CLUSTAL format seed alignment for MF_00576

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GVPA_BACME       -MSIQKSTD----SSSLAEVIDRILDKGIVIDAFARVSLVGIEILTIEARVVIASVDTWL
GVPB_BACME       -MSIQKSTN----SSSLAEVIDRILDKGIVIDAFARVSVVGIEILTIEARVVIASVDTWL
GVPA_NOSS1       -MAVEKTNS----SSSLAEVIDRILDKGIVVDAWVRVSLVGIELLAIEARIVIASVETYL
GVPA_MICDP       -MAVEKTNS----SSSLAEVIDRILDKGIVVDAWVRVSLVGIELLAIEARIVIASVETYL
GVPA_DOLFA       -MAVEKTNS----SSSLAEVIDRILDKGIVIDAWVRVSLVGIELLAIEARIVIASVETYL
GVPA_PLARU       -MAVEKVNS----SSSLAEVIDRILDKGIVIDAWVRVSLVGIELLSIEARIVIASVETYL
GVPA_PSEGP       -MAVEKVNS----SSSLAEVIDRILDKGIVIDAWVRVSLVGIELLSIEARVVIASVETYL
GVPA_ANCAQ       -MAVEKINA----SSSLAEVVDRILDKGVVVDAWVRVSLVGIELLAVEARVVVAGVDTYL
GVPA_HALMT       ----MVQPD----SSSLAEVLDRVLDKGVVVDVWARISLVGIEILTVEARVVAASVDTFL
GVPA_HALVU       ----MAQPD----SSSLAEVLDRVLDKGVVVDVYARLSLVGIEILTVEARVVAASVDTFL
GVPA1_HALSA      ----MAQPD----SSGLAEVLDRVLDKGVVVDVWARVSLVGIEILTVEARVVAASVDTFL
GVPA2_HALSA      ----MAQPD----SSSLAEVLDRVLDKGVVVDVWARISLVGIEILTVEARVVAASVDTFL
GVPA1_STRCO      MTVVPAQQTGGGGSSGLYDVLELVLDRGLVIDAFVRVSLVGIEILKIDVRVVVASVDTYL
GVPA2_STRCO      MITYDDEVVCAPRAGTLYDVLELILDRGMVIDVFVRVSLVGIEILKVDARIVVASVDTYL
                              :. * :*:: :**:*:*:*.:.*:*:****:* ::.*:* *.*:*:*

GVPA_BACME       RYAEAVGLLTDKVEE-------------------EGLPGRTE--ERGAGLSF--------
GVPB_BACME       RYAEAVGLLRDDVEE-------------------NGLPERSNSSEGQPRFSI--------
GVPA_NOSS1       KYAEAVGLTQSAAMP-------------------A-------------------------
GVPA_MICDP       KYAEAVGLTQSAAVP-------------------A-------------------------
GVPA_DOLFA       KYAEAVGLTQSAAVP-------------------A-------------------------
GVPA_PLARU       KYAEAVGLTAQAAVP-------------------SV------------------------
GVPA_PSEGP       KYAEAVGLTASAAVP-------------------AA------------------------
GVPA_ANCAQ       KYAEAVGLTASAQAA---------------------------------------------
GVPA_HALMT       HYAEEIAKIEQAELT-------------------AGAEAA-PTPEA--------------
GVPA_HALVU       HYAEEIAKIEQAELT-------------------AGAEAA-PTPEA--------------
GVPA1_HALSA      HYAEEIAKIEQAELT-------------------AGAEAA-PEA----------------
GVPA2_HALSA      HYAEEIAKIEQAELT-------------------AGAEAPEPAPEA--------------
GVPA1_STRCO      RFAEACNRLDLEAGPRKDPGLPDLVGEMTE----SGARGKSKGALSGAAETISDAFKQAR
GVPA2_STRCO      RFAEACNRLDLEHDVRSKTVPEMFGSPMAKTVGRAGARRTARSLTDKVRDVLTPEHEHEE
                 ::**                                                        

GVPA_BACME       --------------------------------------------------
GVPB_BACME       --------------------------------------------------
GVPA_NOSS1       --------------------------------------------------
GVPA_MICDP       --------------------------------------------------
GVPA_DOLFA       --------------------------------------------------
GVPA_PLARU       --------------------------------------------------
GVPA_PSEGP       --------------------------------------------------
GVPA_ANCAQ       --------------------------------------------------
GVPA_HALMT       --------------------------------------------------
GVPA_HALVU       --------------------------------------------------
GVPA1_HALSA      --------------------------------------------------
GVPA2_HALSA      --------------------------------------------------
GVPA1_STRCO      D---------DGGSERETSSRPRARKAAPSRRKEEQE-------------
GVPA2_STRCO      EPEEAEDRPRAGAERGRSTQRPRSRPAARPRDEDDRPRSRPRRRTEEEDR