CLUSTAL format seed alignment for MF_00577

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HUTU_THEAC            ------------------------------------------------------------
HUTU_THEVO            ------------------------------------------------------------
G8TVL5_SULAD          ------------------------------------------------------------
HUTU_CALS4            ------------------------------------------------------------
HUTU_THEP3            ------------------------------------------------------------
HUTU_THEAB            ------------------------------------------------------------
HUTU_THEM4            ------------------------------------------------------------
HUTU_FERNB            ------------------------------------------------------------
HUTU_RUBXD            ------------------------------------------------------------
HUTU_HERA2            ------------------------------------------------------------
HUTU_SACEN            ------------------------------------------------------------
HUTU_BEUC1            ------------------------------------------------------------
HUTU_MYCS2            ------------------------------------------------------------
HUTU_STRAW            ------------------------------------------------------------
HUTU_STRGG            ------------------------------------------------------------
HUTU_STRCO            ------------------------------------------------------------
HUTU_NOCSJ            ------------------------------------------------------------
HUTU_SYMTH            ------------------------------------------------------------
HUTU_BACVZ            ------------------------------------------------------------
HUTU_BACSU            ------------------------------------------------------------
HUTU_BACHD            ------------------------------------------------------------
HUTU_STAAC            ------------------------------------------------------------
HUTU_STAAN            ------------------------------------------------------------
HUTU_STAAS            ------------------------------------------------------------
HUTU_STAAW            ------------------------------------------------------------
HUTU_STAAM            ------------------------------------------------------------
HUTU_STAAR            ------------------------------------------------------------
HUTU_STAS1            ------------------------------------------------------------
HUTU_BACCZ            ------------------------------------------------------------
HUTU_BACC3            ------------------------------------------------------------
HUTU_BACC0            ------------------------------------------------------------
HUTU_BACAA            ------------------------------------------------------------
HUTU_BACCR            ------------------------------------------------------------
HUTU_BACC4            ------------------------------------------------------------
HUTU_BACHK            ------------------------------------------------------------
HUTU_BACC1            ------------------------------------------------------------
HUTU_BACC2            ------------------------------------------------------------
HUTU_BACMK            ------------------------------------------------------------
HUTU_BACCN            ------------------------------------------------------------
HUTU_NATTJ            ------------------------------------------------------------
HUTU_GEOKA            ------------------------------------------------------------
HUTU_GEOSW            ------------------------------------------------------------
HUTU_BACSK            ------------------------------------------------------------
HUTU_RHIME            ------------------------------------------------------------
HUTU_RHILO            ------------------------------------------------------------
HUTU_AGRFC            ------------------------------------------------------------
HUTU_AGRVS            ------------------------------------------------------------
HUTU_CHESB            ------------------------------------------------------------
HUTU_AGRRK            ------------------------------------------------------------
HUTU_BRUO2            ------------------------------------------------------------
HUTU_BRUMB            ------------------------------------------------------------
HUTU_BRUAB            ------------------------------------------------------------
HUTU_BRUC2            ------------------------------------------------------------
HUTU_BRUSU            ------------------------------------------------------------
HUTU_BRUSI            ------------------------------------------------------------
HUTU_BRUME            ------------------------------------------------------------
HUTU_OCHA4            ------------------------------------------------------------
HUTU_BRASO            ------------------------------------------------------------
HUTU_BRASB            ------------------------------------------------------------
HUTU_BRADU            ------------------------------------------------------------
HUTU_ACICJ            ------------------------------------------------------------
HUTU_CAUVN            ------------------------------------------------------------
HUTU_CAUVC            ------------------------------------------------------------
HUTU_CAUSK            ------------------------------------------------------------
HUTU_PHEZH            ------------------------------------------------------------
HUTU_SPHWW            ------------------------------------------------------------
HUTU_SPHAL            ------------------------------------------------------------
HUTU_STRM5            ------------------------------------------------------------
HUTU_STRMK            ------------------------------------------------------------
HUTU_XANAC            ------------------------------------------------------------
HUTU_XANC5            ------------------------------------------------------------
HUTU_XANCP            ------------------------------------------------------------
HUTU_HYPNA            ------------------------------------------------------------
HUTU_RHORT            ------------------------------------------------------------
HUTU_METNO            ------------------------------------------------------------
HUTU_MARMM            ------------------------------------------------------------
HUTU_PHOPR            ------------------------------------------------------------
HUTU_ALISL            ------------------------------------------------------------
HUTU_VIBC3            ------------------------------------------------------------
HUTU_VIBCH            ------------------------------------------------------------
HUTU_VIBCM            ------------------------------------------------------------
HUTU_VIBCB            ------------------------------------------------------------
HUTU_VIBPA            ------------------------------------------------------------
HUTU_VIBVY            ------------------------------------------------------------
HUTU_VIBVU            ------------------------------------------------------------
HUTU_VIBTL            ------------------------------------------------------------
HUTU_SHEPA            ------------------------------------------------------------
HUTU_SHEWM            ------------------------------------------------------------
HUTU_SHEPW            ------------------------------------------------------------
HUTU_SHEHH            ------------------------------------------------------------
HUTU_SHESH            ------------------------------------------------------------
HUTU_SHEFN            ------------------------------------------------------------
HUTU_SHEB9            ------------------------------------------------------------
HUTU_SHEPC            ------------------------------------------------------------
HUTU_SHEB5            ------------------------------------------------------------
HUTU_SHEB2            ------------------------------------------------------------
HUTU_SHESW            ------------------------------------------------------------
HUTU_SHEB8            ------------------------------------------------------------
HUTU_SHESR            ------------------------------------------------------------
HUTU_SHESM            ------------------------------------------------------------
HUTU_SHESA            ------------------------------------------------------------
HUTU_SHEON            ------------------------------------------------------------
HUTU_CHRVO            ------------------------------------------------------------
HUTU_HAHCH            ------------------------------------------------------------
HUTU_PSEHT            ------------------------------------------------------------
HUTU_IDILO            ------------------------------------------------------------
HUTU_PSEAB            ------------------------------------------------------------
HUTU_PSEAE            ------------------------------------------------------------
HUTU_PSEA7            ------------------------------------------------------------
HUTU_PSEP1            ------------------------------------------------------------
HUTU_PSEPK            ------------------------------------------------------------
HUTU_PSEPU            ------------------------------------------------------------
HUTU_PSEE4            ------------------------------------------------------------
HUTU_PSEPW            ------------------------------------------------------------
HUTU_PSEFS            ------------------------------------------------------------
HUTU_ACIB3            ------------------------------------------------------------
HUTU_ACIBS            ------------------------------------------------------------
HUTU_ACIBC            ------------------------------------------------------------
HUTU_PSESM            ------------------------------------------------------------
HUTU_PSE14            ------------------------------------------------------------
HUTU_PSEU2            ------------------------------------------------------------
HUTU_YERPE            ------------------------------------------------------------
HUTU_YERE8            ------------------------------------------------------------
HUTU_PHOLL            ------------------------------------------------------------
HUTU_SALCH            ------------------------------------------------------------
HUTU_SALNS            ------------------------------------------------------------
HUTU_SALPC            ------------------------------------------------------------
HUTU_SALG2            ------------------------------------------------------------
HUTU_SALDC            ------------------------------------------------------------
HUTU_SALEP            ------------------------------------------------------------
HUTU_SALA4            ------------------------------------------------------------
HUTU_SALSV            ------------------------------------------------------------
HUTU_SALTI            ------------------------------------------------------------
HUTU_SALAR            ------------------------------------------------------------
HUTU_CITK8            ------------------------------------------------------------
HUTU_KLEP3            ------------------------------------------------------------
HUTU_ENT38            ------------------------------------------------------------
HUTU_AZOVD            ------------------------------------------------------------
HUTU_RALSO            ------------------------------------------------------------
HUTU_BDEBA            ------------------------------------------------------------
HUTU_DEIRA            ------------------------------------------------------------
HUTU_HALSA            ------------------------------------------------------------
Q1MME7_RHIL3          ------------------------------------------------------------
A8EDJ6_BURPE          ------------------------------------------------------------
F9EJZ9_FUSNU          ------------------------------------------------------------
Q8RDU9_FUSNN          ------------------------------------------------------------
D0LH96_HALO1          MSTSHRTPSAPGDAASAVSTPDPSLAEGIPATLPEPPP---DDPAVTHAPARRQVLSEHE
F6GCU0_LACS5          ----------------MNSTFKTQILEGIPEQLPAFKP---YEKDINHAPKRKAILTKEE
HUTU_MOUSE            ------------------MSSLQELCSGLPLRPLPENR--GRWAGVPHAPVRTPNLSPEE
HUTU_HUMAN            ------------------MSSLQALCSGLPLRPLPENR--GRQAGVPHAPVRTPSLSPVE
HUTU_DICDI            -----------------MKDLLSSLSKGIPFEPLPEHP--GLDSTVPHAPGRPINLTLNE
HUTU_CAEEL            ------------------MNIPSLFVD--PFSPLLEHPTEQRAKNVAHAPKRPCNLTQTE
A0A0E1EVP6_STRPY      ------------MSFYSETDIAAAMTVKLDDV---LPEKTVFKEGIRRAPDRGFRLTQSQ
A6TVD8_ALKMQ          --------------MISNLDIGNAMTIKLDDV---LPDLPKFTEGIRRAPNRGFKLTLEQ
C0QEW2_DESAH          --------------MLKNTDVSNAMTIKIEDIFTELPEMPDFQPGIRRAPKRAMTLNKGE
                                                                                  

HUTU_THEAC            --------------MES------------KVREIHAPRG------------KTLNTKGWG
HUTU_THEVO            --------------MEE------------KAGEIHAPRG------------NKLNTKGWG
G8TVL5_SULAD          --------------MTDFF----------RHDDIHAPTG------------PTLHCKGWG
HUTU_CALS4            -----------------------------MSRVVRAPRG------------TELHCKNWQ
HUTU_THEP3            -----------------------------MSRVIRAPRG------------TTLHCKNWQ
HUTU_THEAB            -----------------------------MERIIRAPRG------------TTLSCKSWQ
HUTU_THEM4            -----------------------------MSRTVKAPRG------------TQLSCKNWQ
HUTU_FERNB            -----------------------------MPEVIRAPRG------------TQLTCKSWQ
HUTU_RUBXD            --------------MTDGKTT-----------TVRAPRG------------TELSCKGWH
HUTU_HERA2            --------------MTSSRI-------------VRAPRG------------SELSCKGWA
HUTU_SACEN            --------------MSSAR-------------PVRAARG------------TTLTARSWS
HUTU_BEUC1            --------------MDGAR-------------EVRSPRG------------STLTARSWQ
HUTU_MYCS2            --------------MEGAR-------------PVRAPRG------------TTLTARSWA
HUTU_STRAW            --------------MSGPR-------------PVRAPRG------------TELSALGWQ
HUTU_STRGG            --------------MSGPR-------------PVRAPRG------------SALTALGWQ
HUTU_STRCO            --------------MSGPR-------------PVRAPRG------------TEPSALGWQ
HUTU_NOCSJ            --------------MTTPANPR---------LPIHAAHG------------TELTARSWQ
HUTU_SYMTH            --------------MEMTR-------------TVRAPRG------------TQLSCKGWQ
HUTU_BACVZ            --------------MTDVKK------------SIRAGRG------------TELECLGWE
HUTU_BACSU            --------------MTDVKK------------SIRANRG------------TELECLGWE
HUTU_BACHD            -------------MVKETKR------------MIQAKKG------------IELECKGWE
HUTU_STAAC            ------------------MR------------KIQAKKG------------LSIECKGWE
HUTU_STAAN            ------------------MR------------KIQAKKG------------LSIECKGWE
HUTU_STAAS            ------------------MR------------KIQAKKG------------LSIECKGWE
HUTU_STAAW            ------------------MR------------KIQAKKG------------LSIECKGWE
HUTU_STAAM            ------------------MR------------KIQAKKG------------LSIECKGWE
HUTU_STAAR            ------------------MR------------KIQAKKG------------LSIECKGWE
HUTU_STAS1            ------------------MR------------KIEAKRG------------LDIECKGWE
HUTU_BACCZ            --------------MEKVQQ------------TIRAPRG------------TELQTKGWV
HUTU_BACC3            --------------MEKVQQ------------TIRAPRG------------TELQTKGWV
HUTU_BACC0            --------------MEKVKQ------------TIRAPRG------------TELQTKGWV
HUTU_BACAA            --------------MEKVKQ------------TIRAPRG------------TELQTKGWV
HUTU_BACCR            --------------MEKVQQ------------TIRAPRG------------TELQTKGWV
HUTU_BACC4            --------------MEKVQQ------------TIRAPRG------------TELQTKGWV
HUTU_BACHK            --------------MEKVKQ------------TIRAPRG------------TELQTKGWV
HUTU_BACC1            --------------MEKVKQ------------TIRAPRG------------TELQTKGWV
HUTU_BACC2            --------------MEKVQQ------------TIRAPRG------------TELQTKGWV
HUTU_BACMK            --------------MEKVQQ------------TIRAARG------------TELQTKGWV
HUTU_BACCN            --------------MENVKQ------------TIRAPRG------------TELQTKGWI
HUTU_NATTJ            -----------------MSR------------KVRAPRG------------TDLHCKGWQ
HUTU_GEOKA            ---------------MAEKR------------TVSPPAG------------TERRAKGWI
HUTU_GEOSW            --------------MVTKHR------------PVQAYTG------------STLHAKGWI
HUTU_BACSK            --------------MNLNNE------------PIRAKRG------------TALTAKGWV
HUTU_RHIME            --------------MNNPR---------HNIREVRSPRG------------TEISAKSWL
HUTU_RHILO            -------------MMNNPR---------HNIREVRAPRG------------DKLNARYWT
HUTU_AGRFC            --------------MNNPR---------HNIRDVRAPQG------------TELNAKSWM
HUTU_AGRVS            --------------MTNPR---------HNIRDVRAATG------------TELSAKSWM
HUTU_CHESB            -------------MNMNPR---------HNIREIRAPRG------------PELSAKSWM
HUTU_AGRRK            --------------MTNPR---------HNIREIRSPRG------------PELNAKSWM
HUTU_BRUO2            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRUMB            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRUAB            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRUC2            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRUSU            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRUSI            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRUME            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_OCHA4            --------------MSNPR---------HNEREVRSPRG------------DELNAKSWL
HUTU_BRASO            --------------MNRRL---------DNQRVIRAPHG------------SDISAKSWL
HUTU_BRASB            --------------MNRRL---------DNERVIRAPHG------------SDISAKSWL
HUTU_BRADU            --------------MNRRL---------DNDRTIRAPRG------------RDISAKSWL
HUTU_ACICJ            --------------MNRRL---------DNARTIRAPHG------------SDLSARSWL
HUTU_CAUVN            ---------------MTRR---------DTTRVIRPATG------------PERTCKSWL
HUTU_CAUVC            ---------------MTRR---------DTTRVIRPATG------------PERTCKSWL
HUTU_CAUSK            ---------------MTRL---------DNTRVIRPATG------------TELTAKSWL
HUTU_PHEZH            ---------------MTRH---------DPNRVIRPPVG------------PELTCRSWL
HUTU_SPHWW            ---------------MTRL---------DNSRVIRPATG------------TELSAKSWL
HUTU_SPHAL            ---------------MTRL---------DNSRVIRPATG------------PEISAKSWL
HUTU_STRM5            ---------------MTRN---------DPSRTIAAPTG------------TTLNAKSWQ
HUTU_STRMK            ---------------MTRN---------DPSRTIAAPTG------------TTLNAKSWL
HUTU_XANAC            ---------------MTRH---------DATRVIRAATG------------TTLTAKSWL
HUTU_XANC5            ---------------MTRH---------DATRVIRAATG------------TTLTAKSWL
HUTU_XANCP            ---------------MTRH---------DSTRVIRAATG------------TTLTAKSWL
HUTU_HYPNA            ---------------MPYP---------ANVREIRAPRG------------TTLNTQSWL
HUTU_RHORT            --------------MSDRL---------DNQRVVRAPRG------------PEITCKSWL
HUTU_METNO            ---------------MTRL---------DNARIVRAPRG------------PALTAKSWL
HUTU_MARMM            -------------MTQTRR---------DNSRIIRAKHG------------SELDATHWA
HUTU_PHOPR            --------MTQSTIPNPRL---------DESRTIIAPTG------------TQLNAKSWL
HUTU_ALISL            --------MTHTSSSNPRL---------DESRTIIAPTG------------TALTAKSWL
HUTU_VIBC3            --------MTQSSAQGTRL---------DTQRTIRAPRG------------TQLRAKSWL
HUTU_VIBCH            --------MTQSSAQGTRL---------DTQRTIRAPRG------------TQLRAKSWL
HUTU_VIBCM            --------MTQSSAQGTRL---------DTQRTIRAPRG------------TQLRAKSWL
HUTU_VIBCB            --------MTQRQGQDPRL---------DTSRTIRAPHG------------TQLRAKSWL
HUTU_VIBPA            --------MTQRQGQDPRL---------DTSRTIRAPHG------------NKLRAKSWL
HUTU_VIBVY            --------MTQSQGQDPRL---------DTSRTIRAPHG------------TTLRAKSWL
HUTU_VIBVU            --------MTQSQGQDPRL---------DTSRTIRAPHG------------TTLRAKSWL
HUTU_VIBTL            --------MTEHHNSDPRL---------DTTREIRAPHG------------TTLRAKSWL
HUTU_SHEPA            --------------MDKRH---------DPSRRIIAPTG------------TELSCKSWL
HUTU_SHEWM            --------------MDKRH---------NPSRRIIAPHG------------SKLSCKSWT
HUTU_SHEPW            --------------MDKRH---------DPSRRIIAPTG------------TKLSCKSWL
HUTU_SHEHH            --------------MDKRH---------DPSRRIIAPTG------------TKLSCKSWL
HUTU_SHESH            --------------MDKRH---------DPSRRIIAPHG------------TKLSCKSWF
HUTU_SHEFN            --------------MDKRH---------DPSRRIIAPHG------------TQLQCKSWL
HUTU_SHEB9            --------------MDKRH---------DPSRRIIAPHG------------TQLSCKSWL
HUTU_SHEPC            --------------MDKRH---------DPSRRIIAPHG------------TQLSCKSWL
HUTU_SHEB5            --------------MDKRH---------DPSRRIIAPHG------------TQLSCKSWL
HUTU_SHEB2            --------------MDKRH---------DPSRRIIAPHG------------TRLSCKSWL
HUTU_SHESW            --------------MDKRH---------DPSRRIIAPHG------------TQLSCKSWL
HUTU_SHEB8            --------------MDKRH---------DPSRRIIAPHG------------TQLSCKSWL
HUTU_SHESR            --------------MDKRH---------DPSRRIIAPHG------------SQLSCKSWL
HUTU_SHESM            --------------MDKRH---------DPSRRIIAPHG------------SQLSCKSWL
HUTU_SHESA            --------------MDKRH---------DSSRRIIAPHG------------SQLSCKSWL
HUTU_SHEON            --------------MDKRH---------DPSRRIIAPHG------------SQLSCKSWL
HUTU_CHRVO            -------------MTDPRF---------DPSRHIRAPRG------------NQLTCKSWL
HUTU_HAHCH            -------------MKDPRH---------DDQREIRAPRG------------SELNAKSWL
HUTU_PSEHT            --------------MNNRL---------DNNRTIRAPHG------------DKISAKSWQ
HUTU_IDILO            -------------MSFTRL---------DKSRKISAPHG------------TELTTCNWQ
HUTU_PSEAB            --------------MTTPS--------KFRDIEIRAPRG------------TTLTAKSWL
HUTU_PSEAE            --------------MTTPS--------KFRDIEIRAPRG------------TTLTAKSWL
HUTU_PSEA7            --------------MTTPS--------KFRDIEIRAPRG------------NTLTAKSWL
HUTU_PSEP1            --------------MTDNN--------KYRDVEIRAPRG------------NKLTAKSWL
HUTU_PSEPK            --------------MTDNN--------KYRDVEIRAPRG------------NKLTAKSWL
HUTU_PSEPU            --------------MTDNN--------KYRDVEIRAPRG------------NKLTAKSWL
HUTU_PSEE4            --------------MTDNN--------KYRDVEIRAPRG------------NKLTAKSWL
HUTU_PSEPW            --------------MTDNN--------KYRDVEIRAPRG------------NKLTAKSWL
HUTU_PSEFS            --------------MTKPT--------KYRDVEIRAAHG------------NKLTAKSWL
HUTU_ACIB3            -------------MTTMTT--------KFRDVEIRAPRG------------TELTAKSWL
HUTU_ACIBS            -------------MTTTTT--------KFRDVEIRAPRG------------TELMAKSWL
HUTU_ACIBC            -------------MTTTTT--------KFRDVEIRAPRG------------TELTAKSWL
HUTU_PSESM            --------------MTENNQDLKQNWTRHREGVVRAARG------------TQLTAKTWM
HUTU_PSE14            --------------MTENNQDLKQNWTRHREGVVQAACG------------TQLTAKSWL
HUTU_PSEU2            --------------MTENNQHLKQDWTRHREGVVRAARG------------TQLTAKSWL
HUTU_YERPE            --------------MTTQN--------RFRDNEIRAPQG------------TQLTAKSWL
HUTU_YERE8            --------------MTAQN--------RFRDTEIRASRG------------TKLTAKSWM
HUTU_PHOLL            --------------MTAQN-------SKFRSVGIRAPRG------------TQLTAKSWL
HUTU_SALCH            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALNS            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALPC            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALG2            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALDC            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALEP            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALA4            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALSV            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALTI            --------------MPESK---------YRQQTIRAPRG------------TVLTAKSWL
HUTU_SALAR            --------------MPESK---------YRQQTIRAPRG------------ATLTAKSWL
HUTU_CITK8            --------------MPQSK---------YRQQDIRAPRG------------TTLTAKSWL
HUTU_KLEP3            --------------MSQSK---------YRQLDVRAPRG------------TTLTARSWL
HUTU_ENT38            --------------MSSGK---------YRQQEIRAPRG------------TTLTAKSWL
HUTU_AZOVD            --------------MREAF-------HKYRDIEIRAPRG------------TALNARSWL
HUTU_RALSO            ------------MNTMTDAAHLAADPRYDAAREIRAPRG------------TELHCKSWL
HUTU_BDEBA            --------------MGGNM-----------SRVVKAPTG------------NKMVCKGWL
HUTU_DEIRA            --------------MTTHE-----------PRTVRAPRG------------PHKTAKGWI
HUTU_HALSA            -------------MDTPSAAAETSEPSAQWQAYRGAPTG------------TDIECEGWR
Q1MME7_RHIL3          --------------MPKANP---------RHPKFPIPGG------------PELRAKGWR
A8EDJ6_BURPE          -----------------------------MNRTFEVTSG------------DTLRCKGWR
F9EJZ9_FUSNU          --------------MNGEKGLYFRE-NPEILYEVKAQGGGLK-------DKETLRCKGWR
Q8RDU9_FUSNN          --------------MNGEKGLYFRE-NPEILYEVKAQGGGLK-------DKETLRCKGWR
D0LH96_HALO1          RALALRNALRYVPAAWHQTLAPEFAAELARDGRIYMRRLRPQ-HAMKARPLAAYPAKSRQ
F6GCU0_LACS5          EILALRNALRYFDKKHHKTLIKEFKNELDNYGRIYMYRLRPD-YKMYARPIEEYPAKSKQ
HUTU_MOUSE            EQLALRNALRYFPPDVQKLLALEFAQELRQFGHIYMYRFCPS-IEMRAYPIDQYPCRTRA
HUTU_HUMAN            KQLALRNALRYFPPDVQELLAPEFAQELQLYGHIYMYRFCPD-IEMRAYPIEQYPCQTKV
HUTU_DICDI            KKLAIKNSLRYFPNSLHSILANEFLEELNKYGHIYMYRFRPTHYEMKAYPIEEYPAKSRQ
HUTU_CAEEL            KMLAVRNALRYIPKEHHVLLATEFAEELNTYGHIYGYRFMPN-FDLFAPPVSEIGAHCEQ
A0A0E1EVP6_STRPY      TEIALKNALRYVPTKFHEEVIPEFLEELKTRGRIYGYRWRPK-DRIYGKPIDEYKGNCTA
A6TVD8_ALKMQ          TEVALKNALRYVPEKYHETVAPEFLEELMTRGRIYGYRFRPE-GRMKAKTIDEYKGNCVE
C0QEW2_DESAH          VMLAVKNALRYIPEAWHKICAPEFLDELLTHGRIYGYRFRPR-GRLYGKPIDEYTGKCIE
                                                                                  

HUTU_THEAC            QEAALRLLMNNLDPMVAKDPANLIVYGGKGKAARNWEAFDKIVQELKRLENDETLLIQSG
HUTU_THEVO            QEAALRLLMNNLDPMVAKDPANLIVYGGKGKAARNWEAFDKIVEELKKLENDETLLIQSG
G8TVL5_SULAD          QEAALRTLMNNLDPAVGEDPAHLIVYGGRGRAARSWDAYDKIVQSLLTLENDETLLIQSG
HUTU_CALS4            IEAPYRMIMNNLDPEVAEDPANLIVYGGAGKAARNWEAFDKILESLENLEEDETLLVQSG
HUTU_THEP3            IEAPYRTLMNNLDPEVAEDPANLIVYGGAGKAARNWEAFDKIIESLENLEEDETLLIQSG
HUTU_THEAB            TEAPMRMLMNNLDPEVARDPANLIVYGGTGRAARNWQCFDKIVETLKTLEMDETLLVQSG
HUTU_THEM4            TEAPMRMLMNNLDPEVARDPANLIVYGGTGRAARNWECFDKIVETLKNLEMDETLLVQSG
HUTU_FERNB            TEAAMRMLMNNLDPEVARDPANLIVYGGKGKAARNWDCFYKIVETLKKLENDETLLIQSG
HUTU_RUBXD            QEGALRMLMNNLDPEVAERPEELVVYGGTGKAARSWECFWAIVEALRGLDGDETLLVQSG
HUTU_HERA2            QEAALRMLMNNLDPDVAEDPQNLIVYGGTGKAARNWQCFDAIVRSLQELNDDETLLVQSG
HUTU_SACEN            TEAPLRMLQNNLDPEVAERPDDLVVYGGTGKAARNWASFDAIVRELTTLSDDETLLVQSG
HUTU_BEUC1            TEAPLRMLMNNLDPDVAERPDDLVVYGGTGRAARDWASYDGIVRTLTTLGDDETLLVQSG
HUTU_MYCS2            TEAPLRMLMNNLDPENAERPDDLVVYGGTGRAARNWASFDAMVRTLTTLREDETMLVQSG
HUTU_STRAW            QEAALRMLQNNLDPEVAEHPDKLVVYGGTGKAARDWRSFDAMVRTLRTLKQDETMLVQSG
HUTU_STRGG            QEAALRMLQNNLDPEVAEHPDKLVVYGGTGKAARDWRSFDAMVRTLQTLKQDETMLVQSG
HUTU_STRCO            QEAALRMLQNNLDPEVAEHPDKLVVYGGTGKAARDWRSFDAMVRTLRTLKQDETMLVQSG
HUTU_NOCSJ            TEAPLRMLMNNLDPENAERPEDLVVYGGTGRAARSWEAYDALVRTLTTLGDDETMLVQSG
HUTU_SYMTH            QEAALRMLMNNLDPEVAERPEELVVYGGSGKAARSWEAFDAIVKALRSLEDDETLLVQSG
HUTU_BACVZ            QEAVLRMLRNNLDPEVAEKPEDLIVYGGIGKAARNWDAFHAIERSLKMLKDDETLLIQSG
HUTU_BACSU            QEAVLRMLRNNLDPEVAEKPEDLIVYGGIGKAARDWDAFHAIEHSLKTLKNDETLLVQSG
HUTU_BACHD            QEAVLRMLYNNLDPEVAEKPDELIVYGGIGKAARNWAAFEAIVEQLRTLEKDETLLIQSG
HUTU_STAAC            QEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAIEKTLRELESDETMLVQSG
HUTU_STAAN            QEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAIEKTLRELESDETMLVQSG
HUTU_STAAS            QEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAIEKTLRELESDETMLVQSG
HUTU_STAAW            QEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAIEKTLRELESDETMLVQSG
HUTU_STAAM            QEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAIEKTLRELESDETMLVQSG
HUTU_STAAR            QEAVLRMLYNNLDTEVAERPEDLVVYGGIGKAARNWEAFEAIEKTLRELESDETMLVQSG
HUTU_STAS1            QEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAIEDTLRSLEADETMLVQSG
HUTU_BACCZ            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_BACC3            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_BACC0            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_BACAA            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_BACCR            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_BACC4            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_BACHK            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYNAIVDSLKTLESDETLLVQSG
HUTU_BACC1            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYNAIVDSLKTLESDETLLVQSG
HUTU_BACC2            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYNAIVDSLKTLESDETLLVQSG
HUTU_BACMK            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYHAIVDSLKTLENDETLLVQSG
HUTU_BACCN            QEAALRMLMNNLDPEVAEKPEELVVYGGIGRAARNWESYQAIVDSLKTLESDETLLVQSG
HUTU_NATTJ            QEGPMRMLMNNLDPEVAEKPEELIVYGGSGKAARNWEAFDAIVKSLQELEDDETLLVQSG
HUTU_GEOKA            QEAALRMLNNNLHPDVAERPDELIVYGGIGKAARNWECYEAIVDTLLRLENDETLLIQSG
HUTU_GEOSW            QEAALRMLNNNLHPEVAERPEDLVVYGGIGKAARNWECYGAIVETLLNLENDETLLIQSG
HUTU_BACSK            QEAALRMLMNNLDEEVAEHPDQLVVYGGIGKAARNWPSYHSIVSSLTTLDNDETLLIQSG
HUTU_RHIME            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARTWADFDRIVASLKDLNEDETLLVQSG
HUTU_RHILO            TEAPLRMLMNNLDPDVAENPNELVVYGGIGRAARTWNDFDRIVASLKTLGEDETLLVQSG
HUTU_AGRFC            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKDLNEDETLIVQSG
HUTU_AGRVS            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWEDFDRIVATLKTLTEEETLIVQSG
HUTU_CHESB            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARTWEDFDRITAALKTLSEEETLLVQSG
HUTU_AGRRK            TEAPLRMLMNNLDPDVAENPNELVVYGGIGRAARTWEDFDRIAATLKTLTEEETLLVQSG
HUTU_BRUO2            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDDETLLVQSG
HUTU_BRUMB            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDDETLLVQSG
HUTU_BRUAB            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDNETLLVQSG
HUTU_BRUC2            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDDETLLVQSG
HUTU_BRUSU            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDDETLLVQSG
HUTU_BRUSI            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDDETLLVQSG
HUTU_BRUME            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDRIVATLKTLNDDETLLVQSG
HUTU_OCHA4            TEAPLRMLMNNLDPDVAERPHELVVYGGIGRAARTWDDFDKIVATLKTLNEDETLLVQSG
HUTU_BRASO            TEAPLRMLMNNLDPDVAEKPSELIVYGGIGRAARDWDSFDRIVASLRKLEADQTLVVQSG
HUTU_BRASB            TEAPLRMLMNNLDPDVAEKPSELIVYGGIGRAARDWDSFDRIVASLRKLEADQTLVVQSG
HUTU_BRADU            TEAPLRMLMNNLDPDVAERPSELVVYGGIGRAARDWESFDRITAALRKLEDDETLLIQSG
HUTU_ACICJ            TEAPLRMLMNNLDPDVAERPEELVVYGGIGRAARDWESFDRILGALRDLGPEETLLVQSG
HUTU_CAUVN            TEAALRMLMNNLHPDVAERPEELVVYGGIGRAARDWESYDKIVETLRRLEDDETLLVQSG
HUTU_CAUVC            TEAALRMLMNNLHPDVAERPEELVVYGGIGRAARDWESYDKIVETLRRLEDDETLLVQSG
HUTU_CAUSK            TEAPLRMLMNNLHPDVAERPEELVVYGGIGRAARDWESYDKIVETLRRLEDDETLLVQSG
HUTU_PHEZH            TEAPLRMLMNNLHPDVAENPAELVVYGGVGRAARDWESYDRIVETLRRLGDDETLLVQSG
HUTU_SPHWW            TEAPLRMLMNNLHPDVAERPEELVVYGGIGRAARDWESYDRIVETLKRLEADQTLLVQSG
HUTU_SPHAL            TEAPMRMLMNNLHPDVAEAPHELVVYGGIGRAARDWESYDRIVETLRRLEGDETLLIQSG
HUTU_STRM5            TEAPLRMLMNNLHPDVAERPQELVVYGGIGRAARDWESFDAIVETLKRLDDDQTLLVQSG
HUTU_STRMK            TEAPLRMLMNNLHPDVAERPQELVVYGGIGRAARDWESFDAIVETLKRLDDDQTLLVQSG
HUTU_XANAC            TEAPLRMLMNNLDPDVAERPQELVVYGGIGRAARDWESFDAIVAALTRLDEDHTLLVQSG
HUTU_XANC5            TEAPLRMLMNNLDPDVAEHPQELVVYGGIGRAARDWESFDAIVAALTRLDEDQTLLVQSG
HUTU_XANCP            TEAPLRMLMNNLDPDVAERPQELVVYGGIGRAARDWESFDAIVAALTRLDDDQTLLVQSG
HUTU_HYPNA            TEAPLRMLMNNLDPDVAERPEDLVVYGGIGRAARNWEAFDAIVAALKRLKEDETLLIQSG
HUTU_RHORT            SEAPLRMLMNNLDPEVAEKPEELVVYGGIGRAARNWQCYDQIVAALKRLEDDETLLVQSG
HUTU_METNO            TEAPLRMLMNNLDPDVAERPGDLVVYGGIGRAARDWASFDRIVAALKDLDEDQTLLVQSG
HUTU_MARMM            AEAPLRMLMNNLDPDVAEKPEELVVYGGIGRAARDWESYDRIVATLKRLKEDETLLVQSG
HUTU_PHOPR            TEAPLRMLMNNLHPDVAEHPHALVVYGGIGRAARNWECYDKIVEVLKRLEDDETLIVQSG
HUTU_ALISL            TEAPLRMLMNNLHPDVAEHPHALVVYGGIGRAARNWQCYDKIVEVLTRLEDDETLLVQSG
HUTU_VIBC3            TEAPLRMLMNNLDPDVAEHPHALVVYGGIGRAARNWECFDKIVEVLERLEDDQTLLVQSG
HUTU_VIBCH            TEAPLRMLMNNLDPDVAEHPHALVVYGGIGRAARNWECFDKIVEVLERLEDDQTLLVQSG
HUTU_VIBCM            TEAPLRMLMNNLDPDVAEHPHALVVYGGIGRAARNWECFDKIVEVLERLEDDQTLLVQSG
HUTU_VIBCB            TEAPLRMLMNNLDPDVAEHPHSLVVYGGIGRAARNWECFDKIVEVLERLDDDQTLLVQSG
HUTU_VIBPA            TEAPLRMLMNNLDPDVAEHPHSLVVYGGIGRAARNWECYDKIVEVLERLEDDQTLLVQSG
HUTU_VIBVY            TEAPLRMLMNNLDPDVAEHPHALVVYGGIGRAARNWACFDKIVEVLERLEDDQTLLVQSG
HUTU_VIBVU            TEAPLRMLMNNLDPDVAEHPHALVVYGGIGRAARNWACFDKIVEVLERLEDDQTLLVQSG
HUTU_VIBTL            TEAPLRMLMNNLDPDVAEHPHALVVYGGIGRAARDWKCYDKIVEVLERLEDDQTLLVQSG
HUTU_SHEPA            TEAPLRMLMNNLHPDVAERPEDLVVYGGIGRAARDWECYDKIVEVLQRLEEDETLLVQSG
HUTU_SHEWM            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWECYDKIIEVLQRLEEDETLLVQSG
HUTU_SHEPW            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWECYDKIVEVLQRLEDDETLLVQSG
HUTU_SHEHH            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWECYDKIVEVLQRLEDDETLMVQSG
HUTU_SHESH            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWECYDKIIEVLQRLEEDETLLVQSG
HUTU_SHEFN            TEAAMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWQSYDKIIEVLKRLEDDQTLLVQSG
HUTU_SHEB9            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSG
HUTU_SHEPC            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSG
HUTU_SHEB5            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSG
HUTU_SHEB2            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSG
HUTU_SHESW            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSG
HUTU_SHEB8            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSG
HUTU_SHESR            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLKRLEDDETLMVQSG
HUTU_SHESM            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLKRLEDDETLMVQSG
HUTU_SHESA            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLKRLEDDETLMVQSG
HUTU_SHEON            TEAPMRMLMNNLHPDVAERPEDLVVYGGIGRAARDWDCYDKIIEVLKRLEDDETLLVQSG
HUTU_CHRVO            TEAAYRMIQNNLDAEVAEHPQSLVVYGGIGRAARNWECYDKILETLRRLEDDETLLVQSG
HUTU_HAHCH            TEAPLRMLMNNLDPEVAEHPKSLVVYGGIGRAARDWECFDKIVEVLKRLEDDETLLVQSG
HUTU_PSEHT            TEAAKRMLMNNLDPDVAEHPHALVVYGGIGRAARDWPSYDKIIATLDRLEDDETLLVQSG
HUTU_IDILO            VEAAKRMLMNNLDDEVAEHPQALVVYGGIGRAARSWECYDKIIETLERLKPDESLLIQSG
HUTU_PSEAB            TEAPLRMLMNNLDPEVAENPRELVVYGGIGRAARNWECYDRIVETLKQLNDDETLLVQSG
HUTU_PSEAE            TEAPLRMLMNNLDPEVAENPRELVVYGGIGRAARNWECYDRIVETLKQLNDDETLLVQSG
HUTU_PSEA7            TEAPLRMLMNNLDPEVAENPKELVVYGGIGRAARNWECYDRIVETLRQLNDDETLLVQSG
HUTU_PSEP1            TEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWACYDKIVETLTRLEDDETLLVQSG
HUTU_PSEPK            TEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWACYDKIVETLTRLEDDETLLVQSG
HUTU_PSEPU            TEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWECYDKIVETLTRLEDDETLLVQSG
HUTU_PSEE4            TEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWECYDKIVETLTRLEDDETLLVQSG
HUTU_PSEPW            TEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWACYDKIVETLTRLEDDETLLVQSG
HUTU_PSEFS            TEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWECYDQIVESLTHLNDDETLLVQSG
HUTU_ACIB3            TEAPLRMLMNNLDPDVAENPKELVVYGGIGRAARNWECFDKIVDTLKNLETDETLLVQSG
HUTU_ACIBS            TEAPLRMLMNNLDPDVAENPKELVVYGGIGRAARNWECFDKIVDTLKNLETDETLLVQSG
HUTU_ACIBC            TEAPLRMLMNNLDPDVAENPKELVVYGGIGRAARNWECFDKIVDTLKNLETDETLLVQSG
HUTU_PSESM            TEAPLRMLMNNLDPEVAENPNELVVYGGIGRAARNWECYDKIVESLTRLNDDETLLVQSG
HUTU_PSE14            TEAPLRMLMNNLDPEVAENPNELVVYGGIGRAARNWECYDKIVESLTQLNDDETLLVQSG
HUTU_PSEU2            TEAPLRMLMNNLDPEVAENPNELVVYGGIGRAARNWECYDKIVESLTQLNDDETLLVQSG
HUTU_YERPE            TEAALRMLMNNLDPDVAENPKELVVYGGIGRAARNWECYDKIVESLINLNDDETLLIQSG
HUTU_YERE8            TEAPLRMLMNNLDPEVAENPKELVVYGGIGRAARNWECYDKIVESLTHLNDDETLLIQSG
HUTU_PHOLL            TEAPLRMLMNNLDPEVAENSYELVVYGGIGRAARNWECYDKIIETLKELEDDETLLIQSG
HUTU_SALCH            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALNS            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALPC            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALG2            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALDC            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALEP            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALA4            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALSV            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALTI            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_SALAR            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVDALTRLEADETLLIQSG
HUTU_CITK8            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARDWECYDAIINALTKLEADETLLVQSG
HUTU_KLEP3            TEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARNWECYDAIVKALKNLESDETLLVQSG
HUTU_ENT38            TEAPLRMLMNNLDPEVAENPNELVVYGGIGRAARNWECYDAIVDSLTHLESDETLLVQSG
HUTU_AZOVD            CEAPLRLLMNNLDPEVAENPKELVVYGGIGRAARNWECFDRIVECLKNLEEDETLLIQSG
HUTU_RALSO            TEAAYRMLQNNLDPDVAENPKHLVVYGGIGRAARDWACFDKILETLRELNDDESLLVQSG
HUTU_BDEBA            QEAAYRMIQNNLDPVIAEHPENLVVYGGIGKAARNWESFDKILEALKELENDETLLVQSG
HUTU_DEIRA            QEAAKRMLMNNLDPEVAEHPESLVVYGGRGKAARNWEAFDHIVATLDRLENDETLLVQSG
HUTU_HALSA            QEAALRMLNNNLDPEVAEDPENLVVYGGTGQAARSWDAYDAILDELRTLADAETLLVQSG
Q1MME7_RHIL3          QEALLRLLENVL--SVGEDPDNLIVYAALGKAARNWAAHRGIVKALTEMEEDQTLLIQSG
A8EDJ6_BURPE          QEALLRLLENVL--AVGENPDELIVYAALGRAARDWPSHDAIVRTLRTMDENQTLVVQSG
F9EJZ9_FUSNU          QETILRMLEFNM--ENAEIPELLVIYGGNGKCARNWESYWAIVDSLKNLEDDETLVVQSG
Q8RDU9_FUSNN          QETILRMLEFNM--ENAEIPELLVIYGGNGKCARNWESYWAIVDSLKNLEDDETLVVQSG
D0LH96_HALO1          AAAIMLMIQNNLDPAVAQYPHELITYGGNGTVFQNWAQYRLTMKYLSEMSDEQTLVLYSG
F6GCU0_LACS5          AAAIMLMIQNNLDYAVAQHPHELITYGGNGGVFSNWAQYRLTMKYLAEMNDEQTLVMYSG
HUTU_MOUSE            AAAIMHMIMNNLDPAVAQFPQELVTYGGNGQVFSNWAQFRLTMSYLSKMTEEQTLVMYSG
HUTU_HUMAN            AAAIMHMIMNNLDPAVAQFPQELVTYGGNGQVFSNWAQFWLTMFYLSKMTEEQTLVMYSG
HUTU_DICDI            AASIMLMIMNNLDREVAQFPNELVTYGGNGSVFQNWAQYHLTMKYLSEMTDQQTLTMYSG
HUTU_CAEEL            ASAIILMILNNLDKRVAQFPQELVTYGGNGQVFSNWIQFRLVLRYLYTMTDHQTLVLYSG
A0A0E1EVP6_STRPY      AKAMQVMIDNNLSFEIALYPYELVTYGETGSVCANWMQYQFIKKYLEVMTDEQTLVVESG
A6TVD8_ALKMQ          GKAFQVMIDNNLDFDVALYPYELVTYGETGSVFQNWMQYQLIKKYLEVMTQEQTLVIESG
C0QEW2_DESAH          GRAFQVMIENNLDFEIALYPYELVTYGETGQVCQNWMQYQMIKKYLENVTQDQTLVVESG
                             :   :    .  .  *: *.  *     *  .      *  :   .:: : **

HUTU_THEAC            KPVGVFKTTKDAPRVLIVNAQIVPHWATDDVFWDLEARGLTMFGQMTAGSWIYIGTQGVL
HUTU_THEVO            KPVGVFKTTKDSPRVLIVNAQIVPHWATDDVFWDLEARGLTMFGQMTAGSWIYIGTQGVL
G8TVL5_SULAD          KPVAVFRTQPAAPRVLIANSHLVPKWATLEEFNRLEALGLTMYGQMTAGSWIYIGSQGII
HUTU_CALS4            KPVGIFKTHEMAPRVLISNAMLVPKWANWETFWDLEAKGLTMYGQMTAGSWIYIGSQGIV
HUTU_THEP3            KPVGIFKTHTMAPRVLISNAMLVPAWANWENFWDLEAKGLTMYGQMTAGSWIYIGTQGII
HUTU_THEAB            KPVAVFKTSEWAPRVLIANSNLVPKWANWEYFRELEERGLIMYGQMTAGSWIYIGTQGIL
HUTU_THEM4            KPVAVFKTNEWAPRVLIANSNLVPKWANWEYFRELEARGLIMYGQMTAGSWIYIGTQGIL
HUTU_FERNB            KPVAVWKTHEWAPRVLIANSNLVPKWATWEYFNELEVRGLIMYGQMTAGSWIYIGTQGIL
HUTU_RUBXD            KPVAVFRTHPWAPRVLIANSLLVPEWADWETFRELERAGLTMFGQMTAGSWIYIGTQGIL
HUTU_HERA2            KPVAVFRSHRDAPRVLIANSMLVPHWATWENFRELEQAGLTMYGQMTAGSWIYIGTQGIL
HUTU_SACEN            KPVGVLRTHEWAPRVLLANSNLVGDWANWPEFRRLDALGLMMYGQMTAGSWIYIGTQGIL
HUTU_BEUC1            RPVGVLRTHEWAPRVLIANSNLVPDWATWPEFRRLEHLGLTMYGQMTAGSWIYIGTQGIL
HUTU_MYCS2            KPVGVFQTHEWAPRVLIANSNLVGDWATWPEFRRLEAMGLTMYGQMTAGSWIYIGTQGIV
HUTU_STRAW            RPVGVMQTHEWAPRVLIANSNLVGDWANWEEFRRLEALGLTMYGQMTAGSWIYIGTQGIL
HUTU_STRGG            RPVGVMQTHEWAPRVLIANSNLVGDWANWEEFRRLEALGLTMYGQMTAGSWIYIGTQGIL
HUTU_STRCO            RPVGVMQTHEWAPRVLIANSNLVGDWANWEEFRRLEALGLTMYGQMTAGSWIYIGTQGIL
HUTU_NOCSJ            KPVGVMRTHEWAPRVLIANSNLVGDWANWEEFRRLEDLGLTMYGQMTAGSWIYIGTQGIL
HUTU_SYMTH            KPVAIFRTHRMAPRVLIANSNLVARWATWEHFWELERKGLMMFGQMTAGSWIYIGTQGIL
HUTU_BACVZ            KPVGLFRTHSRAPRVLLANSVLVPKWADWEHFHDLEKKGLMMYGQMTAGSWIYIGSQGIL
HUTU_BACSU            KPVGMFRTHPQAPRVLLANSVLVPKWADWEHFHELEKKGLMMYGQMTAGSWIYIGSQGIL
HUTU_BACHD            KPVGRFKTHEQAPRVLLSNSVLVPKWAHWEHFNELEKQGLMMYGQMTAGSWIYIGSQGIL
HUTU_STAAC            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_STAAN            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_STAAS            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_STAAW            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_STAAM            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_STAAR            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_STAS1            KPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_BACCZ            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACC3            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACC0            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACAA            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACCR            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACC4            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACHK            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACC1            KPVAIFKSHEDAPRVLLANSNLVPKWANWNHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACC2            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACMK            KPVAIFKSHEDAPRVLLANSNLVPKWANWDHFRELEKKGLMMYGQMTAGSWIYIGTQGIL
HUTU_BACCN            KPVAIFKSHEDAPRVLLANSNLVPKWANWEHFRELEQKGLMMYGQMTAGSWIYIGTQGIL
HUTU_NATTJ            KPVGVFKTHSQAPRVLIANSLLVPSWADWDQFRELEKQGLTMYGQMTAGSWIYIGTQGIL
HUTU_GEOKA            KPVAVFRTHPDAPRVLIANSNLVPAWATWDHFHELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_GEOSW            KPVAVFKTHTDAPRVLIANSNLVPAWATWDHFHELDKKGLIMYGQMTAGSWIYIGSQGIV
HUTU_BACSK            KPVAVFKTHEDAPRVLLANSNLVPAWANWETFHELDKKGLTMYGQMTAGSWIYIGSQGIV
HUTU_RHIME            KPVGVFRTHKDAPRVLIANSNLVPHWATWDHFNELDKKGLAMYGQMTAGSWIYIGTQGIV
HUTU_RHILO            KPVGVFRTHADAPRVLIANSNLVPHWATWEKFNELDKKGLMMYGQMTAGSWIYIGTQGIV
HUTU_AGRFC            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGTQGIV
HUTU_AGRVS            KPVGVFKTHKDAPRVLIANSNLVPHWATWDHFNELDKKGLAMYGQMTAGSWIYIGTQGIV
HUTU_CHESB            KPVGVFRTHKDAPRVLIANSNLVPHWATWDHFNELDKKGLAMYGQMTAGSWIYIGTQGIV
HUTU_AGRRK            KPVGVFRTHKDAPRVLIANSNLVPHWATWDHFNELDKKGLAMYGQMTAGSWIYIGTQGIV
HUTU_BRUO2            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_BRUMB            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_BRUAB            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_BRUC2            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKDLAMYGQMTAGSWIYIGAQGIV
HUTU_BRUSU            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKDLAMYGQMTAGSWIYIGAQGIV
HUTU_BRUSI            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKDLAMYGQMTAGSWIYIGAQGIV
HUTU_BRUME            KPVGVFRTHKDAPRVLIANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_OCHA4            KPVGVFRTHKDAPRVLIANSNLVPHWATWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_BRASO            KPVGIFRTHPDAPRVLIANSNIVPHWATLDHFNALDKMGLMMYGQMTAGSWIYIGSQGIV
HUTU_BRASB            KPVGIFRTHPDAPRVLIANSNIVPHWATLDHFNALDRMGLMMYGQMTAGSWIYIGSQGIV
HUTU_BRADU            KPVGVFRTHADAPRVLIANSNIVPHWATLDHFNELDRKGLMMYGQMTAGSWIYIGSQGIV
HUTU_ACICJ            KPVGVFRTHADAPRVLIANSNLVPNWANWQHFHELDRKGLMMYGQMTAGSWIYIGSQGIV
HUTU_CAUVN            KPVGVFRTHADAPRVLIANSNLVPRWASWEHFNELDRKGLAMYGQMTAGSWIYIGAQGIV
HUTU_CAUVC            KPVGVFRTHADAPRVLIANSNLVPRWASWEHFNELDRKGLAMYGQMTAGSWIYIGAQGIV
HUTU_CAUSK            KPVGVFKTHPDAPRVLIANSNLVPRWATWEHFNELDRKGLAMYGQMTAGSWIYIGAQGIV
HUTU_PHEZH            KPVGVFRTHADAPRVLIANSNLVPKWATWEHFNELDRKGLAMYGQMTAGSWIYIGTQGIV
HUTU_SPHWW            KPVGVFRTHEDAPRVLIANSNLVPKWATWEHFNELDRKGLAMYGQMTAGSWIYIGTQGIV
HUTU_SPHAL            KPVGVFRTHADAPRVLLANSNLVPQWANWEHFHELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_STRM5            KPVGVFRTHADAPRVLIANSNLVPRWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_STRMK            KPVGVFRTHADAPRVLIANSNLVPRWANWDHFNELDRKGLAMYGQMTAGSWIYIGAQGIV
HUTU_XANAC            KPVGVFRTHADAPRVLIANSNLVPRWANWDHFNELDQKGLAMYGQMTAGSWIYIGAQGIV
HUTU_XANC5            KPVGVFRTHADAPRVLIANSNLVPRWANWDHFSELDQKGLAMYGQMTAGSWIYIGAQGIV
HUTU_XANCP            KPVGVFRTHADAPRVLIANSNLVPRWATWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIV
HUTU_HYPNA            KPVGVFRTHADAPRVLLANSNLVPRWANWDHFNELDRKGLMMYGQMTAGSWIYIGAQGIV
HUTU_RHORT            KAVGVFKTHRDAPRVLIANSNLVPHWATWETFHALDRAGLMMYGQMTAGSWIYIGSQGIV
HUTU_METNO            KPVGIFRTHPDAPRVLIANSNLVPHWATWAHFHELDRKGLMMYGQMTAGSWIYIGSQGIV
HUTU_MARMM            KPVGVFRTHKDAPRVLIANSNLVPNWANWDHFRELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_PHOPR            KPVGVFKTHTNAPRVLIANSNLVPHWANWEHFNELDKEGLMMYGQMTAGSWIYIGSQGIV
HUTU_ALISL            KPVGVFKTHTNAPRVLIANSNIVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBC3            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBCH            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBCM            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBCB            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKEGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBPA            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBVY            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBVU            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKQGLMMYGQMTAGSWIYIGSQGIV
HUTU_VIBTL            KPVGVFPTHKNAPRVLIANSNLVPHWANWEHFNELDKEGLMMYGQMTAGSWIYIGSQGIV
HUTU_SHEPA            KPVGVFKTHNNAPRVIIANSNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SHEWM            KPVGVFKTHNNAPRVIIANSNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SHEPW            KPVGVFKTHSNAPRVIIANSNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SHEHH            KPVGVFKTHSNAPRVIIANSNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SHESH            KPVGVFKTHSNAPRVIIANSNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SHEFN            KPVGVFTTHSNAPRVIIANSNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SHEB9            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHEPC            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHEB5            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHEB2            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHESW            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHEB8            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHESR            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKQGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHESM            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKQGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHESA            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKQGLAMYGQMTAGSWIYIGTQGIV
HUTU_SHEON            KPVGVFRTHADAPRVLIANSNLVPHWANWEHFNELDKQGLAMYGQMTAGSWIYIGTQGIV
HUTU_CHRVO            KPVGVFKTHENAPRVLIANSNLVPHWANWEHFNELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_HAHCH            KPVGVFKTHADAPRVLIANSNLVPHWANWEHFNELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_PSEHT            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_IDILO            KPVGVFPTHENAPRVLIANSNLVPEWANWEHFNELDKKGLMMYGQMTAGSWIYIGSQGIV
HUTU_PSEAB            KPVGVFKTHANAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEAE            KPVGVFKTHANAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEA7            KPVGVFKTHADAPRVLIANSNLVPHWATWEHFNELDARGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEP1            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEPK            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEPU            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEE4            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEPW            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEFS            KPVGVFKTHSNAPRVLIANSNLVPHWASWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_ACIB3            KPVGVFKTHKDAPRVLIANSNLVPHWANWEHFNELDAKALAMYGQMTAGSWIYIGSQGIV
HUTU_ACIBS            KPVGVFKTHKDAPRVLIANSNLVPHWANWEHFNELDAKALAMYGQMTAGSWIYIGSQGIV
HUTU_ACIBC            KPVGVFKTHKDAPRVLIANSNLVPHWANWEHFNELDAKALAMYGQMTAGSWIYIGSQGIV
HUTU_PSESM            KPVGVFKTHSNAPRVLIANSNLVPHWASWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSE14            KPVGVFKTHSNAPRVLIANSNLVPHWASWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PSEU2            KPVGVFKTHSNAPRVLIANSNLVPHWASWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_YERPE            KPVGIFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_YERE8            KPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDVKGLAMYGQMTAGSWIYIGSQGIV
HUTU_PHOLL            KPVGVFKTHSNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALCH            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALNS            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALPC            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALG2            KPVGVFKTHDNAPRVLIANSNLAPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALDC            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALEP            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALA4            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALSV            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALTI            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_SALAR            KPVGVFKTHDNAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_CITK8            KPVGVFKTHENAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_KLEP3            KPVGVFKTHENSPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_ENT38            KPVGVFKTHENAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
HUTU_AZOVD            KPVGVFRTQRDAPRVLIANSNLVPHWATWEHFHELDARGLAMFGQMTAGSWIYIGSQGIV
HUTU_RALSO            KPVGVFKTHPDAPRVLIANSNLVPKWANWEHFNALDRKGLFMYGQMTAGSWIYIGSQGIV
HUTU_BDEBA            KPIGILKTHEDAPRVLLANSNLVPKWATWEHFNELDKKGLMMYGQMTAGSWIYIGTQGII
HUTU_DEIRA            KPVAVLRTHEWAPRVLIANSNLVPHWANWETFDKLDQAGLMMYGQMTAGSWIYIGTQGIL
HUTU_HALSA            KPVGVFETHERAPSVLIANSNLVGNWADWEQFHELEAEGKIMYGQMTAGSWAYIGTQGII
Q1MME7_RHIL3          KPIGLVRTHAKAPLVIMANCNIVGQWAKAEVFYELQRKGLICWGGLTAGAWQYIGSQGVI
A8EDJ6_BURPE          KPVALLRTHASAPLVVMANCNLVGQWAKAEHFYELERRNLICWGGLTAGDWQYIGSQGVI
F9EJZ9_FUSNU          MPVAIFKTHKEAPVVVMATTNIMQ--ATWERFYDLQDKNLTIFAQYTAAPWEYIGTQGVI
Q8RDU9_FUSNN          MPVAIFKTHKEAPVVVMATTNIMQ--ATWERFYDLQDKNLTIFAQYTAAPWEYIGTQGVI
D0LH96_HALO1          HPLGLFPSHPEAPRLVVTCGMVIPDAGTPDEYERLAALGVSSYGQMTAGSFMYIGPQGIV
F6GCU0_LACS5          HPMGLFPSHNNAPRVVVTNGMMIPNYSQPDDWEKFNALGVTQYGQMTAGSYMYIGPQGIV
HUTU_MOUSE            HPLGLFPSSPRAPRLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIV
HUTU_HUMAN            HPLGLFPSSRSAPRLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIV
HUTU_DICDI            HPMGLFPSNESSPRVIVTNGMVIPNYSSHKDYERMYAQGVTQYGQMTAGSYCYIGPQGIV
HUTU_CAEEL            HPLGLFPSTPDSPRMTVTNGMMIPSYSTKELYDKYFALGVTQYGQMTAGSFCYIGPQGIV
A0A0E1EVP6_STRPY      HPVGLFKSKPEAPRVIITNGLLVGEYDNMKDWEIAEEMGVTNYGQMTAGGWMYIGPQGIV
A6TVD8_ALKMQ          HPLGLFKSKPDSPRVIITNALMIGMFDNTKDWDVAQQMGVANYGQMTAGGWMYIGPQGIV
C0QEW2_DESAH          HPLGLFQSSPASPRAIITNAMMVGLFDDQENWERAMSLGVANYGQMTAGGWMYIGPQGIV
                       .:.   :   :*   :    :         :          :.  **. : ***.**::

HUTU_THEAC            QGTYETLSALARKEFG----------------------------KDDLSGKWVLTSGLGE
HUTU_THEVO            QGTYETLSALARKEFK----------------------------KDDLSGKWVLTSGLGE
G8TVL5_SULAD          QGTFETLAALATKHF-----------------------------DGTLAGRVYVSAGLGG
HUTU_CALS4            EGTFETFAALAKKHFD-----------------------------GSLKGKFVLSAGLGG
HUTU_THEP3            EGTFETFAALAKKHFD-----------------------------GTLKGKFVLTAGLGG
HUTU_THEAB            QGTYETFYAVAKKYFG-----------------------------GTLKGKWVLTAGLGE
HUTU_THEM4            QGTYETFYAVAKKYFN-----------------------------GTLKGKWVLTAGLGE
HUTU_FERNB            QGTYETFYAVAKKYFG-----------------------------GTLKGKLVLTAGLGE
HUTU_RUBXD            QGTYETFAALAEQRFG-----------------------------GTLRGRVCLTAGLGG
HUTU_HERA2            QGTYETLAAIARQHFG-----------------------------GSLRGRWTLTAGLGG
HUTU_SACEN            QGTYETFAAVAERRFG-----------------------------GTLAGTLTITAGLGG
HUTU_BEUC1            QGTYETFAAVAEKVGRPDDDGV-----------------------ASLAGTLTLTAGCGG
HUTU_MYCS2            QGTYETFAAAAEKRFG-----------------------------GTLAGTLTLTGGCGG
HUTU_STRAW            QGTYETFAAVAAKKFN-----------------------------GTLAGTITLTAGLGG
HUTU_STRGG            QGTYETFAAVAAKKFG-----------------------------GTLAGTITLTAGLGG
HUTU_STRCO            QGTYETFAAVAAKKFG-----------------------------GTLAGTITLTAGLGG
HUTU_NOCSJ            QGTFETFAAVADKRFG-----------------------------GTLAGTITVTAGLGG
HUTU_SYMTH            QGTYETFAEAARQHFG-----------------------------GSLKGRLALTAGLGG
HUTU_BACVZ            QGTYETFAELARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACSU            QGTYETFAELARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACHD            QGTYETFAELARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_STAAC            QGTYETFAELGNQHFN-----------------------------GDLAGTVTLTAGLGG
HUTU_STAAN            QGTYETFAELGNQHFN-----------------------------GDLAGTVTLTAGLGG
HUTU_STAAS            QGTYETFAELGNQHFN-----------------------------GDLAGTVTLTAGLGG
HUTU_STAAW            QGTYETFAELGNQHFN-----------------------------GDLAGTVTLTAGLGG
HUTU_STAAM            QGTYETFAELGNQHFN-----------------------------GDLAGTVTLTAGLGG
HUTU_STAAR            QGTYETFAELGNQHFN-----------------------------GDLAGTVTLTAGLGG
HUTU_STAS1            QGTYETFGELANQHFN-----------------------------GKLNGTVTLTAGLGG
HUTU_BACCZ            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACC3            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACC0            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACAA            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACCR            QGTYETFGEAARQHFD-----------------------------GSLKGTLTLTAGLGG
HUTU_BACC4            QGTYETFGEAARQHFD-----------------------------GSLKGTLTLTAGLGG
HUTU_BACHK            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACC1            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_BACC2            QGTYETFGEAARQHFD-----------------------------GSLKGTLTLTAGLGG
HUTU_BACMK            QGTYETFGEAARQHFD-----------------------------GSLKGTVTITAGLGG
HUTU_BACCN            QGTYETFGEAARQHFG-----------------------------GSLKGTLTLTAGLGG
HUTU_NATTJ            QGTYETFGAAADKHYN-----------------------------GDLSGKFVLTAGLGG
HUTU_GEOKA            QGTYETFAEVARQHFG-----------------------------GTLAGTITLTAGLGG
HUTU_GEOSW            QGTYETFAEVARQHYG-----------------------------GTLKGTITVTAGLGG
HUTU_BACSK            QGTYETFAECARQHFG-----------------------------GSLKGTITVTAGLGG
HUTU_RHIME            QGTYETFVEAGRQHYG-----------------------------GSLKGKWILTGGLGG
HUTU_RHILO            QGTYETFVEAGRQHYG-----------------------------GNLKGKWILTGGLGG
HUTU_AGRFC            QGTYETFVEAGRQHYD-----------------------------GNLKGKWILTGGLGG
HUTU_AGRVS            QGTYETFVEAGRQHYN-----------------------------GNLKGKWILTGGLGG
HUTU_CHESB            QGTYETFVEAGRQHYD-----------------------------GNLKGKWILTGGLGG
HUTU_AGRRK            QGTYETFVEAGRQHYN-----------------------------GSLKGKWILTGGLGG
HUTU_BRUO2            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_BRUMB            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_BRUAB            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_BRUC2            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_BRUSU            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_BRUSI            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_BRUME            QGTYETFVEAGRQHYG-----------------------------GNLKGRWILTGGLGG
HUTU_OCHA4            QGTYETFVEAGRQHYD-----------------------------GNLKGKWILTGGLGG
HUTU_BRASO            QGTYETFVEVGRRHYN-----------------------------GDLSGKWILTAGLGG
HUTU_BRASB            QGTYETFVEVGRRHYH-----------------------------GDLAGKWILTAGLGG
HUTU_BRADU            QGTYETFVEVGRRHYG-----------------------------GSLAGKWILTAGLGG
HUTU_ACICJ            QGTYETFVEAGRQHYG-----------------------------GDLAGRWILTGGLGG
HUTU_CAUVN            QGTYETFVEMGRQHYG-----------------------------GDLSGRWLLTAGLGG
HUTU_CAUVC            QGTYETFVEMGRQHYG-----------------------------GDLSGRWLLTAGLGG
HUTU_CAUSK            QGTYETFVEMGRQHHG-----------------------------GDLAGKWLLTAGLGG
HUTU_PHEZH            QGTYETFVEMGRQHYG-----------------------------GDLSGRWLLTAGLGG
HUTU_SPHWW            QGTYETFVEMGRQHYD-----------------------------DDLSGRWLLTAGLGG
HUTU_SPHAL            QGTYETFVEMGRQHYG-----------------------------GDLSGRWLLTAGLGG
HUTU_STRM5            QGTYETFVEMGRQHFG-----------------------------GDLTGKWLFTGGLGG
HUTU_STRMK            QGTYETFVEMGRQHFG-----------------------------GDLTGKWLFTGGLGG
HUTU_XANAC            QGTYETFVEMGRQHYD-----------------------------GNLAGKWLFTGGLGG
HUTU_XANC5            QGTYETFVEMGRQHYA-----------------------------GNLAGKWLFTGGLGG
HUTU_XANCP            QGTYETFVEMGRQHYG-----------------------------GSLAGKWLFTGGLGG
HUTU_HYPNA            QGTYETFVEMGRQHHG-----------------------------GNLKGKWLLTAGLGG
HUTU_RHORT            QGTYETFVEAGRRHYG-----------------------------GSLAGRWILTGGLGG
HUTU_METNO            QGTYETFVEMGRQHYG-----------------------------GDLAGRWILTAGLGG
HUTU_MARMM            QGTYETFVEAGRQHYD-----------------------------GDLTGKWILTGGLGG
HUTU_PHOPR            QGTYETFVAMARQHFN-----------------------------GDAKGRWVLTGGLGG
HUTU_ALISL            QGTYETFVAMARQHFD-----------------------------GKAAGRWVLTGGLGG
HUTU_VIBC3            QGTYETFVAVAKKHFN-----------------------------GDAKGRWVLTGGLGG
HUTU_VIBCH            QGTYETFVAVAKKHFN-----------------------------GDAKGRWVLTGGLGG
HUTU_VIBCM            QGTYETFVAVAKKHFN-----------------------------GDAKGRWVLTGGLGG
HUTU_VIBCB            QGTYETFVSVAKKHFN-----------------------------GDAKGRWILTGGLGG
HUTU_VIBPA            QGTYETFVSVAKKHFN-----------------------------GDAKGRWVLTGGLGG
HUTU_VIBVY            QGTYETFVAVAKKHFA-----------------------------GEAKGRWVLTGGLGG
HUTU_VIBVU            QGTYETFVAVAKKHFA-----------------------------GEAKGRWVLTGGLGG
HUTU_VIBTL            QGTYETFVAIAKKHFQ-----------------------------GEANGKWVLTGGLGG
HUTU_SHEPA            QGTYETFVAMAKQHFN-----------------------------GSSAGKWILTGGLGG
HUTU_SHEWM            QGTYETFVAMAKQHFG-----------------------------GSSAGKWILTGGLGG
HUTU_SHEPW            QGTYETFVAMAKQHFG-----------------------------GSSKGKWILTGGLGG
HUTU_SHEHH            QGTYETFVAMAKQHFN-----------------------------GVSAGKWILTGGLGG
HUTU_SHESH            QGTYETFAAMATKHFG-----------------------------GSSKGKWILTGGLGG
HUTU_SHEFN            QGTYETFVAMAKQHFN-----------------------------GSSAGKWILTGGLGG
HUTU_SHEB9            QGTYETFVSVAKQHFD-----------------------------GISKGKWILTGGLGG
HUTU_SHEPC            QGTYETFVSVAKQHFE-----------------------------GISKGKWILTGGLGG
HUTU_SHEB5            QGTYETFVSVAKQHFE-----------------------------GISKGKWILTGGLGG
HUTU_SHEB2            QGTYETFVSVAKQHFE-----------------------------GISKGKWILTGGLGG
HUTU_SHESW            QGTYETFVSVAKQHFE-----------------------------GISKGKWILTGGLGG
HUTU_SHEB8            QGTYETFVSVAKQHFE-----------------------------GISKGKWILTGGLGG
HUTU_SHESR            QGTYETFVAVAKQHFG-----------------------------GVAAGKWILTGGLGG
HUTU_SHESM            QGTYETFVAVAKQHFG-----------------------------GVAAGKWILTGGLGG
HUTU_SHESA            QGTYETFVAVAKQHFG-----------------------------GVAAGKWILTGGLGG
HUTU_SHEON            QGTYETFVSVAKQHFG-----------------------------GISKGKWILTGGLGG
HUTU_CHRVO            QGTYETFFAVANQHFG-----------------------------GKPQGRWILTGGLGG
HUTU_HAHCH            QGTYETFVSVAKQHFN-----------------------------GEAHGRWILTGGLGG
HUTU_PSEHT            QGTYETFVAMAKQHFA-----------------------------GSAKGKWVLTGGLGG
HUTU_IDILO            QGTYETFGSVSRQHFN-----------------------------GDAKGKWVLTGGLGG
HUTU_PSEAB            QGTYETFVEAGRQHYD-----------------------------GNLKGRWVLTAGLGG
HUTU_PSEAE            QGTYETFVEAGRQHYD-----------------------------GNLKGRWVLTAGLGG
HUTU_PSEA7            QGTYETFVEAGRQHYD-----------------------------GNLAGRWVLTAGLGG
HUTU_PSEP1            QGTYETFVEAGRQHYG-----------------------------GSLKGKWVLTAGLGG
HUTU_PSEPK            QGTYETFVEAGRQHYG-----------------------------GSLKGKWVLTAGLGG
HUTU_PSEPU            QGTYETFVEAGRQHYG-----------------------------GTVKAKWVLTAGLGG
HUTU_PSEE4            QGTYETFVEAGRQHYN-----------------------------GSLKGKWVLTAGLGG
HUTU_PSEPW            QGTYETFVEAGRQHYG-----------------------------GSLKGKWVLTAGLGG
HUTU_PSEFS            QGTYETFVEAGRQHYD-----------------------------SNLKGRWVLTAGLGG
HUTU_ACIB3            QGTYETFVEAGRQHYN-----------------------------GDLKGRWVLTAGLGG
HUTU_ACIBS            QGTYETFVEAGRQHYN-----------------------------GDLKGRWVLTAGLGG
HUTU_ACIBC            QGTYETFVEAGRQHYN-----------------------------GDLKGRWVLTAGLGG
HUTU_PSESM            QGTYETFVEAGRQHYD-----------------------------GNLKGRWVLTAGLGG
HUTU_PSE14            QGTYETFVEAGRQHYD-----------------------------GNLKGRWVLTAGLGG
HUTU_PSEU2            QGTYETFVEAGRQHYD-----------------------------GNLKGRWVLTAGLGG
HUTU_YERPE            QGTYETFVEAGRQHFG-----------------------------GSLKGRWVLTAGLGG
HUTU_YERE8            QGTYETFVEAGRQHFG-----------------------------GSLKGRWVLTAGLGG
HUTU_PHOLL            QGTYETFVEAGRQHYN-----------------------------GNLQGRWVLTAGLGG
HUTU_SALCH            QGTYETFVEAGRQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALNS            QGTYETFVEAGRQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALPC            QGTYETFVEAGRQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALG2            QGTYETFVEAGCQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALDC            QGTYETFVEAGCQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALEP            QGTYETFVEAGCQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALA4            QGTYETFVEAGRQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALSV            QGTYETFVEAGRQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_SALTI            QGTYETFVEAGRQHYN-----------------------------GTLAGRWALTAGLGG
HUTU_SALAR            QGTYETFVEAGRQHYN-----------------------------GTLAGRWVLTAGLGG
HUTU_CITK8            QGTYETFVEAGRQHYQ-----------------------------GNLSGRWVLTAGLGG
HUTU_KLEP3            QGTYETFVEAGRQHYQ-----------------------------GSLKGRWVLTAGLGG
HUTU_ENT38            QGTYETFVEAGRQHYN-----------------------------GSLKGRWVLTAGLGG
HUTU_AZOVD            QGTFETFVEAGRQHYG-----------------------------GDLRGRWLLSAGLGG
HUTU_RALSO            QGTYETFAEAGRQHYSDRPSALLKQGLSPEGTAPGSGRSSAQVPGSHLAGRWILTAGLGG
HUTU_BDEBA            QGTYESFVEAGRQHFG-----------------------------GNLTGRVILTAGLGG
HUTU_DEIRA            QGTYETFAGAAQKHFG-----------------------------GSLKGTITVTAGLGG
HUTU_HALSA            QGTFETLAELARDHYPDN---------------------------DGLRGKIVATAGLGG
Q1MME7_RHIL3          QGTYEIFMRIAERRFG-----------------------------GDLLGRFVLTAGLGG
A8EDJ6_BURPE          QGTYEIFSRIAERHFG-----------------------------NDLRGRFILTAGLGG
F9EJZ9_FUSNU          EGTFETLSAIAMKKFN-----------------------------DDLSGKIYLTAGAGG
Q8RDU9_FUSNN          EGTFETLSAIAMKKFN-----------------------------DDLTGKIYLTAGAGG
D0LH96_HALO1          HGTTITLLNAGRKYLGLAGDL---------------------------AGKVYVTSGLGG
F6GCU0_LACS5          HGTTITVLNGFRK---IKKEP---------------------------KGNLFVTSGLGG
HUTU_MOUSE            HGTVLTVLNAGRRYLGIENL----------------------------AGKVFVTSGLGG
HUTU_HUMAN            HGTVLTVLNAARRYLGIEDL----------------------------AGKVFVTSGLGG
HUTU_DICDI            HGTTITLLNAGRKYLGVESL----------------------------IGKVFVSSGLGG
HUTU_CAEEL            HGTTITVLNAGRR-MGLDSL----------------------------AGKVFVTAGLGG
A0A0E1EVP6_STRPY      HGTFNTLLNAGRLKLGVADDGD-------------------------LTGKLFISSGLGG
A6TVD8_ALKMQ          HGTFNTLLNAGRLKLGLKDDED-------------------------LRGKLFVTSGLGG
C0QEW2_DESAH          HGTYGTLLNAARLELDVPEDGD-------------------------LTGRLFVTSGLGG
                      .**   .                                          .    :.* * 

HUTU_THEAC            MGGAQPLAITMNNASGIVVEVDEEKIKRRLRDKYLDTWTESLDEALKMKDES-LAEGKPT
HUTU_THEVO            MGGAQPLAITMNNATGIIVEVDEEKIRRRLRDKYLDTWTDSLDEALRLKDEA-LKSGKPT
G8TVL5_SULAD          MGGAQPLAGKMLDGVALIADVDPAKLERRHRSGYLDVIKSDIADAVAEAWAA-KAARRPL
HUTU_CALS4            MGGAQPLAITMLDGACLIVEVDRNRIKRRLETKYLDVMAEDLDEALGMVMKA-KEEGRAL
HUTU_THEP3            MSGAQPLAVTMLDGACLVVEVDRNRIQRRLDTKYLDVMTDNLDEALEMVLKA-KEEGKPL
HUTU_THEAB            MGGAQPLAVTLNDGVVLAVEIDKRMIERRLNTGYLDTWTDNLDEALEMVQKA-VKEERPL
HUTU_THEM4            MGGAQPLAVTLNDGIVLAVEIDKKMIDRRIKTGYLDVWTNNLDEALEMVQNA-VKEGKPL
HUTU_FERNB            MGGAQPLAVTMNDGVVIAVEVDKRMIDRRIQTGYLDTWTDNLDEALRLAKEA-LKEGRPL
HUTU_RUBXD            MGGAQPLAITMNEGVALCVEVDPRRIDRRLEHRYLDERIDDLDAAVERAEEA-RREGEPL
HUTU_HERA2            MGGAQPLAVTMNDGVALVVEVDRQRMQRRLDTRYLDVAVDTLEEAMTLVDEA-VRDGKAL
HUTU_SACEN            MGGAQPLAVTMNEGVALVVECDPERAHRRVKHGYLDEVADGLDQAIEKAEAA-KAQRRAY
HUTU_BEUC1            MGGAQPLAVTLNGGVCLVVDVDPERLRRRVATRYLDEVADGLDDAVARCEAA-KLERRAL
HUTU_MYCS2            MGGAQPLAVTLNGGACLIVDVDEARLRRRVEHRYLDEVADNLDDAVTKAVAT-RKDKRAW
HUTU_STRAW            MGGAQPLAVTMNDGVAICIDVDPRAIERRIEHRYLDVKADSLEHALQLAVEA-RDARRPL
HUTU_STRGG            MGGAQPLAVTMNDGVAICIDVDPRAIERRIEHRYLDVKADSPEHALQLAVEA-RDARRPL
HUTU_STRCO            MGGAQPLAVTMNDGVVICVDCDPRAIDRRIEHHYLDVKADSLDHALQLATEA-RDRRKPL
HUTU_NOCSJ            MGGAQPLAVTMNDGVVICVECDPERIRRRIDHRYLDVEAPSLEAAVALAVEA-RDERRPL
HUTU_SYMTH            MGGAQPLAVTMNEGVAIVVEVDEARIQRRLDHRYLDRMTRSLDEALAWARES-MAKGEPL
HUTU_BACVZ            MGGAQPLSVTMNDGVVIAVEADETRIDKRIETNYCDRKTASIDEALRWAEAA-RQAGEPL
HUTU_BACSU            MGGAQPLSVTMNEGVVIAVEVDEKRIDKRIETKYCDRKTASIEEALAWAEEA-KLAGKPL
HUTU_BACHD            MGGAQPLAVTMNGGVVIGVDVDRSRIEKRIATKYTDRITESLDQALAWASEA-KAKGEPL
HUTU_STAAC            MGGAQPLAITMNHGVAICVDVDETRVDKRIDTKYCDVKTADLDEALKLAEEA-KERGEGL
HUTU_STAAN            MGGAQPLAITMNHGVAICVDVDETRVDKRIDTKYCDVKTADLDEALKLAEEA-KERGEGL
HUTU_STAAS            MGGAQPLAITMNHGVAICVDVDETRVDKRIDTKYCDVKTADLDEALKLAEEA-KERGEGL
HUTU_STAAW            MGGAQPLAITMNHGVAICVDVDETRVDKRIDTKYCDVKTADLDEALKLAEEA-KERGEGL
HUTU_STAAM            MGGAQPLAITMNHGVAICVDVDETRVDKRIDTKYCDVKTADLDEALKLAEEA-KERGEGL
HUTU_STAAR            MGGAQPLAITMNHGVAICVDVDETRVDKRIATKYCDIKTANLDEALKLAEEA-KERGEGL
HUTU_STAS1            MGGAQPLAVTMNGGVVIGVDVDETRIDKRIETRYCDVKTHDLDEALRLADEA-REKGEPL
HUTU_BACCZ            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALAVANEY-KEKKEPI
HUTU_BACC3            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALAVANEY-KEKKEPI
HUTU_BACC0            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALAVANEY-KEKKEPI
HUTU_BACAA            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALAVANEY-KEKKEPI
HUTU_BACCR            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALTVANEY-KEKREPI
HUTU_BACC4            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALTVANEY-KEKKEPI
HUTU_BACHK            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALTVANEY-KEKKEPI
HUTU_BACC1            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDMYTESLEEALTVANEY-KEKKEPI
HUTU_BACC2            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDKYTESLEEALAIANEY-KEKKEPI
HUTU_BACMK            MGGAQPLAVTMNGGVVIAIDVDKRSIDRRIEKRYCDKYTESLEEALAIANEY-KEKKEPI
HUTU_BACCN            MGGAQPLAVTMNGGVVIAIDVDKRSIERRIEKRYCDMYTESLEEALAVATEY-KEKKEPI
HUTU_NATTJ            MGGAQPLAVTMNNGVVLCVEVDRERIERRIDYQYLDKMAENLDEALELVDEA-VSEKKPL
HUTU_GEOKA            MGGAQPLAVTMNGGVCLAIEVDPARIQRRIDTNYLDTMTDSLDAALEMAKQA-KEEKKAL
HUTU_GEOSW            MGGAQPLAVTLNGGVCIAVEVDPARIQRRIDTKYLDTMTDRLDVAIQMAKRA-KEEGKAL
HUTU_BACSK            MGGAQPLAVTMANGVAICVDVDRSRIDKRMETNYLDIVAHTLTEAIEEAELA-KKEGIPL
HUTU_RHIME            MGGAQPLAAVMAGACCLAVECNPDSIDFRLRTRYLDEKAETLEEAMEMIERW-TKAGEPK
HUTU_RHILO            MGGAQPLAAVMAGACCLAIECNPDSIDFRLRTRYVDEKAETLDEAMEMIERW-TKAGEAK
HUTU_AGRFC            MGGAQPLAAVMAGACCLAVECDETRVDFRLRTRYVDAKAHTLDEALALIDQW-TKAGEAK
HUTU_AGRVS            MGGAQPLAAVMAGACCLAVECDETRVDFRLRTRYVDAKAHTLDEALALIDQW-TKAGEAK
HUTU_CHESB            MGGAQPLAAVMAGACCLAVECDETRIDFRLRTRYVDAKARTLDEALAMIDMW-TKAGEAK
HUTU_AGRRK            MGGAQPLAAVMAGACCLAVESDETRIDFRLRTRYVDEKATSLDEALAMIDKW-TKAGEAK
HUTU_BRUO2            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_BRUMB            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_BRUAB            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_BRUC2            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_BRUSU            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_BRUSI            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_BRUME            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDAW-TKAGEAK
HUTU_OCHA4            MGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSLDEALAKIDEW-TKAGEAK
HUTU_BRASO            MGGAQPLAATMAGASMLAVECQPSRIEMRLRTGYLDRQAASLDEALALMEEA-ARTKTAV
HUTU_BRASB            MGGAQPLAATMAGASMLAVECQPSRIEMRLRTGYLDRQAASLDEALALMAEA-AVTKQAV
HUTU_BRADU            MGGAQPLAATMAGASMLAVECQPSRIEMRLRTGYLDRQAATLDEALAIMEES-AKTKKAI
HUTU_ACICJ            MGGAQPLAATMAGASMIAVECTPSRIEMRLRTRYLDRRADTLDEALAMLEAA-KRDGKPV
HUTU_CAUVN            MGGAQPLAAVMAGAACLAIECQPSSIEMRLRTGYLDRSTDKVEEALAWIEES-CAAKTPI
HUTU_CAUVC            MGGAQPLAAVMAGAACLAIECQPSSIEMRLRTGYLDRSTDKVEEALAWIEES-CAAKTPI
HUTU_CAUSK            MGGAQPLAAVMAGASCLAIECQPSRIEMRLRTGYLDKATERLDEALAWIAEA-NAAKAPV
HUTU_PHEZH            MGGAQPLAAVMAGASCLAIECQPSRIEMRLRTGYLDHAAQTLDEALEIIERS-CREKRPV
HUTU_SPHWW            MGGAQPLAAVMAGASCLAIECQPSRIDMRLRTGYLDRAAETIDEAMAIIEES-CAARKPL
HUTU_SPHAL            MGGAQPLAAVMAGASCLAIECQPSRIEMRLRTGYLDRQAASIDEALAMIEAS-HAEDKPV
HUTU_STRM5            MGGAQPLAAVMAGASCLAVECRKSSIDMRLRTGYLDTWTDNLDEALRLIDES-CKAGTPK
HUTU_STRMK            MGGAQPLAAVMAGASCLAVECRKSSIDMRLRTGYLDTWTDNLDEALRLIDES-CKAGTPK
HUTU_XANAC            MGGAQPLAAVMAGASCLAVECRRSSIDMRLRTGYLDTWTDSLDEALRLIEES-CTARKPL
HUTU_XANC5            MGGAQPLAAVMAGASCLVVECRRSSIDMRLRTGYLDTWTDSLDEALRLIEES-CTAKKPL
HUTU_XANCP            MGGAQPLAAVMAGASCLAVECRRSSIDMRLRTGYLDTWTDSLDEALRLIEES-CTAKRPL
HUTU_HYPNA            MGGAQPLASVMAGTACLAIECQPSSIEMRMRTGYLDAWTDDLEKALAMIDES-CASGTPK
HUTU_RHORT            MGGAQPLAATMAGASMLAVECQPSRIEARLRTGYLDRQTADLDQALAWIAEAGAPGAKPV
HUTU_METNO            MGGAQPLAATMAGASCLAVECRASSIEFRLRTGYVDVQARDLDEALALIDES-CRARVPR
HUTU_MARMM            MGGAQPLAATMAGASMLAVECQPSRIEMRLKTGYLDKSATTLDEALEIINAA-CAKGEAV
HUTU_PHOPR            MGGAQPLAATMAGFSMLAVECDESRIDYRLRTGYVDSKATTLDEALAIIEES-KQTGKPV
HUTU_ALISL            MGGAQPLAATMAGFSMLAVECDESRIDYRLRTGYVDRKATTLDEALAIIEES-KQSGTPV
HUTU_VIBC3            MGGAQPLAATMAGFSMIAVECDESRIDYRLRTGYVDKKANTLDEALAMIADT-D---RPI
HUTU_VIBCH            MGGAQPLAATMAGFSMIAVECDESRIDYRLRTGYVDKKANTLDEALAMIADT-D---RPI
HUTU_VIBCM            MGGAQPLAATMAGFSMIAVECDESRIDYRLRTGYVDKKANTLDEALAMIADT-D---RPI
HUTU_VIBCB            MGGAQPLAGTMAGFSMIAVECDESRIDYRLRTGYVDKKATSLDEALAMIKES-D---TPI
HUTU_VIBPA            MGGAQPLAGTMAGFSMIAVECDESRIDYRLRTGYVDQKATSLDEALAIITES-D---TPV
HUTU_VIBVY            MGGAQPLAATMAGFSMIAVECDESRIDYRLRTGYVDKKATTLDEALAIVKES-D---TPV
HUTU_VIBVU            MGGAQPLAATMAGFSMIAVECDESRIDYRLRTGYVDKKATTLEEALAIVKES-D---TPV
HUTU_VIBTL            MGGAQPLAATMAGFSMIAVECDESRIDYRLRTGYVDRKATSIDEAMAMIKES-D---TPI
HUTU_SHEPA            MGGAQPLAGTMAGYSVLTCEVDETRIDFRLRTKYVDKKATTLDEALAMIDEA-NKSGKPV
HUTU_SHEWM            MGGAQPLAGTMAGYSVLTCEVDETRIDFRLRTRYVDKKATSLDEALAMIDEA-NKSGKPV
HUTU_SHEPW            MGGAQPLAGTMAGYSVLTCEVDETRIDFRLRTRYVDKKATTLDEALAMIDEA-NASGKPV
HUTU_SHEHH            MGGAQPLAGTMAGYSVLTCEVDETRIDFRLRTKYVDKKATSLDEALAMIEEA-NNSGKPV
HUTU_SHESH            MGGAQPLAGTMAGYSVLTCEVDETRIDFRLRTKYVDKKTDSLDEALAMIDEA-NKSGKPV
HUTU_SHEFN            MGGAQPLAGTMAGYSVLTCEVDETRIDFRMRTGYVDKKATSLDQALAMIYAA-NQSGKPV
HUTU_SHEB9            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEEA-NQAGKPV
HUTU_SHEPC            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEAA-NQAGKPV
HUTU_SHEB5            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEEA-NQAGKPV
HUTU_SHEB2            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEEA-NQAGKPV
HUTU_SHESW            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEAA-NQAGKPV
HUTU_SHEB8            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEAA-NQAGKPV
HUTU_SHESR            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMINDA-NASGKPV
HUTU_SHESM            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMINDA-NASGKPV
HUTU_SHESA            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMINDA-NASGKPV
HUTU_SHEON            MGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEALAMIEAA-NQAGKPV
HUTU_CHRVO            MGGAQPLAATMAGFSMIAVECDETRIDFRLKTRYVDRKATTLDEALAIVEDA-KQSGKAV
HUTU_HAHCH            MGGAQPLAATMAGFCMLAVDCDPSRIEFRLRTRYLDKQAKDLDDALAMIENA-KKTGEAI
HUTU_PSEHT            MGGAQPLAATMAGFCALVVECDETRIDFRIKTGYVDIKANNLEHALQLITNA-CVKGDAL
HUTU_IDILO            MGGAQPLAATMAGFCMLAVECDESRIDFRLRTGYVDHKATNLDDALKLINDA-MAKGEAI
HUTU_PSEAB            MGGAQPLAATLAGACSLNIECQQSRIDFRLRSRYVDEQAKDLDDALARIQRY-TAEGKAI
HUTU_PSEAE            MGGAQPLAATLAGACSLNIECQQSRIDFRLRSRYVDEQAKDLDDALARIQRY-TAEGKAI
HUTU_PSEA7            MGGAQPLAATLAGACSLNIECQQSRIDFRLRSRYVDEQAKDLDDALARIARY-TAEGKAI
HUTU_PSEP1            MGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQATDLDDALARIAKY-TAEGKAI
HUTU_PSEPK            MGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQATDLDDALARIAKY-TAEGKAI
HUTU_PSEPU            MGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQATDLDDALVRIAKY-TAEGKAI
HUTU_PSEE4            MGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQATDLDDALARIAKY-TAEGKAI
HUTU_PSEPW            MGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQAKDLDDALARIAKY-TAEGKAI
HUTU_PSEFS            MGGAQPLAATLAGACSLNIECQQVSIDFRLNSRYVDEQATDLDDALARIAKY-TQEGKAI
HUTU_ACIB3            MGGAQPLAATLAGACSLNIECQQASIDFRLRTRYVDEQATDLDDALARIDRY-TKEGKAI
HUTU_ACIBS            MGGAQPLAATLAGACSLNIECQQASIDFRLRTRYVDEQATDLDDALARIDRY-TKEGKAI
HUTU_ACIBC            MGGAQPLAATLAGACSLNIECQQASIDFRLRTRYVDEQATDLDDALARIDRY-TKEGKAI
HUTU_PSESM            MGGAQPLAATLAGACSLNIECQQSRIDFRIKTRYVDEQAADLDDALARIAKY-TAEGKAI
HUTU_PSE14            MGGAQPLAATLAGACSLNIECQQSRIDFRIKTRYVDEQAADLDDALARIAKY-TAEGKAI
HUTU_PSEU2            MGGAQPLAATLAGACSLNIECQQSRIDFRIKTRYVDEQAADLDDALARIAKY-TAEGKAI
HUTU_YERPE            MGGAQPLAATLAGACSLNIECQQSRIDFRLKTRYVDEQATDLDDALARIEKY-TATGVAV
HUTU_YERE8            MGGAQPLAATLAGACSLNIECQQSRIDFRLKTRYVDEQATDFDDALARIKKY-TSAGKAV
HUTU_PHOLL            MGGAQPLAATLAGACSLNIECQQSRIDFRLRTGYVDEQAKDLDDALTRIEKY-TQEGKAI
HUTU_SALCH            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALNS            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALPC            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALG2            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALDC            MGGAQPLAATLAGACSLTIECQQSRIDFCLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALEP            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALA4            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALSV            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALTI            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARITRY-TREGKAV
HUTU_SALAR            MGGAQPLAATLAGACSLTIECQQSRIDFRLRTRYVDEQAATLDDALARIAHY-TRAGKAV
HUTU_CITK8            MGGAQPLAATLAGACSLNIECQQSRIDFRLRTRYVDEQATSLDDALARIEKY-TREGKAV
HUTU_KLEP3            MGGAQPLAATLAGACSLNIECQQSRIDFRLRTRYVDEQATSLDDALARIKKY-TAEGRAI
HUTU_ENT38            MGGAQPLAATLAGACSLNIECQQSRIDFRLRTRYVDEQADNLDDALARINKY-TSQGKTV
HUTU_AZOVD            MGGAQPLAATLAGASALLVECQQSRIDFRLKTGYLDEQARDLDDALARIARY-RGEGRAV
HUTU_RALSO            MGGAQPLAATLAGAVSLTIECQQSSIDFRLRTRYLDKQARDIDDALNLIRHH-CERGEAV
HUTU_BDEBA            MGGAQPLAGVFAGACVLAVEIDPTRIQKRLETKYVDEVATDLDDALARIKKY-TAAGEAK
HUTU_DEIRA            MGGAQPLAVKLAGGVSITIEIDPTRIRKRLETRYLDEVADNLQDAIARAEGY-KAQGVAR
HUTU_HALSA            MGGAQPLAVTMNHGVCIAAEVDEARIDRRIETGYCMERTDDLGEAIERATAA-AEAGDPY
Q1MME7_RHIL3          MGGAQPLAGRMAGAAILCVDIDPERARKRQQIGYLQEIAPDLDSALQMIDAA-VKDKRAL
A8EDJ6_BURPE          MGGAQPLAGRMANAATLVVEIDQTRIHKRLQVGFLERQARDLDEALALIRDA-QARREPI
F9EJZ9_FUSNU          MGANQTWAMKMHGGVCIVVDVNEKTMKKRIEKDYLDIIAPSLEEAIRIAKEN-AKAKKPI
Q8RDU9_FUSNN          MGANQTWAMKMHGGVCIVVDVNEKILKKRIEKDYLDIIAPTLEEAIKIAKEN-AKAKKPI
D0LH96_HALO1          MSGAQAKAAVIAGAVGVIAEVDEAALIKRHEQGWLQEYERDLDRLLARIERA-RAAGEAL
F6GCU0_LACS5          MSGAQPKAGNIAGCITVCAEVNPKITQVRLDQGWINEKITNLDELVTRVNKA-KANKETI
HUTU_MOUSE            MSGAQAKAAAIVGCIGVIAEVDKAALVKRHRQGWLMEVTDSLDRCIARLREA-RKKKEVL
HUTU_HUMAN            MSGAQAKAAVIVGCIGVIAEVDKAALEKRHRQGWLMEVTDSLDRCIQRLREA-RKKKEVL
HUTU_DICDI            MSGAQTKAAYICGAICIVAEVSPAAVKKRHAQNWVMEVYSDLNELFARGSCS-KEKK-PL
HUTU_CAEEL            MSGAQPKAAKIAGCIGVIAEISDTALLKRHQQGWLDVYSKDLEEIVNWIKEY-REKKEAI
A0A0E1EVP6_STRPY      MSGAQGKAAEIAKAVAIIAEVDQSRIETRHSQGWVSQIAESPEEALQLAQKA-IDAKEST
A6TVD8_ALKMQ          MSGAQPKAVEISNGVGIIAEVDLSRIETRHQQGWVSEVSSDLAEVFRIAKEY-MEKKEPI
C0QEW2_DESAH          MSGAQGKAIEIAKGVGIIAEVDESRIQTRYDQGWVSMVTAEPGAAFDAAKKA-MAEKKAL
                      *.. *  :  :     :  :             :           .              

HUTU_THEAC            SIGLLGNAATVYDELMRR-----GIVPDVVSDQTAAHDLNL-GYIPEGYTVESAAKFRD-
HUTU_THEVO            SIGLLGNAATVYDELMKK-----NIVPDVVSDQTAAHDLNL-GYIPEGYTVQSAAEFRE-
G8TVL5_SULAD          SIGVTCHANDLLAYLIRE-----GRVPDVLTDQTAAHDPLV-GYIPDGFSVADAARLRQ-
HUTU_CALS4            SVGLVGNAADVHPELVRR-----GIIPDVVTDQTSAHDPLN-GYVPNGMTLDEAIALRK-
HUTU_THEP3            SVGLVGNAADVHPELVRR-----GIIPDVVTDQTSAHDPLN-GYVPNGMTLEEAFALRK-
HUTU_THEAB            SVALLANAADVHPELVKR-----GIIPDIVTDQTAAHDPLT-GYVPAGMSFEEALKLRK-
HUTU_THEM4            SVGLLANAADVHPELVKR-----GIIPDIVTDQTAAHDPLT-GYVPRGMSFDDALNLRK-
HUTU_FERNB            SIGLLGNAAEVHPELVRR-----GIIPDVVTDQTAAHDPLN-GYVPAGISFEEALKLRK-
HUTU_RUBXD            SIGIPGNAAEVFPALLER-----GYVPDAVTDQTSAHDPLG-GYIPAGYTLEEAAELRE-
HUTU_HERA2            SVGLLGNAAEVFGELYKR-----GVRPDIVTDQTSAHDPLE-GYVPAGMSLEQALELRQ-
HUTU_SACEN            SVAVIGNAAEVLPELLRR-----GVRADIVTDQTSAHDPL--SYLPLGVELEDWEDYAS-
HUTU_BEUC1            SVGLVGNAATVYPELLRR-----GVEIDVVTDQTSAHDPL--SYLPEGVELGEWHEAAE-
HUTU_MYCS2            SVGVVGNAAEVFPELLRR-----GVPIDLVTDQTSAHDPL--SYLPIGISVEDWEDYAT-
HUTU_STRAW            SIGLLGNAAELLPRMLAE-----GAPVDIVTDQTSAHDPL--AYLPVGVDFDDMAAYAA-
HUTU_STRGG            SIGLLGNAAELLPRMLAE-----SAPIDIVTDQTSAHDPL--AYLPLGVDFDDMAGLAA-
HUTU_STRCO            SIGVLGNAAELVPQLLAM-----GAPIDIVTDQTSAHDPL--AYLPTGIAFEDMADAAA-
HUTU_NOCSJ            SIGLLGNAAEVLPRILET-----EVPVDIVTDQTSAHDPL--YYLPVGVPFEEWAARRE-
HUTU_SYMTH            SIGLLGNAATIYPEIVRR-----GVIPDVVTDQTSAHDPLN-GYIPEGLSVQEAAKLRK-
HUTU_BACVZ            SIGLLGNAAEVHHELLNR-----GVHIDIVTDQTSAHDPLI-GYIPAGYSLEEADRLRR-
HUTU_BACSU            SIALLGNAAEVHHTLLNR-----GVKIDIVTDQTSAHDPLI-GYVPEGYSLDEADRLRQ-
HUTU_BACHD            SIGLVGNAAHLHHEILQR-----GVEVDVVTDQTSAHDPLN-GYIPEGHSLEGAELLRK-
HUTU_STAAC            SIGLVGNAVDIHQAILEK-----GFKIDIITDQTSAHDPLN-GYVPQGYSVEEAKVLRE-
HUTU_STAAN            SIGLVGNAVDIHQAILEK-----GFKIDIITDQTSAHDPLN-GYVPQGYSVEEAKVLRE-
HUTU_STAAS            SIGLVGNAVDIHQAILEK-----GFKIDIITDQTSAHDPLN-GYVPQGYSVEEAKVLRE-
HUTU_STAAW            SIGLVGNAVDIHQAILEK-----GFKIDIITDQTSAHDPLN-GYVPQGYSVEEAKVLRE-
HUTU_STAAM            SIGLVGNAVDIHQAILEK-----GFKIDIITDQTSAHDPLN-GYVPQGYSVEEAKVLRE-
HUTU_STAAR            SIGLVGNAVDLHQAILEK-----GFKIDIITDQTSAHDPLN-GYVPQGYSVEEAKVLRE-
HUTU_STAS1            SIGLVGNAVDTHKAILDK-----GFKIDIVTDQTSAHDPLN-GYVPQGYSLEEAKAIRQ-
HUTU_BACCZ            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACC3            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACC0            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACAA            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACCR            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACC4            SIGLLGNAAEILPELVKR-----DITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACHK            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACC1            SIGLLGNAAEILPELVKR-----NITPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACC2            SIGLLGNAAEILPELVNR-----NIIPDLVTDQTSAHDPLN-GYIPVGYTLEEAAKLRE-
HUTU_BACMK            SIGLLGNAAEILPELVNR-----NIIPDLVTDQTSAHDPLN-GYIPVGYTVEEAAKLRE-
HUTU_BACCN            SIGLLGNAAEILPELVSR-----GITPDLVTDQTSAHDPLN-GYVPAGYSLEEATKLRA-
HUTU_NATTJ            SIGLLGNAASIYPELVKR-----GRIPDMVTDQTSAHDILN-GYVPADLDFPYALELRH-
HUTU_GEOKA            SIGLVGNAAEVLPRLVEM-----GFVPDVLTDQTSAHDPLN-GYIPAGLTLDEAAELRA-
HUTU_GEOSW            SIGLLGNAAEVLPKMIEI-----GFIPDVLTDQTSAHDPLN-GYIPAGMTLEEAAELRQ-
HUTU_BACSK            SIGLVGNAAEVLPEMLDR-----GFVPDIVTDQTSAHDPLN-GYLPKGFTNEQGQVLRR-
HUTU_RHIME            SVGLLGNAAEILPEMVRR-----GIRPDMVTDQTSAHDPIN-GYLPKGWTMAEWKAKRE-
HUTU_RHILO            SVGLLGNAAEIVPEMFRR-----GIRPDMVTDQTSAHDPIN-GYLPKGWTMAEWREKRV-
HUTU_AGRFC            SVGLIGNAAEIFPELFRR-----GVRPDIVTDQTSAHDPIH-GYLPAGWTVAEWRAKQE-
HUTU_AGRVS            SVGLIGNAADIFPELVKR-----GIRPDIVTDQTSAHDPIN-GYLPSGWTVAEWRAKQE-
HUTU_CHESB            SVGLLGNAAEIFPELVRRMKAG-GPRPDIVTDQTSAHDPRN-GYLPVGWTVEEARAKRE-
HUTU_AGRRK            SVGLLGNAAEIFPELVKRMKAG-GPRPDIVTDQTSAHDPLN-GYLPLGWTVAEHKIKRE-
HUTU_BRUO2            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_BRUMB            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_BRUAB            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_BRUC2            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_BRUSU            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_BRUSI            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_BRUME            SIALIGNAAEIFPELVKR-----GVKPDIVTDQTSAHDPVH-GYLPLGWTVAEWRAKQE-
HUTU_OCHA4            SIALIGNAAEIYPELVKR-----GVRPDIVTDQTSAHDPVH-GYLPIGWTVAEWRAKQE-
HUTU_BRASO            SVGLLGNAAEIFPELVRR-----GVRPDIVTDQTSAHDPIN-GYLPKGWTLAEWEAKRA-
HUTU_BRASB            SVGLLGNAAEIFPELVRR-----GVRPDIVTDQTSAHDPIN-GYLPKGWTLAEWEMKRA-
HUTU_BRADU            SVGLLGNAAEIFPELVRR-----GVKPDIVTDQTSAHDPIN-GYLPKGWTLADWEAKRA-
HUTU_ACICJ            SIGLLGNAAEVFPELVRR-----GIRPDIVTDQTSAHDPVN-GYLPAGWTLEHWAAMRE-
HUTU_CAUVN            SVGLLGNAAELLPELFKR-----GVRPDLLTDQTSAHDPVN-GYLPAGWSLERWHAMRD-
HUTU_CAUVC            SVGLLGNAAELLPELFKR-----GVRPDLLTDQTSAHDPVN-GYLPAGWSLERWHAMRD-
HUTU_CAUSK            SVGLLGNAAELLPAMFAA-----GVRPDLLTDQTSAHDPIN-GYLPAGWTLDQWATAKE-
HUTU_PHEZH            SVGLVGNACEVLPQILER-----GVLPDLLTDQTSAHDPVN-GYLPKGWSLERWAAMRE-
HUTU_SPHWW            SVGLLGNAAEILPEMYRR-----GIRPDLLTDQTSAHDPVN-GYLPAGWTVAEWIERRE-
HUTU_SPHAL            SVGLLGNAAEILPEIVRR-----GIRPDLLTDQTSAHDPVN-GYLPAGWSLDQWFAKRE-
HUTU_STRM5            SVGLLGNVADVLAELLKR-----GVKPDLLTDQTSAHDPVN-GYLPQGWTVEQWDDKRV-
HUTU_STRMK            SVGLLGNVADVLAELLKR-----GVKPDLLTDQTSAHDPVN-GYLPQGWTVEQWDEKRV-
HUTU_XANAC            SVGLLGNVADVLDELLLR-----GIRPDLLTDQTSAHDPVN-GYLPQGWSVEEWDAKRV-
HUTU_XANC5            SVGLLGNVADVLDELLLR-----GIKPDLLTDQTSAHDPVN-GYLPQGWSVEEWDAKRV-
HUTU_XANCP            SVGLLGNVADVLDELLLR-----GIKPDLLTDQTSAHDPVN-GYLPQGWSVEEWDAKRV-
HUTU_HYPNA            SVGLLGNACEILPKILEL-----GRLPDLLTDQTSAHDPVN-GYLPEDWNVEDWKARRL-
HUTU_RHORT            SVGLLGNAAEVFPELVKR-----GVRPDLVTDQTSAHDPLN-GYLPAGWSLERWERGRE-
HUTU_METNO            SVALIGNAAEVFAEIQRR-----GVRPDCVTDQTSAHDPVN-GYLPRGWSIAEWEARRE-
HUTU_MARMM            SVGLLGNAAEVFPELVKR-----GVKPDMVTDQTSAHDPAN-GYLPAGWTLAEWDEKRE-
HUTU_PHOPR            SVGLLGNAADVYADIVKR-----GIVPDVTTDQTSAHDPLN-GYLPQGWSMEHAAAMRL-
HUTU_ALISL            SVGLLGNAADVYADIVQR-----GIVPDITTDQTSAHDPLN-GYLPQGWSMEQAAEMRL-
HUTU_VIBC3            SVGLLGNAADIFPELVKR-----NITPDVVTDQTSAHDPLN-GYLPLGWSMEKAAQMRQ-
HUTU_VIBCH            SVGLLGNAADIFPELVKR-----NITPDVVTDQTSAHDPLN-GYLPLGWSMEKAAQMRQ-
HUTU_VIBCM            SVGLLGNAADIFPELVKR-----NITPDVVTDQTSAHDPLN-GYLPLGWSMEKAAQMRQ-
HUTU_VIBCB            SVGLLGNAADIFPQLVER-----NITPDVVTDQTSAHDPLN-GYLPQGWSMSHAAEMRL-
HUTU_VIBPA            SVGLLGNAADVFSELVER-----NITPDVVTDQTSAHDPLN-GYLPQGWSMSHAAEMRL-
HUTU_VIBVY            SVGLLGNAADVFAELVER-----NITPDIVTDQTSAHDPLN-GYLPQGWSMAYAAEMRQ-
HUTU_VIBVU            SVGLLGNAADVFAELVER-----NITPDVVTDQTSAHDPLN-GYLPQGWSMAYAAEMRQ-
HUTU_VIBTL            SVGLLGNAADVFPELVER-----NITPDVVTDQTSAHDPLN-GYLPQGWTMEKAAQERT-
HUTU_SHEPA            SVGLLANAADVFAELVER-----GITPDVVTDQTSAHDPLN-GYLPQGWTLEQAIEMRK-
HUTU_SHEWM            SVGLLANAADVFAELVER-----GITPDVVTDQTSAHDPLN-GYLPQGWSLEQAADMRK-
HUTU_SHEPW            SVGLLANAADVFAELVER-----GITPDVVTDQTSAHDPLN-GYLPQGWTLEQAAQMRK-
HUTU_SHEHH            SVGLLANAADVFAELVER-----GITPDVVTDQTSAHDPLN-GYLPQGWTLEYAAEMRK-
HUTU_SHESH            SVGLLANAADVFAELVER-----GVTPDVVTDQTSAHDPLN-GYLPQNWTLEYAAEMRK-
HUTU_SHEFN            SVGLLANAADVFTELVTR-----GIVPDVVTDQTSAHDPLN-GYLPQGWSLEYAAKMRK-
HUTU_SHEB9            SVGLLANAADVFAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMAEAAAMRK-
HUTU_SHEPC            SVGLLANAADVFAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMAEAAAMRK-
HUTU_SHEB5            SVGLLANAADVFAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMAEAAAMRK-
HUTU_SHEB2            SVGLLANAADVFAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMAEAAAMRK-
HUTU_SHESW            SVGLLANAADVFAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMAEAAAMRK-
HUTU_SHEB8            SVGLLANAADVFAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMAEAAAMRK-
HUTU_SHESR            SVGLLANAADVFAELVKR-----GITPDVVTDQTSAHDPLN-GYLPQGWTMAQAADMRK-
HUTU_SHESM            SVGLLANAADIFAELVKR-----GITPDVVTDQTSAHDPLN-GYLPQGWTMAQAADMRK-
HUTU_SHESA            SVGLLANAADVFAELVKR-----GITPDVVTDQTSAHDPLN-GYLPQGWTMAQAADMRK-
HUTU_SHEON            SVGLLANAADVFAELVKR-----GITPDVVTDQTSAHDPLN-GYLPQGWTMAQAADMRK-
HUTU_CHRVO            SVGLLGNAADVFAELVAR-----GITPDVVTDQTSAHDPVH-GYLPQGWTVAQWRDKQK-
HUTU_HAHCH            SIGLLGNAADVYAELVKR-----GVTPDVVTDQTSAHDPLN-GYLPQGWTMEHAAEMRL-
HUTU_PSEHT            SVGLLGNAADVFSTLVKS-----GVTPDVVTDQTSAHDPLN-GYLPQGWSMEHAAKMRE-
HUTU_IDILO            SVGLLGNAADVYSELQQQ-----GVTPDVVTDQTSAHDPLH-GYLPQGWTLEEYKAKQE-
HUTU_PSEAB            SIALLGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPAGWSWEEYRDRAQ-
HUTU_PSEAE            SIALLGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPAGWSWEEYRDRAQ-
HUTU_PSEA7            SIALLGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPAGWTWEQYRDRAQ-
HUTU_PSEP1            SIALHGNAAEILPELVKR-----GVRPDMVTDQTSAHDPLN-GYLPAGWTWEQYRDRAQ-
HUTU_PSEPK            SIALHGNAAEILPELVKR-----GVRPDMVTDQTSAHDPLN-GYLPAGWTWEQYRDRAQ-
HUTU_PSEPU            SIALHGNAAEILPELVKR-----GVRPDMVTDQTSAHDPLN-GYLPAGWTWEQYRDRAQ-
HUTU_PSEE4            SIALHGNAAEILPELVKR-----GVRPDMVTDQTSAHDPLN-GYLPAGWTWEQYRDRAQ-
HUTU_PSEPW            SIALHGNAAEVLPELVKR-----GVRPDMVTDQTSAHDPLN-GYLPVGWTWEQYRDRAQ-
HUTU_PSEFS            SIALLGNAAEILPELVKR-----GVRPDMVTDQTSAHDPLN-GYLPAGWTWDEYRARAK-
HUTU_ACIB3            SIALHGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPVGWTWDEYRERAK-
HUTU_ACIBS            SIALHGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPVGWTWDEYRERAK-
HUTU_ACIBC            SIALHGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPVGWTWEEYRERAK-
HUTU_PSESM            SIALCGNAADILPEMVRR-----GVRPDMVTDQTSAHDPLN-GYLPKGWTWDEYRARSV-
HUTU_PSE14            SIALCGNAAEILPEMVRR-----GVRPDMVTDQTSAHDPLN-GYLPKGWTWDEYRVRSV-
HUTU_PSEU2            SIALCGNAAEILPEMVRR-----GVRPDMVTDQTSAHDPLN-GYLPKGWTWDEYRARSV-
HUTU_YERPE            SIALCGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPKGWNWEEYRQRAQ-
HUTU_YERE8            SIALCGNAAEILPELVRR-----GVRPDMVTDQTSAHDPLN-GYLPKGWSWEEYRRRAQ-
HUTU_PHOLL            SIALCGNAAEILPELVRR-----GVRPDLVTDQTSAHDPLN-GYLPKNWSWEEYRQRAI-
HUTU_SALCH            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALNS            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALPC            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALG2            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALDC            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALEP            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALA4            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALSV            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQKNAQ-
HUTU_SALTI            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPSGWCWEEYQKNAQ-
HUTU_SALAR            SVALCANAADILPELVNR-----GVRPDLVTDQTSAHDPLH-GYLPTGWRWEEYQEKAL-
HUTU_CITK8            SVALCANAADVVPELVKR-----GVRPDLVTDQTSAHDPLH-GYLPSGWRWEEYQAKAA-
HUTU_KLEP3            SIALCGNAADIVPELVKR-----GVRPDMVTDQTSAHDPLH-GYLPKGWSWEEYQQKAE-
HUTU_ENT38            SIALCGNAADIVPELVAR-----GVRPDLVTDQTSAHDPLH-GYLPTGWSWEEYQQKAK-
HUTU_AZOVD            SVGLCANAADILPELVRR-----GVRPDLVTDQTSAHDPLN-GYLPRGWSWAEYRERAA-
HUTU_RALSO            SIGLLGNAAELLPELVRRARAG-GLKPDLVTDQTSAHDLVN-GYLPAGWTVEQWRAAQRD
HUTU_BDEBA            SIALQGNMATVIHQLIEK-----NFTPDLLTDQTSAHDPLV-GYIPEGYTVETAKTFRE-
HUTU_DEIRA            SIGVQGNAAELVPQLVEM-----NWTPDLLTDQTSAHDPMW-GYIPPVNADEDAGKLRS-
HUTU_HALSA            SVGVHGNAADVLEGMLDR-----DFVPDVVTDQTSAHDELA-GYYPSGYTVADADELRD-
Q1MME7_RHIL3          SVGLVGNAAEVYPEIARR-----GIVPDIVTDQTSAHDLVY-GYVPKGMNLDQVKGLRD-
A8EDJ6_BURPE          SVGLLGNAADVFPAILAR-----GVVPDIVTDQTAAHDLVY-GYVPSGYTLEEARSMRD-
F9EJZ9_FUSNU          SIGVVGNAADMYEKVLAS-----DFRPDICSEMCPCHDPI--SYIPSGYTAEEADKLRI-
Q8RDU9_FUSNN          SIGVVGNAADMYEKILAS-----DFRPDICSEMCPCHDPI--SYLPSGYTAEEADELRI-
D0LH96_HALO1          SLGYLGNVVDLWERLVRD-----GVQVELGSDQTSLHNPYAGGYYPAGLSVAESNAMMR-
F6GCU0_LACS5          SIAYLGNIVDVWEKFDEE-----NIHIDLGSDQTSLHNPWAGGYYPVGLSFEEANDMMA-
HUTU_MOUSE            SLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLSFSEAQSLMS-
HUTU_HUMAN            SLGYHGNVVALWERLVHELDTTGECLVDLGSDQTSCHNPFNGGYYPVQLSFTEAQSLMA-
HUTU_DICDI            SIAYQGNVVTLWEKLVEEKDIT----VDLGSDQTSLHNPFNGGYYPVQCSFEESNRLMV-
HUTU_CAEEL            SIGYLGNVVDLWERLAEEPECL----VELGSDQTSLHNPFLGGFYPAGLTFEQSNQMMT-
A0A0E1EVP6_STRPY      SIAYHGNIVDLLEYVNDK-----QIHVDLLSDQTSCHNVYDGGYCPVGITFDERTRLLA-
A6TVD8_ALKMQ          SIAYHGNIVDLLAYAVAH-----NLHIDLLSDQTSCHAAYDGGYCPQGLSFEARTEMLQ-
C0QEW2_DESAH          AIAFHGNVVDLLEYAVDH-----DIHIELLSDQTSCHVAHGGGYCPQGLSFDQRTEMLK-
                      ::.   :                    :  ::  . *      : *              

HUTU_THEAC            -ENREEYIKRVYASIVKEARAILWFQRHGSKTFDYGNNFRTRAQEGG----------MKD
HUTU_THEVO            -KDKDGYVKKVYASIVKEAEAILWFMQHGSKAFDYGNNFRTRALEGG----------LKN
G8TVL5_SULAD          -NDPAEYLRRARASIARHVEQLLTLKRRGAVTFDYGNNIRREAYDQG----------VTD
HUTU_CALS4            -SNPEEYIKRAKKAMAEHVLAMLEMQKRGAIVFDYGNNIRRMAYDEG----------VKD
HUTU_THEP3            -SNPEEYIKRAKKAMAEHVSAMLEMQKRGAIAFDYGNNIRRMAYDEG----------VKE
HUTU_THEAB            -ENPQKYLELVYESVVKHINAILEMQKQGAKVFEYGNNIRRLAYDHG----------VKD
HUTU_THEM4            -ENPKKYLELVYESVVRHIEAILEMQKQGAKVFEYGNNIRRLAYDHG----------VKD
HUTU_FERNB            -ENPEKYLEMVYDSVVKHIEAILEMQRQGAKVFEYGNNIRRLALDHG----------VKD
HUTU_RUBXD            -ADPGRYVREARASMARHCAAMVGFMERGAEVFDYGNNLRGEARLGG----------FER
HUTU_HERA2            -RDPEEYVKHSTASMVEHVKAMVAFADAGSIVFDYGNNLRGVAKAAG----------YDR
HUTU_SACEN            -KKPEEFTDRARDSMAKHVEAMVGFMDAGAEVFDYGNSLRGEAQLAG----------YGR
HUTU_BEUC1            -AKPEEFTDRARESMARQVAAMVGFLDAGAEVFDYGNSIRDEARQGG----------YDR
HUTU_MYCS2            -KKPDEFTERAEESMAVQVRAMVEFQDAGAEVFDYGNSIRDEARKAG----------YDR
HUTU_STRAW            -KDPAGFTTRARESMARHVEAMVGFMDAGAEVFDYGNSIRGEAQLAG----------YER
HUTU_STRGG            -EKPADFTRRARESMARHVEAMVGFMDAGAEVFDYGNSIRGEARLAG----------YDR
HUTU_STRCO            -KDPAGFTTRARESMARHVEAMVGFQDAGAEVFDYGNSIRGEAQLAG----------YDR
HUTU_NOCSJ            -ADPEGFTKEARASMAAHVRAMVELQDRGAEVFDYGNSIRDEARKGG----------YDR
HUTU_SYMTH            -ADPDEYIRRAKASIVKHVQAMLDMQKAGAVVFDYGNNIRQQAYEEG----------LKD
HUTU_BACVZ            -DQPELYVRLSKQSMKKHVEAMLAFKKKGAVVFDYGNNIRQAAKDEG----------LAD
HUTU_BACSU            -DTPELYVRLAKQSMKKHVEAMLAFQQKGSIVFDYGNNIRQVAKDEG----------LEN
HUTU_BACHD            -ENPQRYMALAKQSMKKHVEAMLAFQRRGAIVFDYGNNIRQVAKDEG----------LEE
HUTU_STAAC            -KDPKKYVELSQASMAKHVELMLEFQKRGAVAFDYGNNIRQVAFNNG----------VKN
HUTU_STAAN            -KDPKKYVELSQASMAKHVELMLEFQKRGAVAFDYGNNIRQVAFNNG----------VKN
HUTU_STAAS            -KDPKKYVELSQASMAKHVELMLEFQKRGAVAFDYGNNIRQVAFNNG----------VKN
HUTU_STAAW            -KDPKKYVELSQASMAKHVELMLEFQKRGAVAFDYGNNIRQVAFNNG----------VKN
HUTU_STAAM            -KDPKKYVELSQASMAKHVELMLEFQKRGAVAFDYGNNIRQVAFNNG----------VKN
HUTU_STAAR            -KDPKKYVELSQASMAKHVELMLEFHKRGAVAFDYGNNIRQVAFNNG----------VRN
HUTU_STAS1            -KDPKQYVKEAQTSMRKHVELMLEFQKNGAVAFDYGNNIRQVAFNDG----------LEN
HUTU_BACCZ            -EDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACC3            -EDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACC0            -EDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACAA            -EDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACCR            -EDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACC4            -KDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACHK            -EDPERYVQLSKESMTKHVEAMLTMQAKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACC1            -EDPERYVQLSKESMTKHVEAMLAMQAKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACC2            -EDPERYVQLSKESMTKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACMK            -EDPERYVQLSKESMKKHVEAMLAMQEKGAITFDYGNNIRQVAFDEG----------LKN
HUTU_BACCN            -EDPDRYVQLSKESMKKHVEAMLAMQEKGAIAFDYGNNIRQVAFDEG----------LEH
HUTU_NATTJ            -QDPEKYMKLSKSSIAKHVEAMLEFQKQGAIVFDYGNNIRQQAYIEG----------ITK
HUTU_GEOKA            -RDPKQYIARAKQSIAAHVRAMLAMQKQGAVTFDYGNNIRQVAKDEG----------VDD
HUTU_GEOSW            -RDPKQYIRRAKQSIAEHVKAMLAMQKQGSVTFDYGNNIRQVAKDEG----------VEE
HUTU_BACSK            -EDPQAYISLAKKSMAEQVEAMLELKKRGAIVFDYGNNIRQVAFDEG----------IRD
HUTU_RHIME            -SDPKAVEKAARASMRDHVEAMLAFWDSGVPTLDYGNNIRQVAKDEG----------LER
HUTU_RHILO            -SDPKAVEKAARASMRDHVEAMVAFWNAGVPTLDYGNNIRQVAKDEG----------FEN
HUTU_AGRFC            -SDPKAVAAAARASMKVHVQAMVDFWNAGVPTLDYGNNIRQVAKDEG----------LEN
HUTU_AGRVS            -SDPKAVERAARASMKVHVAAMVDFWNMGVPTLDYGNNIRQVAKEEG----------LEN
HUTU_CHESB            -SDPKSVEIAARASMRAQVEAMVAFWDAGIPTLDYGNNIRQVAKDEG----------LEN
HUTU_AGRRK            -SDPKAVEAAARASMKMHVEAMVAFWDAGVPTLDYGNNIRQVAKEEG----------FEN
HUTU_BRUO2            -NDPKAVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRUMB            -NDPKAVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRUAB            -NDPKAVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRUC2            -NDPKAVEKVARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRUSU            -NDPKAVEKVARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRUSI            -NDPKAVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRUME            -NDPKVVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_OCHA4            -SDPKGVAKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG----------LEN
HUTU_BRASO            -SEPKAVEQASKTSMVGHVQAMLDFHAMGIPTLDYGNNIRQMAKDMG----------LAN
HUTU_BRASB            -SDPKAVEQASKTSMVGHVQAMLDFHAMGIPTLDYGNNIRQMAKDMG----------LAN
HUTU_BRADU            -SDPKAVERASKTSMVEHVQAMLDFHAQGIPTLDYGNNIRQMAQDMG----------LKN
HUTU_ACICJ            -RDPEAVALAAKRSMAGQVRAMLDFWRMGIPVLDYGNNIRAMAQEMG----------VAD
HUTU_CAUVN            -QDPPQVAEAAKASMAAHVKAMLDFQAAGVPTVDYGNNIRQMALEEG----------VTN
HUTU_CAUVC            -QDPPQVAEAAKASMAAHVKAMLDFQAAGVPTVDYGNNIRQMALEEG----------VTN
HUTU_CAUSK            -REPETVNRAARASMAVHVQAMLDFQAAGVPTVDYGNNIRQMALEEG----------VKN
HUTU_PHEZH            -QAPDQVEEAARASMAEHVQAMLAFRKAGVPTVDYGNNIRQVAKDAG----------VTD
HUTU_SPHWW            -REPEAVAKAAKASMAVHVRAMLDFQAAGVPTVDYGNNIRQVAKDEG----------VAN
HUTU_SPHAL            -SDPSAVAKAAKASMAVHVRAMLDLHAAGVPTTDYGNNIRQMAKDEG----------VEN
HUTU_STRM5            -SAPKEVEKAARASMANHIRAMLGFHALGVPTVDYGNNLRQMALEEG----------VEN
HUTU_STRMK            -SAPKDVEKAARASMANHIRAMLGFHALGVPTVDYGNNLRQMALEEG----------VAN
HUTU_XANAC            -SAPKEVEAAARDSMANHIRAMLTFHALGVPTVDYGNNLRQMALEAG----------VDN
HUTU_XANC5            -SARKEVEAAARESMANHIRAMLTFHALGVPTVDYGNNLRQMALEAG----------IDN
HUTU_XANCP            -SAPKDVEAAAREAMANHIRAMLTFHALGVPTVDYGNNLRQMALEEG----------IDN
HUTU_HYPNA            -SDPKAVEKAARASMAKHVRAMLEFQRRGVPTVDYGNNIRQVALDEG----------VAD
HUTU_RHORT            -RAPAEVIAAAKASMATQVRAMLAFHAQGIPTVDYGNNIRQRALEEG----------VSD
HUTU_METNO            -SDPDGVAAAAKRSMAEQVRVMLAFHRAGVPTVDYGNNIRQMALEEG----------VAD
HUTU_MARMM            -SDPAAVEAAAKASMAEQVKAMLAFWEQGIPTLDYGNNIRQMAFDEG----------VTN
HUTU_PHOPR            -EDEAIVVKAAKQSMAVQVQAMLALQEAGSATVDYGNNIRQMALEEG----------VEN
HUTU_ALISL            -KDEPAVVIAAKKSMAIQVQAMLDLQKSGSATVDYGNNIRQMALEEG----------VAN
HUTU_VIBC3            -QNEAEVVKAAKASMAIQVRAMLDLQTRGAATLDYGNNIRQMALEEG----------VAN
HUTU_VIBCH            -QNEAEVVKAAKASMAIQVRAMLDLQTRGAATLDYGNNIRQMALEEG----------VAN
HUTU_VIBCM            -QNEAEVVKAAKASMAIQVRAMLDLQTRGAATLDYGNNIRQMALEEG----------VAN
HUTU_VIBCB            -QDEADVVKTAKKSMAVQVKAMLELQKRGAATLDYGNNIRQMALEEG----------IEN
HUTU_VIBPA            -QDEAAVVKAAKKSMAVQVQAMLDLQSRGAATLDYGNNIRQMALEEG----------VEN
HUTU_VIBVY            -QDESAVVKAAKQSMAVQVKAMLALQTRGAATLDYGNNIRQMALEEG----------VEN
HUTU_VIBVU            -QDESTVVKAAKQSMAVQVKAMLELQSRGAATLDYGNNIRQMALEEG----------VEN
HUTU_VIBTL            -IDEAKVVKAAKQSMAIQVQAMLDLQYRGAATVDYGNNIRQMALEEG----------VEN
HUTU_SHEPA            -TDEAAVVKAAKQSMAVQVKAMLALQAAGAATTDYGNNIRQMAFEEG----------VEN
HUTU_SHEWM            -KDEAAVVKAAKQSMAVQVKAMLALQAAGAATTDYGNNIRQMAFEEG----------VEN
HUTU_SHEPW            -TDEAAVVKAAKQSMAVQVKAMLALQAAGSATTDYGNNIRQMAFEEG----------VEN
HUTU_SHEHH            -KDEAAVVKAAKQSMAVQVKAMLALQAAGAATTDYGNNIRQMAFEEG----------VEN
HUTU_SHESH            -KDEAAVVKAAKQSMAVQVRAMLALQAAGAATTDYGNNIRQMAFEEG----------VEN
HUTU_SHEFN            -TDEAAVVKAAKQSMAVQVRAMLALQAAGAATTDYGNNIRQMAFEEG----------VTN
HUTU_SHEB9            -TDEAAVIKAAKASMAVQVQAMLDLQTAGAATLDYGNNIRQMAFEMG----------VEN
HUTU_SHEPC            -TDEAAVIKAAKASMAVQVQAMLDLQTAGAATLDYGNNIRQMAFEMG----------VEN
HUTU_SHEB5            -TDEAGVVKAAKASMAVQVQAMLDLQTAGAATLDYGNNIRQMAFEMG----------VEN
HUTU_SHEB2            -TDEAGVVKAAKASMAVQVQAMLDLQTAGAATLDYGNNIRQMAFEVG----------VEN
HUTU_SHESW            -TDEAGVVKAAKASMAVQVQAMLNLQTAGAATLDYGNNIRQMAFEMG----------VEN
HUTU_SHEB8            -TDEAGVVKAAKASMAVQVQAMLDLQTAGAATLDYGNNIRQMAFEMG----------VEN
HUTU_SHESR            -TDEAAVVKAAKASMAVQVQAMLDLQAAGAATLDYGNNIRQMAFETG----------VKN
HUTU_SHESM            -TDEAAVVKAAKASMAVQVQAMLDLQAAGAATLDYGNNIRQMAFETG----------VKN
HUTU_SHESA            -TDEAAVVKAAKASMAVQVQAMLELQAAGAATLDYGNNIRQMAFETG----------VKN
HUTU_SHEON            -TDEAAVVKAAKASMAVQVQAMLDLQAAGAATLDYGNNIRQMAFETG----------VKN
HUTU_CHRVO            -TAAAEITAAAKKSMAVQVRAMLTLQQRGAATLDYGNNIRQMALEEG----------VEN
HUTU_HAHCH            -KDPAAVVKAAKQSMAVQVQAMLALQEAGAATLDYGNNIRQMALEEG----------VKN
HUTU_PSEHT            -QDPKAVVTAAKQSMAVQVRAMLALQQAGAATTDYGNNIRQMAFDEG----------VTN
HUTU_IDILO            -SDATGTVNAAKESMAVQVRAMLHFQKEGAAVLDYGNNIRQMAKDVG----------VDN
HUTU_PSEAB            -TDPAAVVKAAKQSMAVHVRAMLAFQQQGVPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEAE            -TDPAAVVKAAKQSMAVHVRAMLAFQQQGVPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEA7            -TDPAGVVKAAKRSMAVHVQAMLAFQKLGIPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEP1            -TEPAAVVKAAKQSMAVHVQAMLDFQKQGIPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEPK            -TEPAAVVKAAKQSMAVHVQAMLDFQKQGIPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEPU            -TEPAAVVKAAKQSMAVHVQAMLDFQKQGVPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEE4            -TDPAAVVKAAKQSMAVHVKAMLDFQKQGIPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEPW            -TEPAAVVKAAKQSMAVHVQAMLDFQKQGIPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSEFS            -TEPAAVIKAAKQSMAVHVKAMLAFQKQGIPTFDYGNNIRQMAQEEG----------VEN
HUTU_ACIB3            -KEPEAVVKAAKQSMAKHVQAMLDFQKMGVPTFDYGNNIRQMAKEEG----------VAN
HUTU_ACIBS            -KEPEAVVKAAKQSMAKHVQAMLDFQKMGVPTFDYGNNIRQMAKEEG----------VAN
HUTU_ACIBC            -TEPEAVVKAAKQSMAKHVQAMLDFQKMGVPTFDYGNNIRQMAKEEG----------VAN
HUTU_PSESM            -SEPAEVVKAAKQSMAEHVEAMLAFQQAGIPTFDYGNNIRQMAKEVG----------VSN
HUTU_PSE14            -SEPANVVKAAKQSMAEHVEAMLAFQQAGIPTFDYGNNIRQMAKEVG----------VAN
HUTU_PSEU2            -SEPASVVKAAKQSMAEHVEAMLAFQQAGIPTFDYGNNIRQMAKEVG----------VTN
HUTU_YERPE            -HEPALVINAAKISMAEHVEAMLAFHNMGIPTFDYGNNIRQMAHDMG----------VIR
HUTU_YERE8            -SEPVLVVNAAKTSMAEHVEAMLAFHHMGIPTFDYGNNIRQMAQDMG----------VTH
HUTU_PHOLL            -SAPEEVIKAAKSSMVEHVKAMLIFQQQGIPVFDYGNNIRQMAYEVG----------VEN
HUTU_SALCH            -SDPHGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALNS            -SDPHGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALPC            -SDPHGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALG2            -SDPHGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALDC            -SDPHGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALEP            -SDPHGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALA4            -SDPHGTMQAAKRSMAAHVRAMLAFSQMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALSV            -SDPHGTMQAAKRSMAAHVRAMLAFSQMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALTI            -SDPRGTMQAAKRSMAAHVRAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_SALAR            -SDPQGTMQAAKRSMAAHVQAMLAFSKMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_CITK8            -SDPQGTVQAAKRSMAKHVQAMLAFSEMGVPTFDYGNNIRQMAKEMG----------VEN
HUTU_KLEP3            -SDPQGTILAAKRSMADHVQAMLAFNEMGVPTFDYGNNIRQMAQEMG----------VSN
HUTU_ENT38            -TDPEGTVLAAKKSMAEHVRAMLAFSDMGVPTFDYGNNIRQMAKEIG----------VEN
HUTU_AZOVD            -REPAATVAAAKRSMAGHVRAMLAFHERGVPVFDYGNNIRQMARDEG----------VEN
HUTU_RALSO            PAQHAHLSAEAARSCAVHVQAMLDFQSMGIPTVDYGNNIRQVAFDQG----------VKN
HUTU_BDEBA            -QDQKAYLKAAYDSMAKHVRGMLAMKDRGAVTFDYGNNLRARAQEAG----------VEN
HUTU_DEIRA            -EHAEEYRQRAYAAMAAHVRAMLELQKRGAVTFDYGNNLRQRAFEAG----------VED
HUTU_HALSA            -EDPDAYREASMDTMARHVAAVLAMQDAGAVAFEYGNNIRGQVAAHRGDVTT-TAGESHD
Q1MME7_RHIL3          -DGQGQLMAASRASIVEHVTAMLEFQKKGSEVFDNGNLIRTQAKEGG----------VAN
A8EDJ6_BURPE          -TDRAKLMQASRASIVRHVEAMLGFKDRGAIVFDNGNLIRTHAKDGG----------VAR
F9EJZ9_FUSNU          -ENREKYLQLARETMKRQLAAMVALKADGVEVFEYGTSIRKECMDAGFP--------REE
Q8RDU9_FUSNN          -KDRDKYLHLARETMKRQLAAMVALKADGVEVFEYGTSIRKECMDAGFP--------REE
D0LH96_HALO1          -DDPAGFRERVQESLRRHAAAINAMSARGMHFWDYGNAFLLEAGRAGAEVMAAGGGG---
F6GCU0_LACS5          -NNPEAFKAEVQKTLRRHAKAINKHTAKGTYFFDYGNAFLLEASRAGADIMADNGV----
HUTU_MOUSE            -SNPAAFKHLVQESLRRHVAAINRLAQEKFFFWDYGNAFLLEAQRAGADVEKKGANK--M
HUTU_HUMAN            -SNPAVFKDLVQESLRRQVSAINRLAEEKFFFWDYGNAFLLEAQRAGADVEKKGAGR--T
HUTU_DICDI            -QEPTKFKEMVQETLRRHTTAINALSARGMKFWDYGNSFLLEASRAKADIIKPGTDG--K
HUTU_CAEEL            -SDPVKFKKLVQNSLIRQIAAIDKIAAKGMYFWDYGNAFLLECQRAGANLLREDAQDD-K
A0A0E1EVP6_STRPY      -EDKDTFHQMVDDTLARHFEAIKTLTENGTYFFDYGNAFMKSVYDSGITEISKNGRNDKD
A6TVD8_ALKMQ          -GNREGFKQLVDETLREHFNMIKKLVEQGTYFFDYGNSFMKAVYDAGVTEISKNGIDEKD
C0QEW2_DESAH          -KDPDAFIKRVDASFVHHYELIKTLVERGTYFFDYGNAFMRAVFDAGVTQICKNGVNTLD
                                   :   .   :           : *. :                     

HUTU_THEAC            AFEIPGYVPAYIRDL-FAVGSGPFRWVALSGDPQDIYRIDDAIIKNFQ------------
HUTU_THEVO            AFDIPGYVPAYIRDL-FAIGSGPFRWVALSGDPQDIYKIDDAIIKNFQ------------
G8TVL5_SULAD          AFDIPGYVPAFIRDL-FNQGKGPFRWVALSGDPADIYHMDDLALTLFG------------
HUTU_CALS4            AFNIPSYVPEYIRDL-FCEGKGPFRWVALSGDPEDIYKTDQKVLELFP------------
HUTU_THEP3            AFNIQGYVPEYIRDL-FSEGKGPFRWIALSGDPEDIYKTDEKVLELFP------------
HUTU_THEAB            AFNIPGYVPEYIRDL-FAEGKGPFRWAALSGNPEDIYKTDKKVLELFP------------
HUTU_THEM4            AFNIPGYVPEYIRDL-FSEGKGPFRWAALSGNPEDIYKTDKKVLELFP------------
HUTU_FERNB            AFNIPGYVPEYIRDL-FSEGKGPFRWVALSGKPEDIYKTDQKVLELFG------------
HUTU_RUBXD            AFSYPGFVPAYIRPL-FCEGKGPFRWAALSGDPDDIAATDEAVLELFP------------
HUTU_HERA2            AFAYPGFVPAYIRPL-FCEGKGPFRWAALSGDPADIAKTDEALLELFP------------
HUTU_SACEN            AFDYPGFVPAYIRPL-FCEGKGPFRWAALSGDPADIAATDRAILDLFG------------
HUTU_BEUC1            AFAFPGFVPAYIRPL-FSEGKGPFRWAALSGDPADIAATDRAVLDLFP------------
HUTU_MYCS2            AFEFPGFVPAYIRPQ-FCEGRGPFRWVALSGDPKDIHATDEAIMKLFP------------
HUTU_STRAW            AFAFPGFVPAYIRPL-FCEGKGPFRWAALSGEASDIAKTDKALLELFP------------
HUTU_STRGG            AFDFPGFVPAYIRPL-FCEGKGPFRWAALSGEASDIHKTDKAMLELFP------------
HUTU_STRCO            AFAFPGFVPAYIRPL-FCEGKGPFRWAALSGDPADIAKTDKAILDLFP------------
HUTU_NOCSJ            AFEFPGFVPAYIRPL-FCEGKGPFRWAALSGDPADIAATDRAILELFP------------
HUTU_SYMTH            AFAFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDRAIMELFP------------
HUTU_BACVZ            AFDFPGFVPAYIRPL-FCEGKGPFRWAALSGDPEDIYRTDALLKELFP------------
HUTU_BACSU            AFDFPGFVPAYIRPL-FCEGKGPFRWAALSGDPADIYRTDALLKELFP------------
HUTU_BACHD            AFAFPGFVPAYIRPL-FCEGKGPFRWAALSGDPEDIYRTDRLIKELFP------------
HUTU_STAAC            AFDFPGFVPAYIRPL-FCEGKGPFRFAALSGDPKDIERADEEMRKLFP------------
HUTU_STAAN            AFDFPGFVPAYIRPL-FCEGKGPFRFAALSGDPKDIERADEEMRKLFP------------
HUTU_STAAS            AFDFPGFVPAYIRPL-FCEGKGPFRFAALSGDPKDIERADEEMRKLFP------------
HUTU_STAAW            AFDFPGFVPAYIRPL-FCEGKGPFRFAALSGDPKDIERADEEMRKLFP------------
HUTU_STAAM            AFDFPGFVPAYIRPL-FCEGKGQFRFAALSGDPKDIERADEEMRKLFP------------
HUTU_STAAR            AFDFPGFVPAYIRPL-FCEGKGPFRFAALSGDPKDIERADEEMRKLFP------------
HUTU_STAS1            AFDFPGFVPAYIRPL-FCEGKGPFRFAALSGNPKDIERADEEMRKIFP------------
HUTU_BACCZ            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACC3            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACC0            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACAA            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACCR            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACC4            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACHK            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACC1            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACC2            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACMK            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_BACCN            AFDFPGFVPAFIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFA------------
HUTU_NATTJ            AFDFPGFVPAYIRPQ-FCEGKGPFRWVALSGDPEDIYRTDRLILEEFS------------
HUTU_GEOKA            AFSFPGFVPAYIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFS------------
HUTU_GEOSW            AFNFPGFVPAYIRPL-FCEGKGPFRWVALSGDPEDIYKTDEVILREFS------------
HUTU_BACSK            AFSFPGFVPAYIRPQ-FCEGKGPFRWVALSGDPADIDKTDEVILQEFA------------
HUTU_RHIME            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYRTDRKVKELLP------------
HUTU_RHILO            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVRELTP------------
HUTU_AGRFC            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELLP------------
HUTU_AGRVS            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELLP------------
HUTU_CHESB            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELLP------------
HUTU_AGRRK            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELTP------------
HUTU_BRUO2            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRUMB            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRUAB            AFAFPGFVPAYIRPL-FCRGIGPYRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRUC2            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRUSU            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRUSI            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRUME            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_OCHA4            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDPEDIAKTDAKVKELLP------------
HUTU_BRASO            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELLP------------
HUTU_BRASB            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELLP------------
HUTU_BRADU            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDPEDIFKTDAKVKELMP------------
HUTU_ACICJ            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYRTDAKVKELIP------------
HUTU_CAUVN            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDPEDIAKTDAKVKELIP------------
HUTU_CAUVC            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDPEDIAKTDAKVKELIP------------
HUTU_CAUSK            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELIP------------
HUTU_PHEZH            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPDDIFRTDAKVKELIP------------
HUTU_SPHWW            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIFKTDAKVKELLP------------
HUTU_SPHAL            AFDFPGFVPAYVRPL-FCRGIGPFRWVALSGDPEDIYRTDARVKQLLP------------
HUTU_STRM5            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELIP------------
HUTU_STRMK            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIAKTDAKVKELIP------------
HUTU_XANAC            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPDDIAKTDAKVKELIP------------
HUTU_XANC5            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPDDIAKTDAKVKELIP------------
HUTU_XANCP            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPEDIAKTDAKVKELIP------------
HUTU_HYPNA            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYRTDQKVKELIP------------
HUTU_RHORT            AFAFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYRTDAKVKELIP------------
HUTU_METNO            AFAFPGFVPAYIRPL-FCRGVGPFRWCALSGDPEDIYRTDAKVKQLLP------------
HUTU_MARMM            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_PHOPR            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDQKVKELIP------------
HUTU_ALISL            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBC3            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBCH            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBCM            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBCB            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBPA            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBVY            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBVU            AFDFPGFVPAYIRPL-FCEGIGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_VIBTL            AFDFPGFVPAYIRPL-FCEGVGPFRWAALSGDPEDIYKTDQKVKELIP------------
HUTU_SHEPA            AFDFPGFVPAYVRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEWM            AFDFPGFVPAYVRPL-FCEGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEPW            AFDFPGFVPAYVRPL-FCEGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEHH            AFDFPGFVPAYVRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHESH            AFDFPGFVPAYVRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEFN            AFDFPGFVPAYVRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEB9            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEPC            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEB5            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEB2            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHESW            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEB8            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHESR            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHESM            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHESA            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_SHEON            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_CHRVO            AFDFPGFVPAYVRPL-FCEGIGPFRWVALSGDPEDIYKTDQKVKELIP------------
HUTU_HAHCH            AFDFPGFVPAYIRPL-FCEGVGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_PSEHT            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDAKVKELIP------------
HUTU_IDILO            AFDFPGFVPAYIRPL-FCEGIGPFRWVALSGDPEDIYKTDEKVKELIP------------
HUTU_PSEAB            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPQDIYKTDAKVKQLIP------------
HUTU_PSEAE            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPQDIYKTDAKVKQLIP------------
HUTU_PSEA7            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPQDIYKTDAKVKELIP------------
HUTU_PSEP1            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGEAEDIYKTDAKVKELIP------------
HUTU_PSEPK            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGEAEDIYKTDAKVKELIP------------
HUTU_PSEPU            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGEAEDIYKTDAKVKELIP------------
HUTU_PSEE4            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDAEDIYKTDAKVKELIP------------
HUTU_PSEPW            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGEAEDIYKTDAKVKELIP------------
HUTU_PSEFS            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDPQDIYKTDAKVKELIP------------
HUTU_ACIB3            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_ACIBS            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_ACIBC            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_PSESM            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPQDIYKTDAKVKELIP------------
HUTU_PSE14            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPEDIYKTDAKVKELIP------------
HUTU_PSEU2            AFDFPGFVPAYIRPL-FCRGIGPFRWAALSGDPQDIYKTDAKVKELIP------------
HUTU_YERPE            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGNPDDIYKTDAKVKALIP------------
HUTU_YERE8            AFDFPGFVPAYIRPL-FCRGVGPFRWAALSGDAEDIYKTDAKVKELIP------------
HUTU_PHOLL            AFDFPGFVPTYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKELLP------------
HUTU_SALCH            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALNS            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALPC            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALG2            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALDC            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALEP            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALA4            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALSV            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALTI            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_SALAR            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_CITK8            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPEDIYKTDAKVKEIVA------------
HUTU_KLEP3            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIIK------------
HUTU_ENT38            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGDPQDIYKTDAKVKEIVA------------
HUTU_AZOVD            AFDFPGFVPAYIRPL-FCRGIGPFRWVALSGEAEDIYRTDARVKELIP------------
HUTU_RALSO            AFDFPGFVPAYIRPL-FCEGRGPFRWVALSGDPEDIYKTDAKIKELFP------------
HUTU_BDEBA            AFDYPGFVPAFIRPL-FCKGSGPFRWVALSGDPNDIKVTDDAMRKLFP------------
HUTU_DEIRA            AFSYPGFVPAFIRDS-FCEGRGPFRWVALSGDPQDIYATDKALLELFP------------
HUTU_HALSA            PFDFPGFVPAYIRPL-FCRGKGPFRWVALSGNPADIHRTDRAVTELFP------------
Q1MME7_RHIL3          AFDIPIFTEAYLRPL-FARAIGPFRWMALSGEESDIARIDDLLLEMFP------------
A8EDJ6_BURPE          AFEIPVFTEAFLRPL-FCRAIGPFRWIALSNDPNDIRVVDDYLLEHFA------------
F9EJZ9_FUSNU          AMKIKGFVAEYIRPL-FCEGRGPFRWTCLSRDPEDLKVSEEIALEICK------------
Q8RDU9_FUSNN          AMKIKGFVAEYIRPL-FCEGRGPFRWTCLSRDPEDLKVSEEIALEICK------------
D0LH96_HALO1          DFRYPSYVEDIMGPMCFDYGFGPFRWVCTSGSDEDLATSDRIAAEVIEQMLVD--APSDI
F6GCU0_LACS5          DFKYPSYVQDIMGPMCFDYGFGPFRWVCASGKPEDLAKTDAIACAILEEIKQN--SPEEI
HUTU_MOUSE            EFRYPSYVQHIMGDI-FSQGFGPFRWVCTSGDPQDLAVTDHLATSVLEKAIAD-GVKASV
HUTU_HUMAN            EFRYPSYVQHIMGDI-FSQGFGPFRWVCTSGDPQDLAVTDELATSVLEEAIAD-GVKVSV
HUTU_DICDI            EFIYPSYVQDIMGDI-FSLGFGPFRWVCTSGNPKDLEITDRIAKELIEKLRSQPGVPKNV
HUTU_CAEEL            SFRYPSYMQDIMGDI-FSMGFGPFRWVCTSGKPEDLRLTDQTACKIIDELKDT-DVPEYV
A0A0E1EVP6_STRPY      GFIWPSYVEDIMGPMLFDYGYGPFRWVCLSGKHEDLVATDKAAMEAIDPDRRY-------
A6TVD8_ALKMQ          GFIFPSYVEDIMGPELFDYGYGPFRWVCLSGEKEDLRKTDQMAMACIDPNRRG-------
C0QEW2_DESAH          GFIFPSYVEDIMGPLMFDYGYGPFRWVCLSGKSEDLLKTDQAAMACIDPDRRS-------
                       :    :    :    *  . * :*: . * .  *:   :                    

HUTU_THEAC            --KDQHLVRWIKLAKERVHFQGLPARICYASY-------GEREEIGLMINDMVRSGDLQA
HUTU_THEVO            --DDPHLIRWIKLAKERVHFQGLPARICYASY-------GEREKIGLMINEMVRNGEVSA
G8TVL5_SULAD          --DNPLLRRWFDLARRYIPFQGLPARIAYMGQ-------GERDRFAVEVNQWVASGKLRA
HUTU_CALS4            --DDPILNRWIRLARERVKFQGLPARICWLGY-------GQRAEFGLAINEMVRKGELKA
HUTU_THEP3            --EDKLLERWIRLAREKIKFQGLPARICWLGY-------GQRAEFGLAINEMVRKGELKA
HUTU_THEAB            --YDDHLRKWIELAQKKVKWQGLPARICWLGQ-------GERAEFGLAINEMVKKGELEA
HUTU_THEM4            --YDEHLKKWVELAQKKVKWQGLPARICWLGQ-------GERAEFGLAINKMVKDGELEA
HUTU_FERNB            --EDEHLRKWIDMAQKKVKWQGLPARICWLGQ-------GQRAEMGLAMNEMVRKGELEA
HUTU_RUBXD            --ENGRLVRWIRQARERVRFQGLPARICWLGA-------GERHRAGLRFNELVAGGTISA
HUTU_HERA2            --EDQALHRWIRAAQERVQFQGLPARICWLGY-------GERAKAGALFNKLVRDGVVSA
HUTU_SACEN            --DDDHLARWIRLAGEKVSFQGLPARICWLGY-------GERHLAGLRFNEMVASGELKA
HUTU_BEUC1            --DDAKLHRWIRAAGERVAYQGLPARICWLGY-------GERHLAGLRFNEMVASGELSA
HUTU_MYCS2            --DDDRLQKWMRGAREKISFQGLPARICWLGY-------GERDKAGVLFNDLVASGKVSA
HUTU_STRAW            --ENESLHRWIKMAGERVHFQGLPARICWLGY-------GERDKAGERFNDMVASGELQA
HUTU_STRGG            --ENESLHRWIRMAGERVHFQGLPARICWLGY-------GERDKAGERFNDMVASGELAA
HUTU_STRCO            --ENESLARWIKMAGERVHFQGLPARICWLGY-------GERDKAGERFNDMVASGELAA
HUTU_NOCSJ            --ANERLRKWITMAGERVHFQGLPARICWLGY-------GERHLAGLRFNEMVASGELKA
HUTU_SYMTH            --ENQSLRRWLEMAQKKVHFQGLPARICWLGY-------GERVKAGLKFNEMVASGELKA
HUTU_BACVZ            --ENQALHRWIDMAQKKVTFQGLPSRICWLGY-------GEREKMGLAINELVRNGELKA
HUTU_BACSU            --TNKALHRWIDMAQEKVTFQGLPSRICWLGY-------GERKKMGLAINELVRTGELKA
HUTU_BACHD            --ENEALIRWIDIAQEKVTFQGLPARICWLGY-------GERMKMGLEINRLVRNGELKA
HUTU_STAAC            --ENEKLLRWLDLAEEKISYQGLPSRIAWLGY-------GERAKMGLALNRLVRDGEISA
HUTU_STAAN            --ENEKLLRWLDLAEEKISYQGLPSRIAWLGY-------GERAKMGLALNRLVRDGEISA
HUTU_STAAS            --ENEKLLRWLDLAEEKISYQGLPSRIAWLGY-------GERAKMGLALNRLVRDGEISA
HUTU_STAAW            --ENEKLLRWLDLAEEKISYQGLPSRIAWLGY-------GERAKMGLALNRLVRDGEISA
HUTU_STAAM            --ENEKLLRWLDLAEEKISYQGLPSRIAWLGY-------GERAKMGLALNRLVRDGEISA
HUTU_STAAR            --ENEKLLRWLDLAEEKISYQGLPSRIAWLGY-------GERAKMGLALNRLVRDGEISA
HUTU_STAS1            --DNEKLIRWLDLAQEKIAFQGLPSRIAWLGY-------EERAKMGLALNKLVRDGEISA
HUTU_BACCZ            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACC3            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACC0            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACAA            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACCR            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACC4            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACHK            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACC1            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACC2            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACMK            --DNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVANGELSA
HUTU_BACCN            --HNEHLCNWIRMARQQVEFQGLPSRICWLGY-------GERAKFGRIINEMVASGELSA
HUTU_NATTJ            --DNEHLCRWIKMAGEQVSFQGLPSRICWLGY-------GERARFGKLINDLVAKGEIKA
HUTU_GEOKA            --DNERLCHWIRMAQKRIKFQGLPARICWLGY-------GERAKFGKIINDMVAKGELKA
HUTU_GEOSW            --DNQHLCNWIRMAREKIQFQGLPARICWLGY-------GERAKFGKIINDMVAKGELKA
HUTU_BACSK            --DNEPLCQWIRMARRHISFQGLPARICWLGY-------GERARFGKRINEMVASGELSA
HUTU_RHIME            --DNKHLHNWLDMARERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRSGELKA
HUTU_RHILO            --GNTHLHNWLDMARERISFQGLPARICWVGL-------GDRHRLGLAFNEMVAKGELKA
HUTU_AGRFC            --DNKHLHNWLDMARERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_AGRVS            --DNKHLHNWLDMARERIAFQGLPARICWVGL-------GDRHKLGLAFNEMVRSGELKA
HUTU_CHESB            --DNKHLHNWLDMAKERISFQGLPARICWVGL-------GDRQKLGLAFNEMVRNGELSA
HUTU_AGRRK            --GNTHLHNWLDMARERIAFQGLPARICWVGL-------GDRERLGLAFNEMVKNGELKA
HUTU_BRUO2            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRUMB            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRUAB            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRUC2            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRUSU            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRUSI            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRUME            --DNKHLHNWLDMAKERIAFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_OCHA4            --DNKHLHNWLDMAKERIEFQGLPARICWVGL-------GDRHRLGLAFNEMVRNGELKA
HUTU_BRASO            --DNKHLHNWLDMARQRIKFQGLPARICWVGL-------GDRHRLGLAFNEMVARGELKA
HUTU_BRASB            --DNKHLHNWLDMARQRIKFQGLPARICWVGL-------GDRHRLGLAFNEMVARGEVKA
HUTU_BRADU            --DDKHLHNWLDMARERIKFQGLPARICWVGL-------GDRHRLGLAFNEMVARGELKA
HUTU_ACICJ            --DDPHLHHWLDMAREWIAFQGLPARICWVGL-------GQRHRLGLAFNEMVARGELSA
HUTU_CAUVN            --DNPHLHNWLDMAGQKIRFQGLPARICWVGL-------GDRHRLGLAFNEMVAKGELKA
HUTU_CAUVC            --DNPHLHNWLDMAGQKIRFQGLPARICWVGL-------GDRHRLGLAFNEMVAKGELKA
HUTU_CAUSK            --DNPHLHHWLDMAAEKIKFQGLPARICWVGL-------GDRHRLGLAFNAMVASGELKA
HUTU_PHEZH            --DNPHLHNWLDMAGERIRFQGLPARICWVGL-------GDRHRLGLAFNEMVAKGELKA
HUTU_SPHWW            --DNHHLHRWLDMARDRIHFQGLPARICWVGL-------GDRHRLGLAFNEMVAKGELKA
HUTU_SPHAL            --DNTHLHNWLDMARERIQFQGLPARICWVGL-------GDRHRLGLAFNEMVASGELKA
HUTU_STRM5            --DNPHLHRWLDMAAEKIKFQGLPARICWVGL-------GDRDRLGQAFNEMVANGELKA
HUTU_STRMK            --DNPHLHRWLDMAAEKIKFQGLPARICWVGL-------GDRDRLGLAFNEMVANGELKA
HUTU_XANAC            --DDAHLHRWLDMAADKIAFQGLPARICWVGL-------GDRHRLGLAFNAMVRSGELKA
HUTU_XANC5            --DDAHLHRWLDMAAEKIAFQGLPARICWVGL-------GDRHRLGLAFNAMVRSGELKA
HUTU_XANCP            --DDAHLHRWLDMAAEKIAFQGLPARICWVGL-------GDRHRLGLAFNAMVRSGELKA
HUTU_HYPNA            --DNPHLHTWLDMARERIKFQGLPARICWVGL-------GDRHRLGLAFNEMVASGELKA
HUTU_RHORT            --DDPHLHTWLDMARERIHFQGLPSRICWVGL-------GDRHRLGLAFNAMVASGELKA
HUTU_METNO            --DNAHLHRWLDMARDKIRFQGLPARICWVGL-------GDRHRLGLAFNAMVRSGELKA
HUTU_MARMM            --DNPHLHRWLDMARERIHFQGLPARICWVGL-------GERHKLGLAFNEMVRTGELSA
HUTU_PHOPR            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRARLGKAFNEMVKNGELKA
HUTU_ALISL            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRARLGKAFNEMVKNGELKA
HUTU_VIBC3            --DNPHLHNWLDMARERIHFQGLPARICWVGL-------KDRARLGLAFNEMVKNGELKA
HUTU_VIBCH            --DNPHLHNWLDMARERIHFQGLPARICWVGL-------KDRARLGLAFNEMVKNGELKA
HUTU_VIBCM            --DNPHLHNWLDMARERIHFQGLPARICWVGL-------KDRARLGLAFNEMVKNGELKA
HUTU_VIBCB            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRERLGQAFNEMVKNGELKA
HUTU_VIBPA            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRERLGQAFNEMVKNGELKA
HUTU_VIBVY            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRERLGQAFNEMVKNGELKA
HUTU_VIBVU            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRERLGQAFNEMVKNGELKA
HUTU_VIBTL            --DNPHLHNWLDMARERIQFQGLPARICWVGL-------KDRERLGQAFNEMVKNGELKA
HUTU_SHEPA            --DNPHLHNWLDMARERIAFQGLPSRICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHEWM            --DNPHLHNWLDMARERIAFQGLPSRICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHEPW            --DNPHLHNWLDMARERIAFQGLPSRICWVGL-------KDRARLALAFNEMVNNGELSA
HUTU_SHEHH            --DNPQLHNWLDMARERIAFQGLPSRICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHESH            --DNPQLHNWLDMARERIAFQGLPSRICWVGL-------KDRARLALAFNEMVKSGELSA
HUTU_SHEFN            --DNPQLHNWLDMARERIAFQGLPARICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHEB9            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHEPC            --DNPLLHNWLDMARERIAFQGLPARICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHEB5            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLALAFNEMVKKGELSA
HUTU_SHEB2            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHESW            --DNPHLHNWLDMARERIAFQGLPARICWIGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHEB8            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLALAFNEMVKNGELSA
HUTU_SHESR            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLAQAFNEMVKNGELSA
HUTU_SHESM            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLAQAFNEMVKNGELSA
HUTU_SHESA            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLAQAFNEMVKNGELSA
HUTU_SHEON            --DNPHLHNWLDMARERIAFQGLPARICWVGL-------KDRARLAQAFNEMVKNGELSA
HUTU_CHRVO            --DDPHLHNWLDMAKERIAFQGLPARICWVGL-------KDRARLGQAFNEMVKNGELKA
HUTU_HAHCH            --DNPHLHNWLDMARERISFQGLPARICWVGL-------KDRARLGLAFNEMVRNGELKA
HUTU_PSEHT            --DDAHLHNWLDMARKRIQFQGLPARICWVGL-------KDRARLALAFNNMVKNGELKA
HUTU_IDILO            --DNEHLHNWLDMAKERISFQGLPSRICWIGL-------KDRARIARAFNDMVKSGELKA
HUTU_PSEAB            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEAE            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRTGELSA
HUTU_PSEA7            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEP1            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEPK            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEPU            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEE4            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEPW            --DDAHLHRWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSEFS            --DDAHLHNWLDMARERISFQGLPARICWVGL-------GQRAKLGLAFNEMVRSGELSA
HUTU_ACIB3            --DDEHLHHWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_ACIBS            --DDEHLHHWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_ACIBC            --DDEHLHHWLDMARERISFQGLPARICWVGL-------GLRAKLGLAFNEMVRSGELSA
HUTU_PSESM            --DDDHLHNWLDMARERISFQGLPARICWVGL-------GQRAKLGLAFNEMVRSGELSA
HUTU_PSE14            --DDDHLHNWLDMARERISFQGLPARICWVGL-------GQRAKLGLAFNEMVRSGELSA
HUTU_PSEU2            --DDEHLHNWLDMARERISFQGLPARICWVGL-------GQRARLGLAFNEMVRSGELSA
HUTU_YERPE            --DDAHLHHWLDMARERIRFQGLPARICWVGL-------GQRAKLGLAFNEMVRSGELSA
HUTU_YERE8            --DDEHLHHWLDMARERISFQGLPARICWVGL-------GQRAKLGLAFNEMVRTGELSA
HUTU_PHOLL            --DDQHLHHWLDMARERISFQGLPARICWVGL-------GQRAKLGLAFNEMVRSGELSA
HUTU_SALCH            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALNS            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALPC            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALG2            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALDC            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALEP            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALA4            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALSV            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALTI            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_SALAR            --EDKHLHHWLDMARERIHFQGLPARICWVGL-------EWRQKLGLAFNEMVRCGEVSA
HUTU_CITK8            --DDKHLHHWLDMARERINFQGLPARICWVGL-------AWRQKLGLAFNEMVRRGEVSA
HUTU_KLEP3            --DDKHLHHWLDMARERISFQGLPARICWVGL-------EWRQKLGLAFNEMVRSGEVSA
HUTU_ENT38            --DDAHLHHWLDMARERINFQGLPARICWVGL-------EWRQKLGLAFNEMVRSGEVSA
HUTU_AZOVD            --DDPHLHRWLGMARERIRFQGLPARICWVGL-------GQRARLGLAFNEMVRRGELKA
HUTU_RALSO            --HNAHVHRWLDMARERIAFQGLPARICWLGL-------GERHAAGLAFNEMVRKGELKA
HUTU_BDEBA            --HKKDLLRWLDMAEERIAFQGLPARICWLEY-------GERAKAGLMFNQLVAEGKVKA
HUTU_DEIRA            --EDERLQSWLTYAADQIAFQGLPARICWLGY-------KERDRAAKLFNDMVKDGRVKA
HUTU_HALSA            --EKDDLHRWIDLAQEHVQFQGLPSRVCWLGYCAADDDLTERARFAVRINELVDNGEIEA
Q1MME7_RHIL3          --DNKIITNWIRLAREHVPFEGLPARIAWLGH-------GERTALARRVNALVASGELKG
A8EDJ6_BURPE          --ENRIVTNWVRRARECVPFEGLPARIAWLGH-------GERTRLALAVNALVRERVLAG
F9EJZ9_FUSNU          --GDKLVERWINLARKNLPIEGMPARICYMGF-------GERKRFGLAINQAIKDGRIKG
Q8RDU9_FUSNN          --GDKLVERWINLARKNLPIEGMPARICYMGF-------GERKRFGLAINQAIKDGRIKG
D0LH96_HALO1          AQQLGDNLRWIREAGAHEMVVGSKARILYSDS-------EGRTRIALAFNRAIRDGAIRG
F6GCU0_LACS5          QQQMADNIQWIKGAQENKLVVGSQARILYADA-------EGRAKIAEAFNQAIAKGEI-G
HUTU_MOUSE            KLQYMDNIRWIREAAKHQLVVGSQARILYSDQ-------KGRVAIAVAINQAIASGKIKA
HUTU_HUMAN            KLQYMDNIRWIREAARHRLVVGSQARILYSDQ-------KGRVAIAVAINQAIACRRIKA
HUTU_DICDI            QQQFNDNHLWISQAGEHKLVVGSQARILYSDC-------IGRSELAVAFNKAVADGTLSA
HUTU_CAEEL            KQQYLDNKKWIEEAEKNKLVVGSQARILYSDR-------AGRVALASAFNELVKSGKVSA
A0A0E1EVP6_STRPY      --QDRDNYNWIRDAEKNQLVVGTQARILYQDC-------IGRVTVALKFNELVRKGKI-G
A6TVD8_ALKMQ          --QDRDNYVWIRDAEKNQLVVGTQARILYQDA-------MGRTKIALKFNEMVRNGEV-G
C0QEW2_DESAH          --QDRDNYIWIRDAQKNKLVVGTQARILYQDA-------AGRVAIALKFNEMVRKGEI-G
                               *.  *       *  :*: :            *   .  .*  :    : .

HUTU_THEAC            PVAIGRDHHDTGSVASPYRETEKMKDGSDAIADWPILNALLNAISGATWVSVHHGGGTAI
HUTU_THEVO            PVAIGRDHHDTGSVASPYRETEKMKDGSDAIADWPILNALLNAISGATWVSVHHGGGTGI
G8TVL5_SULAD          PVVFGRDHHDTGSVASPYRETERMLDGSDAIADWPLLNAMLNVASGAHWVSIHHGGGTGI
HUTU_CALS4            PIVIGRDHHDTGSVASPYRETEAMKDGSDAIADWPILNALLNTASGATWVSVHHGGGVGI
HUTU_THEP3            PIVIGRDHHDTGSVASPYRETEAMKDGSDAIADWPILNALLNTASGATWVSVHHGGGVGI
HUTU_THEAB            PIVIGRDHHDTGSVASPYRETEAMKDGSDAIADWPILNAMLNVASGATWVSFHHGGGVGI
HUTU_THEM4            PIVIGRDHHDTGSVASPYRETEAMKDGSDAIADWPILNAMLNVASGATWVSFHHGGGVGI
HUTU_FERNB            PIVIGRDHHDTGSVASPYRETEAMKDGSDAIADWPLLNAMLNVASGATWVSIHHGGGVGI
HUTU_RUBXD            PIVIGRDHLDSGSVASPYRETEGMRDGSDAIADWPVLNALLNTASGASWVAVHHGGGVGI
HUTU_HERA2            PIVIGRDHLDCGSVASPNRETEAMRDGSDAIGDWPILNAMINAVNGATWVSVHHGGGVGI
HUTU_SACEN            PLVLGRDHLDCGSVASPYRETEGMADGSDAIADWPLLNALVNTASGATWVSLHHGGGVGM
HUTU_BEUC1            PIVIGRDHLDAGSVASPYRETEAMADGSDAIADWPLLNALVNTASGATWVSIHHGGGVGI
HUTU_MYCS2            PIVIGRDHLDSGSVASPYRETEAMLDGSDAIADWPLLNALTATSSGATWVSIHHGGGVGI
HUTU_STRAW            PLAIGRDHLDCGSVASPYRETEAMLDGSDAIADWPLLNAMVNVASGASWVSIHHGGGVGM
HUTU_STRGG            PLAIGRDHLDCGSVASPYRETEAMLDGSDAIADWPLLNAMVNVASGASWVSLHHGGGVGM
HUTU_STRCO            PIVIGRDHLDCGSVASPYRETEAMLDGSDAIADWPLLNAMVNVASGASWVSLHHGGGVGM
HUTU_NOCSJ            PIVIGRDHLDCGSVASPYRETEGMLDGSDAIADWAVLNALVNTASGASWVSFHHGGGVGI
HUTU_SYMTH            PIVIGRDHLDAGSVASPNRETEAMKDGSDAVADWPLLNALVNTAAGATWVSIHHGGGVGI
HUTU_BACVZ            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVGDWAVLNALINTASGASWVSFHHGGGVGM
HUTU_BACSU            PVVIGRDHLDCGSVASPNRETEAMKDGSDAVGDWAVLNALVNTAAGASWVSFHHGGGVGM
HUTU_BACHD            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVGDWAILNALINTAAGGSWISVHHGGGVGM
HUTU_STAAC            PIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISFHHGGGVGM
HUTU_STAAN            PIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISFHHGGGVGM
HUTU_STAAS            PIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISFHHGGGVGM
HUTU_STAAW            PIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISFHHGGGVGM
HUTU_STAAM            PIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISFHHGGGVGM
HUTU_STAAR            PIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISFHHGGGVGM
HUTU_STAS1            PIVIGRDHLDSGSVASPNRETEGMKDGSDAVGDWAILNALINTAAGGSWISFHHGGGVGM
HUTU_BACCZ            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACC3            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACC0            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACAA            PIVIGRDHLDCGSVASPNRETEAMKDGSDSVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACCR            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACC4            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACHK            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACC1            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACC2            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACMK            PIVIGRDHLDCGSVASPNRETESMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_BACCN            PIVIGRDHLDCGSVASPNRETEGMKDGSDAVADWPILNALINSVNGASWVSVHHGGGVGM
HUTU_NATTJ            PIVIGRDHLDCGSVASPNRETEGMKDGSDAIADWPILNALINTAAGAHWVSVHHGGGVGI
HUTU_GEOKA            PIVIGRDHLDSGSVASPNRETEGMKDGSDAIADWPILNALLNAVGGASWVSVHHGGGVGM
HUTU_GEOSW            PIVIGRDHLDSGSVASPNRETEGMKDGSDAIADWPILNALLNAVGGASWVSVHHGGGVGM
HUTU_BACSK            PIVIGRDHLDAGSVASPNRETEAMKDGSDAVADWPILNALVNTAAGASWVSVHHGGGVGM
HUTU_RHIME            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_RHILO            PVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_AGRFC            PVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_AGRVS            PVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNCASGATWVSLHHGGGVGM
HUTU_CHESB            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_AGRRK            PVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUO2            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUMB            PIVIGRDHLDSGSVASPNRKTEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUAB            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUC2            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUSU            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUSI            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRUME            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_OCHA4            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_BRASO            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNCASGATWVSLHHGGGVGI
HUTU_BRASB            PIVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNCASGATWVSLHHGGGVGI
HUTU_BRADU            PVVIGRDHLDSGSVASPNRETEAMKDGSDAVSDWPLLNALLNCASGATWVSLHHGGGVGI
HUTU_ACICJ            PVVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNCASGATWVSLHHGGGVGM
HUTU_CAUVN            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_CAUVC            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_CAUSK            PVVIGRDHLDSGSVASPNRETEAMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PHEZH            PVVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SPHWW            PVVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SPHAL            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_STRM5            PVVIGRDHLDSGSVASPNRETEAMADGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_STRMK            PVVIGRDHLDSGSVASPNRETEAMADGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_XANAC            PVVIGRDHLDSGSVASPNRETEAMADGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_XANC5            PVVIGRDHLDSGSVASPNRETEAMADGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_XANCP            PVVIGRDHLDSGSVASPNRETEAMADGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_HYPNA            PVVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNCASGATWVSLHHGGGVGM
HUTU_RHORT            PVVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_METNO            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_MARMM            PVVIGRDHLDSGSVASPNRETEAMMDGSDAVADWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PHOPR            PIVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_ALISL            PIVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_VIBC3            PIVIGRDHLDSGSVASPNRETEGMLDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBCH            PIVIGRDHLDSGSVASPNRETEGMLDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBCM            PIVIGRDHLDSGSVASPNRETEGMLDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBCB            PVVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBPA            PIVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBVY            PIVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBVU            PIVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_VIBTL            PVVIGRDHLDSGSVASPNRETEGMMDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_SHEPA            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGM
HUTU_SHEWM            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGM
HUTU_SHEPW            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGM
HUTU_SHEHH            PIVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGM
HUTU_SHESH            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGM
HUTU_SHEFN            PIVIGRDHLDSGSVASPNRETEAMLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGM
HUTU_SHEB9            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHEPC            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHEB5            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHEB2            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHESW            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHEB8            PVVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHESR            PIVIGRDHLDSGSVASPNRETESMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHESM            PIVIGRDHLDSGSVASPNRETESMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHESA            PIVIGRDHLDSGSVASPNRETESMMDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SHEON            PIVIGRDHLDSGSVASPNRETESMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_CHRVO            PIVIGRDHLDSGSVASPNRETESMRDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_HAHCH            PVVIGRDHLDSGSVASPNRETESMMDGSDAVSDWPLLNAMLNVAGGATWVSLHHGGGVGM
HUTU_PSEHT            PVVIGRDHLDSGSVASPNRETEAMLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_IDILO            PVVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_PSEAB            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PSEAE            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PSEA7            PIVIGRDHLDSGSVSSPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PSEP1            PVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_PSEPK            PVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_PSEPU            PVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_PSEE4            PVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_PSEPW            PIVIGRDHLDSGSVSSPNRETESMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PSEFS            PVVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_ACIB3            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_ACIBS            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_ACIBC            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_PSESM            PVVIGRDHLDSGSVASPNRETESMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PSE14            PVVIGRDHLDSGSVASPNRETESMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PSEU2            PVVIGRDHLDSGSVASPNRETESMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_YERPE            PVVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_YERE8            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_PHOLL            PIVIGRDHLDSGSVASPNRETESMCDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALCH            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALNS            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALPC            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALG2            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALDC            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALEP            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALA4            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALSV            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALTI            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_SALAR            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_CITK8            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_KLEP3            PIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_ENT38            PIVIGRDHLDSGSVASPNRETEAMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_AZOVD            PVVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGM
HUTU_RALSO            PIVIGRDHLDTGSVASPNRETEAMRDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
HUTU_BDEBA            PIVIGRDHLDCGSVASPNRETEAMKDGSDAVSDWALLNALVNTACGATWVSLHHGGGVGM
HUTU_DEIRA            PIVIGRDHLDAGSVASPYRETEAMKDGSDAVSDWPLLNFGVGIASGASWMSFHHGGGVGL
HUTU_HALSA            PIVVTRDHLDAGSVASPNRETEAMRDGTDAVADWPILNALLNTAAGADIVSVHNGGGVGI
Q1MME7_RHIL3          PVAFSRDHLDAGAMAHPNIMTEGMKDGSDAIADWPLIDAMMLCSSMADLVVIHSGGGGYA
A8EDJ6_BURPE          PIAFTRDHLDAGAMAHPNIMTENLRDGSDAVADWPLLNAMMNCSSMADLVAIHSGGGGYS
F9EJZ9_FUSNU          TVAFSRDNLDSGSIVNPTFESENMPDGGDYISDWPYLNALLDCAAGCDLIAIQQN--YSM
Q8RDU9_FUSNN          TVAFSRDNLDSGSIVNPTFESENMPDGGDYISDWPYLNALLDCAGGCDLIAIQQN--YSM
D0LH96_HALO1          PIVLGRDHHDVSGTDSPYRETAHIRDGSNRCADMAVHNVIGDAFRGATWVSLHNGGGVGW
F6GCU0_LACS5          TVILGRDHHDVSGTDSPYRETSNIYDGSRFTADMAIQNVIGDSFRGATWVSIHNGGGVGW
HUTU_MOUSE            PVVLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGW
HUTU_HUMAN            PVVLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGW
HUTU_DICDI            PVVISRDHHDVSGTDAPWRETSNIKDGSQFCADMAIHNVIGDSFRGATWVAIHNGGGTGF
HUTU_CAEEL            AIVISRDHHDVSGTDSPFRETSNVYDGSAFTADMAVQNCIGDSFRGATWVALHNGGGVGW
A0A0E1EVP6_STRPY      PVMIGRDHHDVSGTDSPFRETSNIKDGSNVTCDMAVQCYAGNAARGMSLVALHNGGGTGI
A6TVD8_ALKMQ          PIMLGRDHHDVSGTDSPFRETANIKDGSNVMADMATQCFAGNAARGMSLIALHNGGGVGI
C0QEW2_DESAH          PVMLGRDHHDTSGTDSPFRETANIKDGSNIMADMAIQCFAGNCARGMSLVALHNGGGVGI
                      .: . **: * ..   *   :  : **     * .              : .: .     

HUTU_THEAC            GNAIHAGFVIVADGTKDAEERIKRVLNADPGIGVIRHADAGYESSIDIIK-----KGPKF
HUTU_THEVO            GNAIHAGFVIVADGTKDAEERIKRVLNADPGIGVIRHADAGYESSIEIIK-----KGPKF
G8TVL5_SULAD          GYSLHAGMVVVADGSADSAERLARVLYNDPGIGVVRHADAGYRLAHDTLHA----HADRI
HUTU_CALS4            GYSIHAGVVVCADGTKETDLRIERVLTGDPGLGIVRHADAGYEIAIKTAK------EKGI
HUTU_THEP3            GYSIHAGVVVCADGTKESDLRIERVLTSDPGSGVMRHADAGYEIAIRTAK------EKGI
HUTU_THEAB            GYSLHAGMVIVADGTDLAHKKLERVLTNDVGLGVVRHADAGYEIAIETAK------KHNL
HUTU_THEM4            GYSLHAGMVTVADGTELAHKKLERVLTNDVGLGVVRHADAGYEIAINTAK------KHNI
HUTU_FERNB            GYSIHAGVVIVADGTELTRQKLERVLTNDVGMGVVRHADAGYEIAIQTAK------KHGI
HUTU_RUBXD            GKSIHAGAQVVVDGTEEGAARIERVLTNDPSLGVVRHADAGYERAREAAR------ALGI
HUTU_HERA2            GYSLHAGMVIVADGTAEADHRLERVLTSDPGMGVVRHVDAGYDEAIAVAQ------ERNV
HUTU_SACEN            GRSLHAGQVTVADGTALAAQKLERVLTNDPGMGVIRHVDAGYDRAREVAT------ERGV
HUTU_BEUC1            GRSIHAGQVSVADGTELAAAKLERVLTNDPGMGVIRHVDAGYARADEVAA------ERGV
HUTU_MYCS2            GRSIHAGQVGVADGTELAAQKLSRLLTNDPGMGVIRHVDAGYERAEEIAA------ERGV
HUTU_STRAW            GRSIHAGQVSVADGTELAGEKIRRVLTNDPGMGVIRHVDAGYDIAESVAD------ERGV
HUTU_STRGG            GRSIHAGQVSVADGTKLAGEKIRRVLTNDPGMGVIRHVDAGYDIAENVAA------DQGV
HUTU_STRCO            GRSIHAGQVTVADGTPLAGEKIRRVLTNDPGMGVIRHVDAGYDIAESVAA------ERDV
HUTU_NOCSJ            GRSLHAGQVCVADGTDLAAQKIERVLTNDPGMGVIRHVDAGYDRAAEVAR------ERGV
HUTU_SYMTH            GYSQHAGMVVVADGTEEARVRLERVLTTDPGMGVVRHVDAGYEKALQVAR------ERGI
HUTU_BACVZ            GYSLHAGMVAVADGSILAEQRLSRVLTSDPGMGIIRHADAGYEKAAQVAE------EQDI
HUTU_BACSU            GYSLHAGMVAVADGSELADERLARVLTSDPGMGIIRHADAGYERAVEVAK------EQDI
HUTU_BACHD            GYSLHAGMVVVADGTENAEKRLRRVLTTDPGMGIIRHADAGYELAKQVAR------EKGV
HUTU_STAAC            GYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAK------EKGI
HUTU_STAAN            GYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAK------EKGI
HUTU_STAAS            GYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAK------EKGI
HUTU_STAAW            GYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAK------EKGI
HUTU_STAAM            GYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAK------EKGI
HUTU_STAAR            GYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAK------EKGI
HUTU_STAS1            GYSLHAGMVVVADGSERADRRLGRVLTTDPGMGVVRHADAGYESAIKVAK------EKGI
HUTU_BACCZ            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACC3            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVKTAK------EKGV
HUTU_BACC0            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACAA            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACCR            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACC4            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACHK            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACC1            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVETAK------EKGV
HUTU_BACC2            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGIVRHVDAGYDLAVETAK------EKGV
HUTU_BACMK            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVQTAK------EKGV
HUTU_BACCN            GYSLHAGMVIVADGTEAAAKRIERVLTSDPGMGVVRHVDAGYDLAVQTAK------EKGV
HUTU_NATTJ            GYSLHAGIVVMADGSKDAEERLERVLTSDPGTGIIRHVDAGYELAKKTAS------EQGV
HUTU_GEOKA            GYSIHAGMVIVADGTKEAEKRLERVLTTDPGLGVVRHADAGYELAIRTAK------EKGI
HUTU_GEOSW            GYSIHAGMVIVADGTKEAEKRLERVLTTDPGLGVVRHADAGYELAIKTAK------EKGI
HUTU_BACSK            GYSLHAGMVVVADGTAEAARRLERVLTTDPGLGVVRHADAGYQKAIETAK------ATGI
HUTU_RHIME            GFSQHSGMVICCDGTDDAARRIERVLWNDPATGVMRHADAGYDIAVDCAR------EKGL
HUTU_RHILO            GFSQHAGMVIVADGTPDAARRLERVLWNDPATGVMRHADAGYDIAIDCAK------EHQL
HUTU_AGRFC            GFSQHSGMVICADGTDDAARRLERVLWNDPATGVMRHADAGYDIAVECAK------EQGL
HUTU_AGRVS            GFSQHSGMVICADGTDDAARRLERVLWNDPATGVMRHADAGYDIALDCAK------EKGL
HUTU_CHESB            GFSQHAGMVICADGSEDANRRLERVLWNDPATGVMRHADAGYEIAVDCAK------EKGL
HUTU_AGRRK            GFSQHSGMVICADGTDDAARRIERVLWNDPATGVMRHADAGYDIALDCAK------DKGL
HUTU_BRUO2            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_BRUMB            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_BRUAB            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_BRUC2            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_BRUSU            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_BRUSI            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_BRUME            GFSQHAGMVICCDGTEDADRRLERVLWNDPATGVMRHADAGYDIALDWAR------KQGL
HUTU_OCHA4            GFSQHSGMVICCDGTEDADQRIGRVLWNDPATGVMRHADAGYDIALDWAK------QQGL
HUTU_BRASO            GYSQHAGMVIVADGTDDAARRLERVLWNDPATGVMRHADAGYDDAIGCAE------ANGL
HUTU_BRASB            GYSQHAGMVIVADGTPDAARRLERVLWNDPATGVMRHADAGYEDAIACAD------VNGL
HUTU_BRADU            GYSQHAGMVIVADGTPEAAKRIARVLWNDPATGVMRHADAGYDIAIDCAR------DKGL
HUTU_ACICJ            GYSQHAGMVIVADGTEAAAKRLERVLWNDPATGVMRHADAGYDIAIDCAR------ENGL
HUTU_CAUVN            GFSQHAGMVIVCDGTEAAAKRVARVLWNDPATGVMRHADAGYDIALACAR------EKGL
HUTU_CAUVC            GFSQHAGMVIVCDGTEAAAKRVARVLWNDPATGVMRHADAGYDIALACAR------EKGL
HUTU_CAUSK            GFSQHAGMVIVADGTEAAAKRLARVLWNDPASGVMRHADAGYEIAKACAR------EHGL
HUTU_PHEZH            GYSQHAGMVIVCDGTEAAARRIERVLWNDPASGVMRHADAGYDIALSVAR------EKGL
HUTU_SPHWW            GYSQHSGMVIVADGTEAAAKRLERVLWNDPATGVMRHADAGYDIALDCAR------DKGL
HUTU_SPHAL            GYSQHSGMVIVADGTPEAAKRLERVLWNDPGTGVMRHADAGYDIAIDCAR------EKGL
HUTU_STRM5            GFSQHAGMVIVCDGTEAAAKRIGRVLWNDPATGVMRHADAGYEIAIDCAK------EKGL
HUTU_STRMK            GFSQHAGMVIVCDGTEAAAKRIGRVLWNDPATGVMRHADAGYDIAIDCAK------EKGL
HUTU_XANAC            GFSQHAGMVIVCDGSEAADKRLERVLWNDPATGVMRHADAGYAIATDCAK------AKGL
HUTU_XANC5            GFSQHAGMVIVCDGSEAADKRIERVLWNDPATGVMRHADAGYAIATDCAK------EKGL
HUTU_XANCP            GFSQHAGMVIVCDGSEAADKRIERVLWNDPATGVMRHADAGYAIAVECAK------DQGL
HUTU_HYPNA            GYSQHAGMVICCDGTEAAARRIERVLWNDPASGVMRHADAGYDIAIDSAR------EHGL
HUTU_RHORT            GFSQHAGMVIVCDGSEDAARRIGRVLWNDPATGVMRHADAGYDDAIACAR------EKGL
HUTU_METNO            GFSQHAGMVIVCDGSEAADRRLERVLWNDPATGVMRHADAGYPEAIACAR------EQGL
HUTU_MARMM            GYSLHSGQVVLADGTVEAAERVGRVLWNDPGTGVMRHADAGYEIAKDCAK------EQGL
HUTU_PHOPR            GFSQHSGMVIVCDGTDDAAERVGRVLRNDPATGVMRHADAGYDIAINCAE------EQGL
HUTU_ALISL            GFSQHSGMVIVCDGTDDAAERVGRVLHNDPATGVMRHADAGYDIAINCAK------EQNL
HUTU_VIBC3            GFSQHSGMVICCDGSDDAAERIARVLHNDPATGVMRHADAGYEIAKRCAQ------QQKL
HUTU_VIBCH            GFSQHSGMVICCDGSDDAAERIARVLHNDPATGVMRHADAGYEIAKRCAQ------QQKL
HUTU_VIBCM            GFSQHSGMVICCDGSDDAAERIARVLHNDPATGVMRHADAGYEIAKRCAQ------QQKL
HUTU_VIBCB            GFSQHSGMVICCDGSDDASERIARVLHNDPATGVMRHADAGYDIAKQCAA------EQKL
HUTU_VIBPA            GFSQHSGMVICCDGSDDASQRIARVLHNDPATGVMRHADAGYDIAKQCAA------EQGL
HUTU_VIBVY            GFSQHSGMVICCDGTEDASARIARVLHNDPATGVMRHADAGYDIAKQCAA------QQGL
HUTU_VIBVU            GFSQHSGMVICCDGTEDASARIARVLHNDPATGVMRHADAGYDIAKQCAA------QQGL
HUTU_VIBTL            GFSQHSGMVICCDGSEDASQRISRVLHNDPATGVMRHADAGYDIAKQCAK------EQKL
HUTU_SHEPA            GFSQHSGVVIVADGTDDAAARLGRVLWNDPATGVMRHADAGYDIAKNCAK------EQGL
HUTU_SHEWM            GFSQHSGVVIVADGTDDAAARLGRVLWNDPATGVMRHADAGYDIAKNCAK------EQGL
HUTU_SHEPW            GFSQHSGVVIVADGTDDAAARLGRVLWNDPATGVMRHADAGYDIAKDCAK------EQGL
HUTU_SHEHH            GFSQHSGVVIVADGTDDAAVRLGRVLWNDPATGVMRHADAGYDIAKNCAK------EQGL
HUTU_SHESH            GFSQHSGVVIVADGSDEAAVRLGRVLWNDPATGVMRHADAGYDIAKKCAK------EQNL
HUTU_SHEFN            GFSQHSGVVIVADGTDEAAVRLGRVLWNDPATGVMRHADAGYDIAKNCAK------EQGL
HUTU_SHEB9            GFSQHSGVVIVCDGTDAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHEPC            GFSQHSGVVIVCDGTDAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHEB5            GFSQHSGVVIVCDGTDAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHEB2            GFSQHSGVVIVCDGTDAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHESW            GFSQHSGVVIVCDGTDAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHEB8            GFSQHSGVVIVCDGTDAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHESR            GFSQHSGVVIVCDGTEAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHESM            GFSQHSGVVIVCDGTEAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHESA            GFSQHSGVVIVCDGTEAAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_SHEON            GFSQHSGVVIVCDGTETAAKRVGRVLWNDPATGVMRHADAGYEIAKNCAK------EQGL
HUTU_CHRVO            GFSQHSGVVIVCDGTDAASERLGRVLRNDPGTGVMRHADAGYDIAVNCAR------EQGL
HUTU_HAHCH            GFSQHSGVVIVCDGSEAADQRIARVLRNDPGTGVMRHADAGYDIARNCAK------ENGL
HUTU_PSEHT            GFSQHAGVVIVADGSDEAKQRIARVLWNDPATGVMRHADAGYDIAKNCAK------EQNL
HUTU_IDILO            GYSQHAGVVIVADGTEEADKRLGRVLWNDPGTGVMRHADAGYDIAKNCAR------EQGL
HUTU_PSEAB            GFSQHSGMVIVCDGSDEAAERIARVLTNDPGTGVMRHADAGYQVAIDCAK------EQGL
HUTU_PSEAE            GFSQHSGMVIVCDGSDEAAERIARVLTNDPGTGVMRHADAGYQVAIDCAK------EQGL
HUTU_PSEA7            GFSQHSGMVIVCDGTDAAAARIARVLTNDPGTGVMRHADAGYPIAIDCAR------EQGL
HUTU_PSEP1            GFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYDIAIDCAK------EQGL
HUTU_PSEPK            GFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYDIAIDCAK------EQGL
HUTU_PSEPU            GFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYDIAIDCAK------EQGL
HUTU_PSEE4            GFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYQIAIDCAK------EQGL
HUTU_PSEPW            GFSQHSGMVIVCDGTDEAAARIARVLTNDPGTGVMRHADAGYDIAVDCAK------EQGL
HUTU_PSEFS            GFSQHSGMVIVCDGTDEAAERIARVLHNDPATGVMRHADAGYQIAIDCAK------EQGL
HUTU_ACIB3            GFSQHSGVVIVCDGTDEAAARIARVLTNDPATGVMRHADAGYEIAINCAK------EQGL
HUTU_ACIBS            GFSQHSGVVIVCDGTDEAAARIARVLTNDPATGVMRHADAGYEIAINCAK------EQGL
HUTU_ACIBC            GFSQHSGVVIVCDGTDEAAARIARVLTNDPATGVMRHADAGYEIAINCAK------EQGL
HUTU_PSESM            GFSQHSGMVIVCDGTDEAAERIARVLHNDPATGVMRHADAGYDIAIDCAK------EQGL
HUTU_PSE14            GFSQHSGMVIVCDGTDEAAERIARVLHNDPATGVMRHADAGYDIAIDCAR------EQGL
HUTU_PSEU2            GFSQHSGMVIVCDGTDEAAERIARVLHNDPATGVMRHADAGYDIAIDCAR------EQGL
HUTU_YERPE            GFSQHSGMVVVCDGSDEAAERIARVLHNDPATGVMRHADAGYDIAVNCAQ------EQGL
HUTU_YERE8            GFSQHSGMVVVCDGSDDAAERIARVLHNDPATGVMRHADAGYDIAINCAQ------EQGL
HUTU_PHOLL            GFSQHAGMVIVCDGTDEAAERIARVLHNDPATGVMRHADAGYEIAIHCAK------EQGL
HUTU_SALCH            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALNS            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECSV------EQGL
HUTU_SALPC            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALG2            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALDC            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALEP            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALA4            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALSV            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALTI            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_SALAR            GFSQHAGMVIVCDGTDEAAARIRRVLHNDPATGVMRHADAGYDLAVECAV------EQGL
HUTU_CITK8            GFSQHAGMVIVCDGTDEAAARIARVLHNDPATGVMRHADAGYEIAVECAA------EQGL
HUTU_KLEP3            GFSQHSGMVIVCDGTDEAAARIARVLRNDPATGVMRHADAGYDIAIECAA------EQGL
HUTU_ENT38            GFSQHAGMVIVCDGTDEAAARIARVLHNDPATGVMRHADAGYDIAIDCAK------EQGL
HUTU_AZOVD            GYSQHAGVAIVCDGTDEAAARIARVLHNDPASGVMRHADAGYPEAIACAR------ERGL
HUTU_RALSO            GYSQHAGVVIVADGTDAAARRLARVLVNDAGSGVMRHADAGYETAVACAK------RNGL
HUTU_BDEBA            GYSQHAGQVIVADGTEKAARRLERVLTADPAMGVFRHLDAGYELAHDIAK------ERGV
HUTU_DEIRA            GFSQHSGLVIVADGTDEAAKKLSRALTNDPGMGVIRHADAGYDHALDVAR------ERGI
HUTU_HALSA            GNSLHTNNHVVLDGSDAAAETARRVFTTDPGMGVIRHADAGYADALVEAD------ASGV
Q1MME7_RHIL3          GYMTSCGVTVVADGTDDADERLDHALTNDTALGVMRYADAGYEEALDEVA--------KK
A8EDJ6_BURPE          GYMTSAGVTVVADGSAAADERLTLSMTNDTALGVIRYADAGYEEALDEAQ--------RR
F9EJZ9_FUSNU          GEAVHTGVTMIADGTEEADRRLAACLTTDSGIGVIRHAQAGYKAAKDVANGKGKFTTDSI
Q8RDU9_FUSNN          GEAVHTGVTMIADGTEEADRRLAACLTTDSGIGVIRHAQAGYKAAKDVANGKGKFTTDSI
D0LH96_HALO1          GQVINGGFGMVLDGSEEADARARSMILWDVNNGIARRAWAGNAGAVVATQRAEQRESR-L
F6GCU0_LACS5          GEVINGGFGMVLDGSKEASTRLKSMLFWDVNNGISRRSWARNEGAIFAIKRAMDSEPN-L
HUTU_MOUSE            GEVINGGFGLVLDGTAEAEQKARMMLSWDVSNGVARRCWSGNPKAYEIICQTMQENSG-L
HUTU_HUMAN            GEVINGGFGLVLDGTPEAEGRARLMLSWDVSNGVARRCWSGNQKAYEIICQTMQENST-L
HUTU_DICDI            GEAINGGFGLYLCGSKLQEEKARMMLNWDVNNGIARRSWSYNDNAENTIKRAMELDPS-L
HUTU_CAEEL            GDVINGGFGIVLDGSSDAARRAEGMLNWDVPNGVTRRSWSGNAKAQEAIQRAEKQVDG-L
A0A0E1EVP6_STRPY      GKAINGGFGLVLDGSERIDEIIKSAIAWDTMGGVARRNWARNEHAIETAIEYNRLHAGTD
A6TVD8_ALKMQ          GKSINGGFGMVLDGSERVDTILSSAMPWDVMGGVARRAWARNENSISTSIEYNQANQGSD
C0QEW2_DESAH          GKAINGGFGLVLDGSSRVDEIIKRAMLWDVMGGVARRSWARNENALDTCVEFNGQYKGEA
                      *     .      *:          :  *   *: *   :    :               

HUTU_THEAC            RYPYIN----------------------
HUTU_THEVO            RYPYL-----------------------
G8TVL5_SULAD          RTPLIGPVRDAE----------------
HUTU_CALS4            KMPMLK----------------------
HUTU_THEP3            KMPMLK----------------------
HUTU_THEAB            RMPMLD----------------------
HUTU_THEM4            QMPMLDT---------------------
HUTU_FERNB            RMPMMD----------------------
HUTU_RUBXD            RMPMLGR---------------------
HUTU_HERA2            HIPMLKQ---------------------
HUTU_SACEN            RVPGLA----------------------
HUTU_BEUC1            RVPMRES---------------------
HUTU_MYCS2            RIPMREGE--------------------
HUTU_STRAW            RVPMREGDDA------------------
HUTU_STRGG            RVPMTEGN--------------------
HUTU_STRCO            RVPMREGDEAHEGDAAHGSGAAREGDGV
HUTU_NOCSJ            RIPMSEG---------------------
HUTU_SYMTH            RLPMYE----------------------
HUTU_BACVZ            MIPMKKER--------------------
HUTU_BACSU            IVPMQK----------------------
HUTU_BACHD            MIPMEDKNEEGV----------------
HUTU_STAAC            HIPMIDKAGDK-----------------
HUTU_STAAN            HIPMIDKAGDK-----------------
HUTU_STAAS            HIPMIDKAGDK-----------------
HUTU_STAAW            HIPMIDKAGDK-----------------
HUTU_STAAM            HIPMIDKAGDK-----------------
HUTU_STAAR            HIPMIDKAGDK-----------------
HUTU_STAS1            KIPMITGKGDK-----------------
HUTU_BACCZ            NIPMMK----------------------
HUTU_BACC3            NIPMMK----------------------
HUTU_BACC0            NIPMMK----------------------
HUTU_BACAA            NIPMMK----------------------
HUTU_BACCR            NIPMMK----------------------
HUTU_BACC4            NIPMMK----------------------
HUTU_BACHK            NIPMMK----------------------
HUTU_BACC1            NIPMMK----------------------
HUTU_BACC2            NIPMMK----------------------
HUTU_BACMK            NIPMMK----------------------
HUTU_BACCN            NIPMMK----------------------
HUTU_NATTJ            NIPMWS----------------------
HUTU_GEOKA            DMPMLK----------------------
HUTU_GEOSW            HMPMLK----------------------
HUTU_BACSK            VIPALAREGKENG---------------
HUTU_RHIME            RLPGILGE--------------------
HUTU_RHILO            NLPGILG---------------------
HUTU_AGRFC            RLPGILGN--------------------
HUTU_AGRVS            RLPGILGN--------------------
HUTU_CHESB            RLPGILGN--------------------
HUTU_AGRRK            RLPGILGN--------------------
HUTU_BRUO2            RLPAILGN--------------------
HUTU_BRUMB            RLPAILGN--------------------
HUTU_BRUAB            RLPAILGN--------------------
HUTU_BRUC2            RLPAILGN--------------------
HUTU_BRUSU            RLPAILGN--------------------
HUTU_BRUSI            RLPAILGN--------------------
HUTU_BRUME            RLPAILGN--------------------
HUTU_OCHA4            RLPAILGN--------------------
HUTU_BRASO            DLPSLAR---------------------
HUTU_BRASB            DLPSLAR---------------------
HUTU_BRADU            DLPSLSK---------------------
HUTU_ACICJ            NLPGITG---------------------
HUTU_CAUVN            DLPGIL----------------------
HUTU_CAUVC            DLPGIL----------------------
HUTU_CAUSK            DLPGIL----------------------
HUTU_PHEZH            DLPGILG---------------------
HUTU_SPHWW            DLPGILG---------------------
HUTU_SPHAL            DLPSI-----------------------
HUTU_STRM5            DLPGILG---------------------
HUTU_STRMK            DLPGILG---------------------
HUTU_XANAC            DLPGILR---------------------
HUTU_XANC5            DLPGILR---------------------
HUTU_XANCP            DLPGILS---------------------
HUTU_HYPNA            DLPSLKG---------------------
HUTU_RHORT            DLPFLG----------------------
HUTU_METNO            VLPSLG----------------------
HUTU_MARMM            DLPSV-----------------------
HUTU_PHOPR            DLPMVNTKNTHSK---------------
HUTU_ALISL            DLPMLSEPK-------------------
HUTU_VIBC3            DLPMLNAELAKLK---------------
HUTU_VIBCH            DLPMLNAELAKLK---------------
HUTU_VIBCM            DLPMLNAELAKLK---------------
HUTU_VIBCB            DLPMLNEELKKLK---------------
HUTU_VIBPA            DLPMLNEELKKLK---------------
HUTU_VIBVY            DLPMLNEELSKLK---------------
HUTU_VIBVU            DLPMLNEELSKLK---------------
HUTU_VIBTL            DLPMLNEELRRL----------------
HUTU_SHEPA            DLPMLEKATTEGK---------------
HUTU_SHEWM            DLPMLEK---------------------
HUTU_SHEPW            DLPMLEK---------------------
HUTU_SHEHH            DLPML-----------------------
HUTU_SHESH            DLPMLEK---------------------
HUTU_SHEFN            DLPMLGA---------------------
HUTU_SHEB9            DLPMQD----------------------
HUTU_SHEPC            DLPMQD----------------------
HUTU_SHEB5            DLPMQE----------------------
HUTU_SHEB2            DLPMQE----------------------
HUTU_SHESW            DLPMQD----------------------
HUTU_SHEB8            DLPMQE----------------------
HUTU_SHESR            DLPMLKD---------------------
HUTU_SHESM            DLPMLKD---------------------
HUTU_SHESA            DLPMLKD---------------------
HUTU_SHEON            DLPMLKD---------------------
HUTU_CHRVO            DLPMLK----------------------
HUTU_HAHCH            DLPMLKD---------------------
HUTU_PSEHT            DLPMLNEE--------------------
HUTU_IDILO            DLPMLDTK--------------------
HUTU_PSEAB            NLPMITAQR-------------------
HUTU_PSEAE            NLPMITAQR-------------------
HUTU_PSEA7            NLPMITGKR-------------------
HUTU_PSEP1            DLPMITG---------------------
HUTU_PSEPK            DLPMITG---------------------
HUTU_PSEPU            DLPMITG---------------------
HUTU_PSEE4            DLPMITG---------------------
HUTU_PSEPW            DLPMITG---------------------
HUTU_PSEFS            NLPMIK----------------------
HUTU_ACIB3            HLPMITQ---------------------
HUTU_ACIBS            HLPMITQ---------------------
HUTU_ACIBC            HLPMITQ---------------------
HUTU_PSESM            NLPMIGR---------------------
HUTU_PSE14            NLPMIGR---------------------
HUTU_PSEU2            NLPMIGR---------------------
HUTU_YERPE            NLPMVAATQGKKS---------------
HUTU_YERE8            NLPMIAATQGRKA---------------
HUTU_PHOLL            DLPMLNTK--------------------
HUTU_SALCH            NLPMVAATQGKG----------------
HUTU_SALNS            NLPMVAATQGKG----------------
HUTU_SALPC            NLPMVAATQGKG----------------
HUTU_SALG2            NLPMVAATQGKG----------------
HUTU_SALDC            NLPMVAATQGKG----------------
HUTU_SALEP            NLPMVAATQGKG----------------
HUTU_SALA4            NLPMVAATQGKG----------------
HUTU_SALSV            NLPMVAATQGKG----------------
HUTU_SALTI            NLPMVAATQGKG----------------
HUTU_SALAR            HLPMVAATQRKR----------------
HUTU_CITK8            NLPMIAATQGKR----------------
HUTU_KLEP3            NLPMVAATQGNAK---------------
HUTU_ENT38            NLPMIAATQGKH----------------
HUTU_AZOVD            KLPMLGDA--------------------
HUTU_RALSO            KLPMIG----------------------
HUTU_BDEBA            RSLWL-----------------------
HUTU_DEIRA            DLPSLGIKDHA-----------------
HUTU_HALSA            TVPMRDAEREQ-----------------
Q1MME7_RHIL3          DVPYIRLG--------------------
A8EDJ6_BURPE          QIPHFRL---------------------
F9EJZ9_FUSNU          KVPLWWQPAEKVTFGPKGKYR-------
Q8RDU9_FUSNN          KVPLWWQPAEKVTFGPKGKYR-------
D0LH96_HALO1          RVTLPHQADDAVVRAALAAHKPGESDA-
F6GCU0_LACS5          KVTLPNNVDDAIIDSL------------
HUTU_MOUSE            VVTLPHEVADEQVLQQALRP--------
HUTU_HUMAN            VVTLPHKVEDERVLQQALQL--------
HUTU_DICDI            KVTIPNHTSDDLINSLNF----------
HUTU_CAEEL            RVTLPVEADEELLKKLKF----------
A0A0E1EVP6_STRPY      HITIPYLADDDLVTSAVDQLFH------
A6TVD8_ALKMQ          HITIPYIPKDELVKECLDKAFNK-----
C0QEW2_DESAH          HISIPYLTDEQMIADLVDAKIK------