDPRDVGRSYE-AIIRINSQSGKGGIAYILQQDYGLNLPRNLQVEFRE
LEU1_RHIME       -NKPTWEVPYLPIDPRDVGRSYE-AIIRINSQSGKGGIAYILQEDYGINLPRNLQIEFRE
LEU1_AGRFC       -NHPVWEVPYLPIDPKDVGRSYE-AIIRINSQSGKGGIAYILQQDYGINLPRNLQVEFRE
LEU1_BRUSU       -NSPVWEVPYLPIDPQDVGRSYE-AIIRINSQSGKGGIAYILQADYGLNLPRNLQVEFRE
LEU1_BRUME       -NSPVWEVPYLPIDPQDVGRSYE-AIIRINSQSGKGGIAYILQADYGLNLPRNLQVEFRE
LEU1_RHILO       -NTSLWEVPYLPIDPADVGRSYE-AIIRINSQSGKGGIAYVLQADYGLNLPRNLQIEFSQ
LEU1_PSEPK       -DGELWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEP1       -DGELWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEPG       -EGERWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEE4       -EGELWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQ
LEU1_PSE14       -DGELWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEU2       -EGELWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGIAYLLEQEYGISLPRRMQIEFSQ
LEU1_PSESM       -EGELWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGIAYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEPF       -PDTLWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGIAYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEF5       -ADGLWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGIAYLLEQEYGISLPRRMQIEFSQ
LEU1_PSEAE       -EDAIWEVPYLPIDPADIGRDYE-AVIRVNSQSGKGGITFLLEQEYGISLPRRMQIEFSQ
LEU1_PSEA7       -EDAIWEVPYLPIDPADIGRDYE-AVIRVNSQSGKGGITFLLEQEYGISLPRRMQIEFSQ
LEU1_PSEU5       -PNGLWEVPYLPIDPADIGRSYE-AVIRVNSQSGKGGITFLLEQEYGISLPRRMQIEFSQ
LEU1_PSEMY       -DDAVWEVPYLPIDPADIGRDYE-AVIRVNSQSGKGGITFLLEQEYGISLPRRMQIEFSQ
LEU12_RALSO      -PDAIWEMPYLPIDPADVGRTYD-SIIRVNSQSGKGGVAYLLESGYGIAMPRRLQVEFSS
LEU1_HERSS       -PDAPWRVPYLPIDPTDLGRTYD-SIVRVNSQSGKGGIAFLLQRDHHITMPRRMQVEFSA
LEU1_MARMS       -SSMIWQIPYLPLDPKDIGCTYE-EVIRVNSQSGKSGAAWLLQENHGLFLPRKLQIDFSK
LEU1_YEAST       -GETQWRIPYLPLDPKDIGRDYE-AVIRVNSQSGKGGAAWVILRSLGLDLPRNMQIEFSS
LEU1_ALCBS       -EGDIWTAAYLPIDPADVGRRYE-EVVRINSQSGKGGVAHVLERDFGIDLPRWLQQELAG
LEU12_HYDCU      -DDEPWNVAYLPIDPKDLNRSYE-AIIRVNSQSGKAGAAFVLTQEYDLNLPKWVQQDFAP
LEU1_MYCLE       --DILWQVPYLPIDPRDVGRTYE-AVIRVNSQSGKGGVAYIMKADHGLELPRRLQIEFSR
LEU1_MYCUA       --DMLWQVPYLPIDPKDVGRTYE-AVIRVNSQSGKGGVAYIMKADHGLALPRRLQIEFSR
LEU1_CORGL       LRDTEWEVPYLPIDPKDVGRDYE-AVIRVNSQSGKGGVAYIMKTDHGLQIPRSMQVEFST
LEU1_CORGB       LRDTEWEVPYLPIDPKDVGRDYE-AVIRVNSQSGKGGVAYIMKTDHGLQIPRSMQVEFSA
LEU1_COREF       LRSTEWEVPYLPIDPKDVGRDYE-AVIRVNSQSGKGGVAYIMKTDHGLKMPRSMQVEFSA
LEU1_STRCO       --DIEWAVPYLPIDPKDVGRSYE-AVIRVNSQSGKGGIAYVLKNDHSLDLPRRMQIEFSK
LEU1_STRAW       --DIEWAVPYLPIDPKDVGRSYE-AVIRVNSQSGKGGIAYVLKNDHKLDLPRRMQIEFSK
LEU1_KINRD       --EIPWAVPYLPIDPRDVGRSYE-AVIRVNSQSGKGGVAYLLKAEHQLDLPRRLQIEFSR
LEU1_ARTS2       --DYTWQVPYLPVDPKDLGRSYE-AVIRVNSQSGKGGVAYLLKNEHSLDLPRRAQIEFSG
LEU1_BIFLS       --SFVWLVPYLPIDPKDIGRTYE-AIIRVNSQSGKGGMAYLLKTNHNLDLPKRLQIEFDK
LEU1_CATAD       --QAPWDVPYLPIDPADVGRSYQ-GVIRVNSQSGKGGIAYLLRTHYGVDLPRDFQPGFSK
LEU1_NOCFA       --EIDWRVPYLPIDPADIGRSYD-AVIRVNSQSGKGGIAYLLESEYGTVLPRRLQIDFAR
LEU1_STRRD       --DLPWEMPYLPLDPEDVGRTYE-AVVRINSQSGKGGVAYVMSAWHGLNLPRDLQIDFAH
LEU1_HELHP       -NLSTWSVPYLPIDPKDVGRVYESDVIRINSQSGKGGIAYILHHHYGVNLPPLFREEFSY
LEU1_DESHY       -ECHYWNVPYLLIDPQDIGREYEGDVIRINSQSGKGGIAYMLEQHYALDLPAKMREAFGY
LEU12_BACP2      -HVDKWDVPYIPVDPVDLGRNYQTDVIRINSQSGKGGIGYILETNYGIQLPYQMNEAMGY
LEU1_CLOAB       -KNKHWEVPYLAVDPHDLGREYE-EIIRINSQSGKGGTAYIMESDFGFILPKAMHPEFGK
LEU1_ACESD       -QAQYWEVPYLPLDPKDIGKSYE-PIIRINSQSGKGGVSFILEQNYGLYIPKDFQKDAGR
LEU1_MAGMM       -QAQQWAVPYLPIDPQDLGRHYE-PVIRINSQSGKGGMAFIMEERCGIHMPKAMQVEFSR
                      *  .*: :** *:.  *:  ::*:******.*   ::       :*   .     

LEU1_RHIL3       DIQRITDV---EGKELPSRRIYDRFIERYVTQPE-------------------GRLRFVD
LEU1_RHIME       EVQRITDE---EGKELPSKRIHQRFIESYVEQPG-------------------ARIKFVD
LEU1_AGRFC       DIQRITDE---EGVELPAKRIYERFIERYVTQPN-------------------ARIKFVD
LEU1_BRUSU       IIQHITDE---EGKELPSKRIYEEFQKLYVTQPD-------------------ARIKFVD
LEU1_BRUME       IIQHITDE---EGKELPSKRIYEEFQKLYVTQPD-------------------ARIKFVD
LEU1_RHILO       AIQAITDA---EGKEVPAKRIHERFLETYVDQPG-------------------ARLKFLD
LEU1_PSEPK       VVQGETDR---LGLEMTAQQIYSLLHKEYLQA----------------------NAPYAL
LEU1_PSEP1       VVQGETDR---LGLEMTAQQIYSLLHKEYLQA----------------------NAPYAL
LEU1_PSEPG       VVQGETDR---LGLEMTAQQIYSLLHKEYLQA----------------------NAPYAL
LEU1_PSEE4       VVQGETDR---LGLEMTAEQIYKLLQKEYLQA----------------------NAPYAL
LEU1_PSE14       VVQGETDR---LGLEMSAQQIHSLLRREYLQA----------------------NTPYAL
LEU1_PSEU2       VVQGETDR---LGLEMTAEQIHSLLRREYLQA----------------------NVPYAL
LEU1_PSESM       VVQGETDR---LGLEMTAEQIHALLRREYLQA----------------------NTPYAL
LEU1_PSEPF       VVQRETDR---LGLEMTAQQIHALLHSEYLQA----------------------NTPYAL
LEU1_PSEF5       VVQRETDR---LGLEMTAQQIHALLHSEYLQA----------------------NTPYAL
LEU1_PSEAE       VVQGETDR---LGLEMTAQQIYSLLENEYLKA----------------------TSPYVL
LEU1_PSEA7       VVQGETDR---LGLEMTAQQIYSLLENEYLKA----------------------TSPYAL
LEU1_PSEU5       VVQKETDR---LGLEMSAKQIYALLEAEYLQA----------------------TAPYTL
LEU1_PSEMY       VVQRETDR---LGLEMTAAQIYQLLESEYLQA----------------------SAPYAL
LEU12_RALSO      TVQQLTDA---SGREATAADIWALFQETYLRA----------------------DGPIGY
LEU1_HERSS       IVQALADA---SETELTSEHLWDVFERTYLAPVQASPDFSDR----TSLAPALEQRRFIY
LEU1_MARMS       KVKNHTDQ---TGHEMPLADVWRLFRESYRLNPD-------------------DKGQMKL
LEU1_YEAST       AVQDHADS---LGRELKSDEISKLFKEAYNYNDE-------------------QYQAISL
LEU1_ALCBS       VVQGDAEE---DGGEITSERVHRRFNSDYLNV----------------------PMGWVL
LEU12_HYDCU      VAQTIAEQ---AGGIVSHQMLYDAFIQHYRLD----------------------KSLAEL
LEU1_MYCLE       AIQKISEG---EGGEITPTEMWDVFFEEYLSP----------------VQP---LERIKQ
LEU1_MYCUA       AIQEIAEGSAGEGGEVSPKEMWDAFAEEYLAP----------------VRP---LERIKQ
LEU1_CORGL       VVQNVTDA---EGGEVNSKAMWDIFATEYLER----------------TAP---VEQIAL
LEU1_CORGB       VVQNVTDA---EGGEVNSKAMWDIFATEYLER----------------TAP---VEQIAL
LEU1_COREF       VVQNVTDA---EGGEVNSKEMWDIFATEYLDR----------------SAP---VEQIAL
LEU1_STRCO       LIQAKTDA---EGGEITPTAIWDVFQDEYLPN----------------PDN--PWGRIQV
LEU1_STRAW       IIQTKTDA---EGGEVTPKDIWAVFQDEYLPN----------------PRN--PWGRIQV
LEU1_KINRD       VIQERTDA---QGGEVSAAQIFDVFSDEYLPS----------------GSGTPEWGRFAL
LEU1_ARTS2       VIQKRTDT---VGGEVSGAQLWQIFQDEYLPS----------------SKEDGQWGRYSL
LEU1_BIFLS       IVQNYADT---TKKEVKDGDIWRLFKDEYLPVEQSGMTAAGVVVGDTHDASLEPWGRLKL
LEU1_CATAD       VVQRATDE---HGREMTPQDLWELFRTTYVVPGED-------------------GAWKLT
LEU1_NOCFA       HVQQHTDD---TGREVTAAELWSLFSAVYLREGE-------------------------A
LEU1_STRRD       VVQSQADA---EGGEITPDRVKRLFEREYLSSSD--------------------------
LEU1_HELHP       YVKNISDK---AHKELSPDEICEIFQNDFVNL----------------------NNTLCV
LEU1_DESHY       KVKNVSDN---LHKELMPEEIKDIFFKEYVNI----------------------ENPIKF
LEU12_BACP2      EAKKVSDQ---SNRELSVEEIYHVFEKQYVDF----------------------HPHFQL
LEU1_CLOAB       VIKKKSDE---LDCELSPEQIFKFFKEEYLEN----------------------RSPYYL
LEU1_ACESD       VITAYSDK---MQTEIGAEEIYEVFLNEYVDI----------------------RTPLQL
LEU1_MAGMM       VIQAVTDE---MGRELQADEIEQLFFKNFVLQ----------------------ENPLSL
                      ::             :   :   :                               

LEU1_RHIL3       HHTYPDTEH-------KGQRIVAAEITDNGE---------IKRIEGRGNGPIDGFINALS
LEU1_RHIME       HHTYPAGEH-------KGLRVVAAEITDGGE---------TRQIEGKGTGPIDGFINALS
LEU1_AGRFC       HHTYPAGDF-------KGVRIVAAEITDNGE---------VKRIEGKGTGPIDGFINALS
LEU1_BRUSU       HHTYPDPEQ-------KGRRILTAEITDNGV---------TKTIEGKGTGPIDGFVDALS
LEU1_BRUME       HHTYPHPEQ-------KGRRILTAEITDNGV---------TKTIEGKGTGPIDGFVDALS
LEU1_RHILO       HHTYPDTAV-------KGRRVIEAVILDKGK---------EVTISGTGTGPIDGFVDALS
LEU1_PSEPK       VSHRLQE-E-------NGHSAVEVEVAGEGE--------TTLHWRGKGNGALEALV----
LEU1_PSEP1       VSHRLQE-E-------NGHSAVEVEVAGEGE--------TTLHWRGKGNGALEALV----
LEU1_PSEPG       VSHRLQE-E-------NGHSAVEVEVAGEGE--------TTLHWRGKGNGALEALV----
LEU1_PSEE4       VSHRLQE-E-------NGSSHVQVEVSGEGE--------TTLHWHGKGNGALEALV----
LEU1_PSE14       ISHKLQE-E-------NGNSAVDAEVHVDGE---------TQHWRGKGKGALEALV----
LEU1_PSEU2       ISHKLQE-E-------NGNSSVDAEVHVDGE---------TQHWRGKGKGALEALV----
LEU1_PSESM       ISHRLQE-E-------NGNSAVDAEVHVDGE---------TQHWRGKGKGALEALV----
LEU1_PSEPF       VSHRLQE-E-------NGNSAVEVEVASKGQGE------TNLHWRGKGNGALEALV----
LEU1_PSEF5       VSHRLQE-E-------NGHSAVEVEVSSKGQGE------TNLSWRGKGNGALEALV----
LEU1_PSEAE       ASHRLQE-E-------NGTSAVDLEVSFDGE---------KQHWRGIGKGPLEALV----
LEU1_PSEA7       ASHRLQE-E-------NGTSAVDLEVTFDGE---------KQHWRGIGKGPLEALV----
LEU1_PSEU5       KGHRLQE-E-------NGTSAVDVEVAADGE---------VIHWRGIGKGPLEALV----
LEU1_PSEMY       KGHRLQE-E-------NGTSAVDVEVISAGE---------SHHWRGIGKGPLEALV----
LEU12_RALSO      VSHRLAERD-------DGSQHIRLVVNIADR---------EHVCEGVGNGPLDALVQALA
LEU1_HERSS       RSHCLHPHP-------DGERIVLELADTEGN---------VRTVEGSGNGPIAATV----
LEU1_MARMS       MDYRSHS-S-------NGLQEIRATLRYQEK---------TWQLVGEGKGLLSAMLDALR
LEU1_YEAST       VNYNVEKFG-------TERRVFTGQVKVGDQ---------IVDIEGTGNGPISSLVDALS
LEU1_ALCBS       RSYDLNR-S-------NEQVQAQISIGDDRQ--------PVTLLSGRGDGAMSALVDALN
LEU12_HYDCU      NNYQLSR-K-------EGKEHLSVEVNGET-------------WQGQGNGTLSALCDAWQ
LEU1_MYCLE       RVNAAEED--------GGSTSIAATVKING---------EETEISGVGNGPLAAFIDAL-
LEU1_MYCUA       RVIAAEED--------GGTTSIDATVKIDG---------KEAEISGSGNGPLAAFVHAL-
LEU1_CORGL       RVENAQTE--------NEDASITAELIHNG---------KDVTVDGRGNGPLAAYANAL-
LEU1_CORGB       RVENAQTE--------NEDASITAELIHNG---------KDVTVDGHGNGPLAAYANAL-
LEU1_COREF       RVENAQTE--------NDDATITAELVVDG---------ENQTVSGRGNGPLAAYANAL-
LEU1_STRCO       ANGQTTTDR-------DGVDTLTVDATVDG---------AETTLVGSGNGPISAFFHAL-
LEU1_STRAW       KTGQTTTDK-------DGVDTLTVEASVDG---------VDTVLTGSGNGPISAFFDAL-
LEU1_KINRD       RGTRSVSVV-------DGADTLEVDLHDDG---------AENTVRGTGNGPIAAFCAAL-
LEU1_ARTS2       GSFSTETDD-------DGAMTLHATVTVDG---------VQVRRTGSGNGPIAALLSIL-
LEU1_BIFLS       LKVAVSSGE-------DGSDTVLKARLLDRGVNVGDDEPVEREASGIGNGPIAAFLNAI-
LEU1_CATAD       DTAFQEIEG-------GGHRVEATAVRADG---------TVIPVAGIGNGPLSALTVAL-
LEU1_NOCFA       DAPQADL----------GNRLGIDGVVASG---------A----------SAAELGAAL-
LEU1_STRRD       ---LPVPLA-------SGTELVTTSLHIDG---------ERFDVGADRADTVQAVRATL-
LEU1_HELHP       QDFHFTHIDSKPSQEFNVKLHILYAKENSKT---------QQEITGKGNGRLDSIANALR
LEU1_DESHY       LNFHFLNHD-----DFQTTVTLEFKGE-------------IQELSGEGDGRLDAISNALQ
LEU12_BACP2      LDYQFHKGE-----KQEVTLTLLRDHQ-------------QIDIQGTGTGSLDAISNALK
LEU1_CLOAB       KNYKIHSIQNIE--EEKNTVDIEAVISVNGK---------DTSIEGVGNGPVDAFFNAMN
LEU1_ACESD       NYHKTQSVD-----SDWDLVFIEAEIEYNMQ---------KHYVQAEGNGVVSAFCNSLK
LEU1_MAGMM       GHVEHREET-------EERHHLHAQVSYAGT---------VQALQAHGNGPMSALVNALE
                                                                             

LEU1_RHIL3       HYLGIEMSVEDYSEH--SLQHGS----NAAAISYVETSYP------GGKLFGAGINTNIV
LEU1_RHIME       IYLGIELSVADYSEH--SLQHGS----NAAAIAYVEVEYP------GGKLFGVGINTNIV
LEU1_AGRFC       VYLGVDLSVNDYSEH--SLQHGS----NASAIAYVEMEHP------GGKLFGAGVNTNIV
LEU1_BRUSU       KYLGVKMSVVDYSEH--SLQQGS----DASAISYVEMVYP------GGKLFGVGINDNIV
LEU1_BRUME       KYLGVKMSVVDYSEH--SLQQGS----DASAISYVEMVYP------GGKLFGVGINDNIV
LEU1_RHILO       RHVGVEMSVLDYSEH--SMQRGS----NASAISYVEMEYP------GGKLFGAGINTNIV
LEU1_PSEPK       AGLPIAVEIMDYNEH--AIGAGT----NAKAAAYIELR----VAG-GRPVHGVGIDENIT
LEU1_PSEP1       AGLPIAVEIMDYNEH--AIGAGT----NAKAAAYIELR----VAG-GRPVHGVGIDENIT
LEU1_PSEPG       AGLPIAVEIMDYNEH--AIGAGT----NAKAAAYIELR----VAG-GRPVHGVGIDENIT
LEU1_PSEE4       AGLPVNVEIMDYNEH--AIGAGT----NAKAAAYIELR----VAG-GRPVHGVGIDENIT
LEU1_PSE14       AGLPVAVEIMDYNEH--AIGSGT----TAKAAAYIELR----VNG-ERAVHGVGIDENIT
LEU1_PSEU2       AGLPVAVEIMDYNEH--AIGSGT----TAKAAAYIELR----VNG-ERAVHGVGIDENIT
LEU1_PSESM       AGLPVAVEIMDYNEH--AIGSGT----TAKAAAYIELR----VNG-DRAVHGVGIDENIT
LEU1_PSEPF       AGLPIPVEIMDYNEH--AIGAGT----NAKAAAYIELR----VNG-ERAVHGVGIDENIT
LEU1_PSEF5       AGLPVPVEIMDYNEH--AIGAGT----NAKAAAYIELR----VNG-ERAVHGVGIDENIT
LEU1_PSEAE       AALPVKAEIMDYHEH--AIGAGA----NAKAAAYIEIR----LEG-QRPLHGIGIDENIT
LEU1_PSEA7       AALPVKAEIMDYHEH--AIGAGA----NARAAAYIEIR----LEG-QRPLHGIGIDENIT
LEU1_PSEU5       AALPVKLEIMDYHEH--AIGAGS----NAKAAAYIEVR----LDG-ERPLHGIGIDENIT
LEU1_PSEMY       AGLPVAVEIMDYSEH--AIGAGT----NAKAAAYIELR----VNG-GRALHGIGIDENLT
LEU12_RALSO      AVLAAPVSIHHYEER--ALGQGA----NADAIAFAELA----APGVAGSVFGVGIDANLT
LEU1_HERSS       AALGLALRIDSYEERSLGVGVGA----DAQALAIVEAA----LPTVPGSRFGVGRHENIT
LEU1_MARMS       KRFNWQINISDFHEH--TLGQQT----KSKAVSYVQIE----SDQ-ATPSFGVAIDEDST
LEU1_YEAST       NLLNVRFAVANYTEH--SLGSGS----STQAASYIHLSYRRNADNEKAYKWGVGVSEDVG
LEU1_ALCBS       RRIGGEVKVVSFDEY--SLGDNT----EANAMACVRVQ----VGD--STQSAVAMAVDTT
LEU12_HYDCU      RRTGQQVDVLDYSEH--ALHEGK----DSKAIAYVYVQ----QKN--TKTIGIAMAEDTV
LEU1_MYCLE       GHVGLQVAVLDYSEH--AMNAGD----DAQAAAYVEASVH------GHTAWGVGIAPSIT
LEU1_MYCUA       GTVGFDVAVLDYSEH--AMSAGD----DAQAAAYVEASVA------GKTVWGVGIAPSIT
LEU1_CORGL       EKLGIDVEIQEYNQH--ARTSGD----DAEAAAYVLAEVN------GRKVWGVGIAGSIT
LEU1_CORGB       EKLGIDVEIQEYNQH--ARTSGD----DAEAAAYVLAEVN------GRKVWGVGIAGSIT
LEU1_COREF       ESLNIDVEIQEYSQH--ARTSGD----DAEAAAYVLAEVN------GRMVWGVGIAGSIT
LEU1_STRCO       QGVGIDVRLLDYQEH--TMSEGA----SAQAASYIECAIG------DKVLWGIGIDANTT
LEU1_STRAW       QSVGIDVRLLDYTEH--TMSEGA----SAQAASYIECAID------GQVLWGIGIDANTT
LEU1_KINRD       GSRGVDVRVLDYAEH--ALSAGG----DAQAAAYVECAVA------GRVLWGVGIDHNIT
LEU1_ARTS2       GQDGVDVRVLDYSEH--ALSEGG----NARAAAYVECAVG------ERVLWGVGIDSNTT
LEU1_BIFLS       SNFGVEASIMDYVEH--TMSVGT----DAMAASYVECQIGE--ADDAQIVWGVGIDSSIT
LEU1_CATAD       AKAGIGFEVVDYTEN--AVYSEH-AVSEGADAVAVCYIRAR---VEGREVWGVGMDTSVL
LEU1_NOCFA       RRHGVELEVLAVHHT--TVTGELLALVEYRDGAGVRWSAGR--GRTAGEAVGNAVAAAVG
LEU1_STRRD       TRWG--FDVRAVHRT--GIAGQD----RGPDADVAVYAECR---VEGRVSWGVGIDRDIE
LEU1_HELHP       EHLNLDFEIIDYSEH--SLKKGS----TSQAVSYVQIE------SKGKKCFGVGIDNDII
LEU1_DESHY       ARLGLSYSNLIYKEH--ALELGS----KSQAVSYVGVTG-----PDGVIHWGCGIHTDIF
LEU12_BACP2      AYFHLEYDLEVYEQN--SLGKDS----QAKACAQIGIS------HQGKMHWGAGIDKDII
LEU1_CLOAB       NKKYNGCKFISYDEH--ALNIGS----HSKAVAYVQIE------SQDKKYFGVGISDNID
LEU1_ACESD       EIIGMDIDIVDYRGH--SMEYGT----KAKAISYIELKN-----ETGERFYGAGTSSSVG
LEU1_MAGMM       TFYSMTIQIHDYHQH--ARTAGR----DSEAVSFVQISV-----NGGKPTFGVGLHTDSS
                                                                    . .      

LEU1_RHIL3       AASLEAIVSAANRVLDVKAGKA-----------------
LEU1_RHIME       AASLEAIVSAANRVLDVVGK-------------------
LEU1_AGRFC       AASLEAIVSAANRVLEERAK-------------------
LEU1_BRUSU       SASLEAVVSAANRVIAK----------------------
LEU1_BRUME       SASLEAVVSAANRVIAK----------------------
LEU1_RHILO       AASLEAVTSAANRIVGRKAR-------------------
LEU1_PSEPK       TASFKALFSALNRSLSQQEAKAA----------------
LEU1_PSEP1       TASFKALFSALNRSLSQQEAKAA----------------
LEU1_PSEPG       TASFKALFSALNRSLSQQEAKAA----------------
LEU1_PSEE4       TASFKALFSALNRSLSQQQAKAA----------------
LEU1_PSE14       TASFRALFSALNRSLSQTQAKAA----------------
LEU1_PSEU2       TASFRALFSALNRSLSQTQAKAA----------------
LEU1_PSESM       TASFRALFSALNRSLSQAQAKAA----------------
LEU1_PSEPF       TASFKALFSALNRSLSQPEAKAA----------------
LEU1_PSEF5       TASFKALFSALNRSLSEQQAKAA----------------
LEU1_PSEAE       TASFRALFSALNRAVTQAEAKAA----------------
LEU1_PSEA7       TASFRALFSALNRAVTQAEAKAA----------------
LEU1_PSEU5       TASIRALFSAMNRALHQAQEAAA----------------
LEU1_PSEMY       TASFRALFSALNRALSQAESRAA----------------
LEU12_RALSO      TASIRAVVGGVNRLAARHAQAQPGQSLLRRGMAPSMELA
LEU1_HERSS       TASIMAVLSAASRFAGEEQGKG-----------------
LEU1_MARMS       KASLQALINACHPLYKEA---------------------
LEU1_YEAST       DSSVRAIFATINNIIHSGDVSIPSLAEVEGKNAAASGSA
LEU1_ALCBS       AAALQAILSAVGRMQETSEQLIANS--------------
LEU12_HYDCU      SAMIQALLSTIR---------------------------
LEU1_MYCLE       TASLRAVVSAVNRAMPR----------------------
LEU1_MYCUA       TASLRAVVSAINRASR-----------------------
LEU1_CORGL       YASLKAVTSAVNRALDVNHEAVLAGGV------------
LEU1_CORGB       YASLKAVTSAVNRALDVNHEAVLAGGV------------
LEU1_COREF       YASLKAVTSAVNRALDFKHQQLQNGGV------------
LEU1_STRCO       RASLKAVVSAVNRATR-----------------------
LEU1_STRAW       RASLKAVVSAVNRAAR-----------------------
LEU1_KINRD       TASLKAIVSAVNRALR-----------------------
LEU1_ARTS2       TSSLKAVISAVNRAIRDAQA-------------------
LEU1_BIFLS       TSALKAIISAINRSQRQR---------------------
LEU1_CATAD       TAMVRAAVSAVNR--------------------------
LEU1_NOCFA       PATAPARAVAEVRPG------------------------
LEU1_STRRD       AASLAAVRSAVIRARLKRLPARGGEATGIVAPLVAAGR-
LEU1_HELHP       TASIYGLVSALNRII------------------------
LEU1_DESHY       TSSVKALISAINTMIKDSAAV------------------
LEU12_BACP2      EATVKALVVAVNRLEVWM---------------------
LEU1_CLOAB       TASINAIVSALNRSKLK----------------------
LEU1_ACESD       KSSLRAVVSAINKMILAQQTKDMDTQEEDIA--------
LEU1_MAGMM       RSALEAVLCSINRALATSLT-------------------
                  :   .