CLUSTAL format seed alignment for MF_00573

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL35A_PYRFU           ---------------------MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLI
RL35A_PYRWO           ---------------------MSIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLI
RL35A_PYRHO           ---------------------MRIKGVVLSYRRSKENQHTNVMIIKPLDINSREEASKLI
RL35A_PYRAB           ---------------------MRIKGVVLSYRRSKENQHTNVMIIKPLNVNSREEASKLI
F8AFI4_PYRYC          -----------------------MKAVVLSYRRSKENQHNYHMIIKPLDINSREEAAKLI
F0LIL0_THEBM          -----------------------MKGIVLSYMRSKENQHNHHMIIKPLGIESREEAAKLI
C5A6N3_THEGJ          --------------------M-RRKALILAYAGSHEHRHNHHMILKPIGVEDRAGASALI
B6YUV0_THEON          --------------------MPRGKAIVLAYAGTHEHQDNHHMILKPLGVDGREQAARLI
Q5JIB4_THEKO          ----------------------MRKAVVLSYVGSHEHRDPNRVILKPLDVNDRGSAARLI
RL35A_METKA           -------------------MSEVKRGVIVNYRMGRHTQDPRQCIIEFEGVESRSEAAQLI
A0A1J4UUJ5_9ARCH      -----------------------MRARITDYRGGRHTQKPNQMVMEVDGVSTKEGAAELV
Q74MU4_NANEQ          -----------------------MRGIVISYRRGKHTQNNYQVIVQPENVFDKKEASKLV
A1RX00_THEPD          -----------------------MEGWIVSFRRGMNKYYPRQVILSL-DGVTYKDAVKVI
F0QUV2_VULM7          ----------------MSTQIRTIKARIYSIRRGSIGYSRDAIIIVP-GIETAIDAAKFI
D7DBV4_STAHD          -MIR-------------------VPGLIMSFRRGPRHQYNRQVLIKIL-DEN-IPRKSLV
E0SQM0_IGNAA          MIMQS--------------KSNIVIGRILGYKRGGGRQYNNKVLIKVF-IDS-KNIHKLI
RL35A_AERPE           -MAR-------------------ARGVVLGYRRGTNTQYPQHALVKLL-LDDPRKAGLYV
G0ED63_PYRF1          -MSGEATRLVRLPTPEEIFEKGMAVGVILGYRMGGNEQYENQVRIKIFGINDRRLASRLI
A2BL64_HYPBU          -MSGE--------------DKRVYTGIILGYRLGSNTQYEKQVLIRVDGVNDRASASRLI
D6GUZ9_9ZZZZ          ------------------------MAKIVSYKRGRKTQKMNQAIASIEKVSNREEAGKYI
RL35A_PONAB           -----------------MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL
RL35A_MACFA           -----------------MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL
RL35A_HUMAN           -----------------MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL
RL35A_MOUSE           -----------------MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL
RL35A_RAT             -----------------MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL
RL35A_BOVIN           -----------------MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL
RL35A_XENLA           -----------------MSGRLWCKATFAGYKRGLRNQREHTALLKIEGVYARDETEFYF
RL35A_ICTPU           -----------------MPGRLWCKAIFAGYKRGLRNQREHTALLKVEGVYSRNEVDFYL
RL35A_CAEEL           ----MADTAVARRPSAPTTGRLYVKAIFTGFKRGLRTQSEHTSLLKLEGVFNKEDAGFYA
R35A3_ARATH           ----------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYK
R35A1_ARATH           ----------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYK
R35A2_ARATH           -----------MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYK
R35A4_ARATH           -----------MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYK
RL33B_YEAST           ---------------MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQEAQFYL
RL33A_YEAST           ---------------MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYL
RL33B_SCHPO           --------------MPAQGHRLYVKAKHLSFQRSKHVIHPGTSIVKIEGCDSKEEAQFYL
RL33A_SCHPO           --------------MPAQGHRLYVKAKHLSFQRSKHVIHPGTSLVKIEGCDSKEEAQFYL
RL35A_TETTS           --------MAKTSTSPVAPTRLWVKAAFTGFRRSKHTQNSNQALLKLQNVNTKEDVAFYQ
RL35A_DICDI           ------------------MEKIYSKGVVLGYRRSQATQYPNISLIKIEGVVSREDSTFYL
                                               .                                  

RL35A_PYRFU           GRLVLWKSP--------------SGKILKGKIVRVHGTK--GAVRARFEKGLPGQALGDY
RL35A_PYRWO           GRLVLWKSP--------------SGKILKGKIVRVHGTK--GAVRARFEKGLPGQALGDY
RL35A_PYRHO           GRLVVWKSP--------------SGKVLKGKIVRVHGTR--GAVRARFEKGLPGQALGDY
RL35A_PYRAB           GRLVIWKSP--------------SGKLLKGKIVRVHGTK--GAVRARFEKGLPGQALGDY
F8AFI4_PYRYC          GRLVIWKSP--------------SGKILKGKITRVHGTK--GAVRVRFEKGLPGQALGDY
F0LIL0_THEBM          GKKVIWKSP--------------SGKIIAGKIVKPHGVR--GEVKVRFEKGLPGQALGDY
C5A6N3_THEGJ          GRKVVWRTP--------------TGRKMFGKILRVHGNR--GEVKAYFKPGLPGQALGDY
B6YUV0_THEON          GRKVVWRTP--------------TGKKMVGKILKPHGNR--GEVKAYFKPGLPGQALGDY
Q5JIB4_THEKO          GRKVVWRTP--------------TGRKLVGKIVRTHGTR--GEVKAVFKPGLPGQALGDY
RL35A_METKA           GKEVIWKHPE-------------TGKVIRGKVVDTHGNN--GAVRVRFERGLPGQALGTE
A0A1J4UUJ5_9ARCH      GKQVVWASP--------------AGKKIAGKVTGPHGNK--GRVHALFEKGLPGQAIGTQ
Q74MU4_NANEQ          GKKVIWKSP--------------TGKTFVGVITAPHGNK--GKVRVRFRKGVPGQMLGKL
A1RX00_THEPD          GRKVLWVHPE-------------TGEKFVGKIVRMHGRR--GHVLAYFKRHLPGQAVGTK
F0QUV2_VULM7          NAKVIW-KSR-------------TGIEAIGNVLRVWGKH--GQLLVRFRQGLPGQALGDT
D7DBV4_STAHD          GAKVEYVDK--------------YGNKYTGRITRGHGKGWNNVYRAIFYHGLPGQAINSR
E0SQM0_IGNAA          GSKVIAKDS--------------KDNTYNGKIVKIHSTK-NTVAIAHFKPNIPGQLIGST
RL35A_AERPE           SGIAFYRDR--------------YGNVYKGRVLRLHGRR-GGVVVVKFNPPLPGQATGGV
G0ED63_PYRF1          GWKVIYRDQ--------------YGNEYRGKVIGVHGNR--GVVLARFKPNLPGQAITGL
A2BL64_HYPBU          GWKVLYRDG--------------KGNEYRGKIVHVHGSK--GVVIAVFKPNLPGQARGGN
D6GUZ9_9ZZZZ          GKRVEIAFS---------------KTSIKGVVVKPHGNR--GKVVIRFRRGLPGQAMNRE
RL35A_PONAB           GKRCAYVYKAKNNTVTPGGK-PNKTRVIWGKVTRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_MACFA           GKRCAYVYKAKNNTVTPGGK-PNKTRVIWGKVTRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_HUMAN           GKRCAYVYKAKNNTVTPGGK-PNKTRVIWGKVTRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_MOUSE           GKRCAYVYKAKNNTVTPGGK-PNKTRVIWGKVTRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_RAT             GKRCAYVYKAKNNTVTPGGK-PNKTRVIWGKVTRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_BOVIN           GKRCAYVYKAKNNTVTPGGK-PNKTRVIWGKITRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_XENLA           GKRCAYVYKAKNNTVTPGGK-PNRTRVIWGKVTRAHGNS--GMVRAKFRSNLPAKAIGHR
RL35A_ICTPU           GKRCAYVYKAKKTTVTPGGK-PNKTRVIWGKVTRAHGNS--GMVRAKFTSNLPPKAIGHR
RL35A_CAEEL           GKRVVYLYKAHNKTLKTGHTVATRTRAIWGKITRPHGNA--GAVRAKFHHNIPPSALGKR
R35A3_ARATH           GKRMAYIYKAKTKKNG------SHYRCIWGKVTRPHGNS--GVVRAKFTSNLPPKSMGSR
R35A1_ARATH           GKRMAYIYKAKTKKNG------SHYRCIWGKVTRPHGNS--GVVRAKFTSNLPPKSMGSR
R35A2_ARATH           GKRLAYIYKAKTKKNG------SHYRCIWGKVTRPHGNS--GVVRSKFTSNLPPKSMGAR
R35A4_ARATH           GKRLAYIYKAKTKKNG------SHYRCIWGKVTRPHGNS--GVVRSKFTSNLPPKSMGAR
RL33B_YEAST           GKRIAYVYRASKEVRG------SKIRVMWGKVTRTHGNS--GVVRATFRNNLPAKTFGAS
RL33A_YEAST           GKRIAYVYRASKEVRG------SKIRVMWGKVTRTHGNS--GVVRATFRNNLPAKTFGAS
RL33B_SCHPO           GKRVCYVYKSSKAVRG------SKIRVIWGTIARPHGNS--GAVRARFVHNLPAKTFGSS
RL33A_SCHPO           GKRICFVYKSNKPVRG------SKIRVIWGTVSRPHGNS--GVVRARFTHNLPPKTFGAS
RL35A_TETTS           GKRVVYIYKGQKKNGS-------NYRTIWGRIGKAHGNN--GVAVARFAHNLPPQAIGSV
RL35A_DICDI           GKKVCLVSKVSKSAKN-----PTGHKISWGKICKTHGSS--GVVQARFARNLPPKAMGAP
                      .                            * :    .          *   :* .     

RL35A_PYRFU           VEIV-------------
RL35A_PYRWO           VEIV-------------
RL35A_PYRHO           VEII-------------
RL35A_PYRAB           VEII-------------
F8AFI4_PYRYC          VEIL-------------
F0LIL0_THEBM          VQIL-------------
C5A6N3_THEGJ          VEIL-------------
B6YUV0_THEON          VEIL-------------
Q5JIB4_THEKO          VEIL-------------
RL35A_METKA           VTLK-------------
A0A1J4UUJ5_9ARCH      AEIK-------------
Q74MU4_NANEQ          VTIQ-------------
A1RX00_THEPD          VKIV-------------
F0QUV2_VULM7          VDLILNR----------
D7DBV4_STAHD          AFVIKK-----------
E0SQM0_IGNAA          VSIFLLK----------
RL35A_AERPE           VEVVKAGGDG-------
G0ED63_PYRF1          VVLQRS-----------
A2BL64_HYPBU          VYIYPKGIELVFEEEKQ
D6GUZ9_9ZZZZ          IKLD-------------
RL35A_PONAB           IRVMLYPSRI-------
RL35A_MACFA           IRVMLYPSRI-------
RL35A_HUMAN           IRVMLYPSRI-------
RL35A_MOUSE           IRVMLYPSRI-------
RL35A_RAT             IRVMLYPSRI-------
RL35A_BOVIN           IRVMLYPSRI-------
RL35A_XENLA           IRVMLYPSRI-------
RL35A_ICTPU           IRVMLYPSRV-------
RL35A_CAEEL           IRVLLYPSNI-------
R35A3_ARATH           VRVFMYPSNI-------
R35A1_ARATH           VRVFMYPSNI-------
R35A2_ARATH           VRVFMYPSNI-------
R35A4_ARATH           VRVFMYPSNI-------
RL33B_YEAST           VRIFLYPSNI-------
RL33A_YEAST           VRIFLYPSNI-------
RL33B_SCHPO           LRVMLYPSNI-------
RL33A_SCHPO           LRVMLYPSNV-------
RL35A_TETTS           LRVMLYPNRA-------
RL35A_DICDI           VRVMLYPSNI-------
                        :