CLUSTAL format seed alignment for MF_00579

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

E1RKI3_METP4      --------------------------------------MQINGTEIVDTYAEAFPIWLSR
Q2NE82_METST      --------------------------------------MKLP--IIEDTYAEAFNTKAAH
FTR_METKA         --------------------------------------MEINGVEIEDTFAEAFEAKMAR
Q0W8U1_METAR      --------------------------------------MKINNVEIEDTYAEAFPIQVSR
D1YXD3_METPS      --------------------------------------MKYNNVEIDDTYAEAFPVTVSR
H8I4R1_METCZ      --------------------------------------MKYNNVEIDDTYAEAFPAQVSR
B8GE36_METPE      --------------------------------------MEFNGVPIDDTYAEAFPIWISR
Q2FKY6_METHJ      --------------------------------------MELNGVPIDNTFAEGFPIWVSR
E1REI3_METP4      --------------------------------------MELNGVQIEDEFAEAFPNWACR
A3CT61_METMJ      --------------------------------------MELNGVTIDDTYAEAFPTWVAR
A7I5V0_METB6      --------------------------------------MEINGVTIDDTYAEAFPTWVCR
F4BTC4_METSG      --------------------------------------MEINGVQIDDTFAEAFPIKMAR
A0B9N6_METTP      --------------------------------------MEINGVEIDDTFAEAFPIKIGR
G7WRA5_METH6      --------------------------------------MEISGVEIEDTFAEGFPIKVAR
A6UQQ1_METVS      --------------------------------------MELNGVVIEDTFAEGFSIWVSR
A9A952_METM6      --------------------------------------MELNGVVIEDTFAEGFPIWVSR
A6VHJ8_METM7      --------------------------------------MELNGVVIEDTFAEGFPIWVSR
A4G0W2_METM5      --------------------------------------MELNGVVIEDTFAEGFPIWVSR
Q6LWU5_METMP      --------------------------------------MELNGVVIEDTFAEGFPIWVSR
F8AN94_METOI      --------------------------------------MEINGVFIEDTFAEAFPIWVSR
A6UTJ4_META3      --------------------------------------MEINGVFIEDTFAEAFPIWVSR
D7DQM5_METV3      --------------------------------------MELNGVAIDNTFAEGFPIWTSR
F6BCN6_METIK      --------------------------------------MEINGVIIEDTFAEAFPIWVSR
D5VSI1_METIM      --------------------------------------MEINGVYIEDTFAEAFPIWVSR
C7P952_METFA      --------------------------------------MEINGVYIEDTFAEAFPIYVSR
D3S4K6_METSF      --------------------------------------MEINGVYIEDTFAEAFPIWVSR
C9RFK4_METVM      --------------------------------------MEINGVYIEDTFAEAFPIWVSR
FTR_METJA         --------------------------------------MEINGVYIEDTFAEAFPIWVSR
FTR_METFV         --------------------------------------MKVNGVEIEDTFAEAFDIKVSR
FTR_METTH         --------------------------------------MEINGVEIEDTFAEAFGIKVSR
D9PYC7_METTM      --------------------------------------MEINGVEIEDTFAEAFGIKVSR
F0T892_METLA      --------------------------------------MDINGVEIEDNFAEAFDIKVSR
F6D426_METPW      --------------------------------------MEINGVEIEDNFAEAFGIQVSR
D3E0E8_METRM      --------------------------------------MEINGVEIKETYAEGFGIKVTR
A5UM69_METS3      --------------------------------------MEINGVEIKDNYAEGFGIKVTR
D7EBE7_METEZ      --------------------------------------MEVNGVEVEETFAEAFPIKVSR
FTR_METBF         --------------------------------------MEINGVEIEDTYAEAFPIKIAR
FTR_METAC         --------------------------------------MEINGVEIEDTYAEAFPIKIAR
FTR_METMA         --------------------------------------MEINGVEIEDTYAEAFPIKIAR
F7XL43_METZD      --------------------------------------MELNGVEIEDTFAEAFPIKMGR
D5E8Y9_METMS      --------------------------------------MEINGVEIEDTFAEAFPIKIGR
F2KML2_ARCVS      --------------------------------------MKLNGVEIEDTFAEAFDIYVAR
FTR_ARCFU         --------------------------------------MKVNGVEVEETFAEAFDIKIAR
D3RYB3_FERPA      --------------------------------------MKVNGVEVEETYAEAFDIKVAR
E4RM60_HALHG      --------------------------------------MQFQGIEIENTFAEAFNMYGTR
I4BWV4_ACEMN      --------------------------------------MIYNGVEIEDTYAEAFSMWGSR
D2R5E2_PIRSD      --------------------------------------MKLGSVTIDDTFAEAFGMRYTR
D5SRS8_PLAL2      MSEPANRDAVKLQNSLPEGSTLKGFSQEDPAHAGVRWLRTSSGVIVEQTFAEAFPMSFAR
F0SSN0_RUBBR      -----------------------MIGRNHFDRSVSMSELNLNQIPVHDTFAEAFGVTGTR
E8QZI9_ISOPI      -----------------------------MSALSTVCGYLAEGIEVEDTFAEAFGMTAAR
FTR_RHOBA         ----------------------------MADPAATPKSLSIACVSIKDTFAEAFDMKATR
D8JYG4_HYPDA      ------------------------------------MSKTVNGVEIDDTFAEAFGMSGTG
F8JBN5_HYPSM      ------------------------------------MSKTVNGISIDDTFAEAFGMSGTG
B0UF30_METS4      -----------------------------------MADLTLHGIRVEDTFAEAFDMAGTA
B8ITW7_METNO      -----------------------------------MADLTLNGIRVEDTFAEAFDMAGTA
B1LV90_METRJ      -----------------------------------MSDLTLNGIPVVDTFAEAFDVAGTA
B1ZIB9_METPB      -----------------------------------MSDLILNGIKVEDTFAEAFDVAGTA
FHCD_METEA        -----------------------------------MSDFTLNGIKVEDTFAEAFDVAGTA
A9W3R8_METEP      -----------------------------------MSDFTLNGIKVEDTFAEAFDVAGTA
B7KXD3_METC4      -----------------------------------MSDFTLNGIKVEDTFAEAFDVAGTA
C7CBT1_METED      -----------------------------------MSDFTLNGIKVEDTFAEAFDVAGTA
E8TE70_MESCW      -----------------------------------MPNMSINGVTIDDTFAEAFGMRATA
Q1YFY4_AURMS      --------------------------------------MTRNGVVIDDTFAEAFPMSGTA
B8EKG2_METSB      -----------------------------------MRAMIANGVRIDESFAEAFPMRGTA
J7QQ18_METSZ      -------------------------------------------MTIDDNFAEAFPMSGTG
G7ZBU3_AZOL4      -----------------------------------MAELQINGVRIEDTFAEAFPMTYTR
G7ZAY1_AZOL4      --------------------------------------MLLNGIHIENTYAEAFDMKATR
A7IG96_XANP2      --------------------------------MTSQAPMIINGVEIRDSFAEAFPMAGTR
D7A5G4_STAND      --------------------------------------MIRNGVEIRDNFAEAFPMVGTR
D7DPS3_METV0      --------------------------------------MIINGVQIDETFAEAFNMRGTR
C6WV19_METML      -------------------------------------MMLLNNIQIDDTFAEAFNMRGTR
C6XDX8_METGS      --------------------------------------MIINGVSIDDTFAEAFGMRGTR
I1XFH4_METNJ      --------------------------------------MIINGVSIDKTFAEAFPMKGTR
I1YJL0_METFJ      --------------------------------------MIINGVAIDKTFAEAFPMKGTR
G0A464_METMM      --------------------------------------MIINGVTIDKTFAEAFPMKATR
G4SVI6_META2      -------------------------------------MMIINGVTIDKTFAEAFPMKATR
FTR_METCA         --------------------------------------MIINGVHIDETFAEAFPMRATR
D5C447_NITHN      --------------------------------------MIINGVKIDPSFAEAFPMKATR
B2JX59_PARP8      --------------------------------------MQIHDTLIDDTFAEAFPMKATR
D5WEG1_PARAM      --------------------------------MNAPAPLEINGTAIDATFAEAFPMKATR
Q13QW1_PARXL      --------------------------------MSEPATLQINGTTIDATFAEAFPMKATR
E1TEU1_BURSG      ----------------MAHMADIAAPHAGSDKTSDTSTLQINGTTIDATFAEAFPMKATR
B2JVM0_PARP8      -------------------------------MSVTTSPRSVRGVSIDDTFAEAFPMKATR
A2SJ40_METPP      --------------------------------------MELNGIVIDDSFAEAFPMKGTR
I0HWJ0_RUBGI      ----------------------------------MSEAVVLNGVVVDATFAEAFPMKATR
B1Y0X7_LEPCP      -----------------------------MSAATTTTPLELNGVVIDDGFAEAFPMKATR
C5CPU5_VARPS      -----------------------------------MKALERNGVVIDETFAEAFPMKATR
                                                               :   :**.*      

E1RKI3_METP4      VIITADTHELAMVAATEATGFATSTIMCPCEAGIER-YYSPEETPDKRPGVSIFICT-AR
Q2NE82_METST      LLITAATKNLAFTAATEATGFATSFIGCPAEAGIDK-YISPDKTPDNRPGYSIIICQNKI
FTR_METKA         VLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGVTIMIGHNDE
Q0W8U1_METAR      VLITAATEYYARIAATEATGFGTSVIGCPAEAGIDC-FVPSTKTPDGRPGYVIMICHPKK
D1YXD3_METPS      VLITAATEYWAKVAATEATGFGTSVIGCPAEAGIDC-FVPADKTPDGRPGYAIMIVQMGK
H8I4R1_METCZ      VLITAVTEYYAKVAAIEATGFGTSVIGCPAEAGIDC-FVPADKTPDGRPGYVIMICHPNK
B8GE36_METPE      VLITAATMDLAYTAAVEASGFATSCIGCTAECGVDT-FVPAEETPDGRPGYSMLICNPSK
Q2FKY6_METHJ      VIITGVTREWAMTAAMEATGFATSAIGCPCEAGIEG-YVSADETPDGRPGVSILICA-SK
E1REI3_METP4      VIITAITEKWALQAATEATGFATSAIGCPCEAGIER-ILPASETPDGRPGVAVLFFAGGK
A3CT61_METMJ      PIITAVTEEWAYKAAVEAVGFATSTIGCPAEAGIDC-FVSPDETPDGRPGYAIMICA-SK
A7I5V0_METB6      VIITAVTKDWALKAATEATGFATSAIGCPCEAGIES-ILSGSETPDGRPGVSILICA-SK
F4BTC4_METSG      VQITAVTERWALEAAREATGFGTSVIGCPAEAGIEC-LVDGRETVDGRPGVNILLCNMGF
A0B9N6_METTP      VLITAISERWALEAAREATGFGTSVIMCPAEAGIEC-IVPSTETPDGRPGVYIQICNMSW
G7WRA5_METH6      VLITAITERWAMEAAREATGFGTSVIMCPAEAGIER-LARRAETPDGRPGVYIQICNMSF
A6UQQ1_METVS      VLITAATERLAKAAATEATGFACSVIMCPAEAGIEK-YVSPMETPDGRPGYIIEICHPKK
A9A952_METM6      VLITAATERLAKAAATEATGFACSVIMCPAEAGIEK-YVSPAETPDGRPGYIIEICHPKK
A6VHJ8_METM7      VLITAATERLAKAAATEATGFACSVIMCPAEAGIEK-YVSPAETPDGRPGYIIEICHPKK
A4G0W2_METM5      VLITAATERLAKAAATEATGFACSVIMCPAEAGIEK-YVSPAETPDGRPGYIIEICHPKK
Q6LWU5_METMP      VLITAATERLAKAAATEATGFACSVIMCPAEAGIEK-YVSPAETPDGRPGYIIEICHPKK
F8AN94_METOI      VLITAATERLAKIAATEATGFGCSVIMCPAEAGIEK-YVSPEETPDGRPGYIVEICHPKK
A6UTJ4_META3      VLITAATEKLAKIAATEATGFGCSVIMCPAEAGIEK-YVPATETPDGRPGYIIEICHPKK
D7DQM5_METV3      ILITAATERLAKVAATEATGFACSVIMCPAEAGIEK-YVAPTETPDGRPGYIVEICHPKK
F6BCN6_METIK      ILVTAATERLAKIAATEATGFGCSVIMCPAEAGIEK-YVPPTETPDGRPGYIIQICHPKK
D5VSI1_METIM      ILITAATKRWAKIAATEATGFGTSVIMCPAEAGIEK-YVPPSKTPDGRPGFIIQICHPKK
C7P952_METFA      VLITAATKKWAKIAATEATGFGCSVIMCPAEAGIEK-YVPPSETPDGRPGFIIQICHPKK
D3S4K6_METSF      VLITAATKKWAKIAATEATGFGCSVIMCPAEAGIEK-YVPPSETPDGRPGYIIQICHPKK
C9RFK4_METVM      VLITAATKKWAKIAATEATGFGCSVIMCPAEAGIEK-YVPPSKTPDGRPGFIIQICHPKK
FTR_METJA         VLITAATKKWAKIAATEATGFGCSVIMCPAEAGIEK-YVPPSKTPDGRPGFIIQICHPKK
FTR_METFV         ILVTAASKRLAKIAAREATGYGTSVIGCPAEAGIDT-YIPPKNTPDQRPGFTIIICNPSK
FTR_METTH         VLVTAATKKLAKIAATEATGYGTSVIGCPAEAGIDC-YVPPEETPDGRPGYIIMICNPSK
D9PYC7_METTM      VLVTAATKKLAKIAATEATGYGTSVIGCPAEAGIDC-YVPPEETPDGRPGYIIMICNPSK
F0T892_METLA      ILITAATKKLALVAATEATGYGTSVIGCPAEAGIDC-YVPPQETPDGRPGYVIMICNMNK
F6D426_METPW      ILVTAATKKLAKVAATEATGYGTSVIGCPAEAGIDC-YVPPQETPDGRPGYIIMICNMSK
D3E0E8_METRM      ILVTAATAKLAKIAATEATGYATSVIGCPAEAGIDC-FVPSECTPDGRPGYAIMICHASK
A5UM69_METS3      ILVTAATKRLAKIAATEATGYGTSVIGCPAEAGIDC-YVPPTETPDGRPGYVIMLCQGSK
D7EBE7_METEZ      ILITAATKYWAKVAAQEATGFGTSVIMCPAEAGIER-FANWNETPDGRPGYYIQICNFSY
FTR_METBF         VLITAATKRWALVAATEATGFATSVIMCPAEAGIER-LASPSETPDGRPGVYVQICTFKY
FTR_METAC         VLITAATKRWAQVAATEATGFATSVIMCPAEAGIEK-FASPSETPDGRPGVYVQICTFKY
FTR_METMA         VLITAVTKRWAQVAATEATGFGTSVIMCPAEAGIER-FASPSETPDGRPGAYIQICTFKY
F7XL43_METZD      VLITAATRKWAEVAAQEATGFGTSVIMCPAEAGIER-FVSGDSTPDGRPGVYIQICTFGY
D5E8Y9_METMS      VLITAVNEKWARVAAQEATGFGTSVIMCPAEGGIER-VASPDETPDGRPGVYIQICTFGY
F2KML2_ARCVS      VLITAYDYGLAEVAATEATGFGTSIIMCPAEAGIEG-KAKPEETPDGRPGVYIQICHPSK
FTR_ARCFU         VLITGYDYYWAWVAANEATGFGTSVIMCPAEAGIEI-KAKPSETPDGRPGYYIQICHMSK
D3RYB3_FERPA      VLITAYDYYWAYVAANEATGFGTSVIMCPAEAGIEK-KALPSETPDGRPGYYIQICHMSK
E4RM60_HALHG      IIVTADNKKWAKIAARESTGFATSIIECGIEAGIER-ELREEETLDGRPGYSLLFFTMKK
I4BWV4_ACEMN      IVVTADTREWVMTAAASATGFATSVIGCGCEAGVES-ELDEYQTPDGRPGASILIFGVSR
D2R5E2_PIRSD      VIITAHDAHWLAAAIQAFTGYATSVIACDAEAGVEN-YLDSSQTPDGRVGANILLFGFSS
D5SRS8_PLAL2      LIVTAETERWVDIASVTFTGYATSVIGCDLEAGIER-KLTPDETPDGRPGVALLMFSFSR
F0SSN0_RUBBR      LIITAINQRWALTAAREATGYGTSVIACDAEAGIEQ-VLSDEETPDGRPGVAILLFAFNR
E8QZI9_ISOPI      LIVTAETAAWARIAGQTATGYATSVIACDAEAGVER-ELEPDQTPDGRPGVRLLIFALSR
FTR_RHOBA         LIVTADDRRWCDESARAMCGFGTSVIACGLEIAVEQ-TLSPEQTPDGRPGVAILAFGMSG
D8JYG4_HYPDA      IIITADTLKWARIAATVATGFGTSVIGCGAECGIDK-ELSPDETPDGRPGVRILIFGFSP
F8JBN5_HYPSM      IIITADSMKWAKIAATVATGFGTSVIGAGAECGIDK-ELSEDETPDGRPGVRILIFGFSP
B0UF30_METS4      LVLTADTPEWAMIAATTMTGFATSVIGCGAEAGIDA-VLAPEATPDGRPGVRVLLFGFDA
B8ITW7_METNO      LVLTAETPEWAMIAATTMTGFATSVIGCGAEAGIDA-VLGPEATPDGRPGVRVLVFGFDA
B1LV90_METRJ      IIVTNDTAKWAMIAATTMTGFATSVIGCGAEAGIDA-ELSPEETPDGRPGVRILLFGFEP
B1ZIB9_METPB      IIVTNDTPKWAMIAATVMTGFATSVIGCGAEAGIDA-ELSPEETPDGRPGVRILLFGFEP
FHCD_METEA        IIVTNDTPKWAMIAATVMTGFATSVIGCGAEAGIDA-ELSPDETPDGRPGVRILLFGFEP
A9W3R8_METEP      IIVTNDTPKWAMIAATVMTGFATSVIGCGAEAGIDA-ELSPDETPDGRPGVRILLFGFEP
B7KXD3_METC4      IIVTNDTPKWAMIAATVMTGFATSVIGCGAEAGIDA-ELSPDETPDGRPGVRILLFGFEP
C7CBT1_METED      IIVTNDTPKWAMIAATVMTGFATSVIGCGAEAGIDA-ELSPEETPDGRPGVRILLFGFEP
E8TE70_MESCW      IVITAPSRKWARQAAITMTGFATSVIGCGCEAAIDL-DLPPSATPDGRPGCRVMIFAMGT
Q1YFY4_AURMS      IQVTADSEKWAMEAARSFTGFATSVIACGCEAGIDR-VVPASETRDGRPGVRILLFSMDK
B8EKG2_METSB      IIITAPNLKWARQAAVTMTGFATSVIGCKVEAGIDR-DAPESETPDGRPGVRVLMFSMST
J7QQ18_METSZ      ILITAPNAKWARQAALTMTGFATSVIGCGCEAGIDR-EVPPEETPDGRPGVRALLFAMSS
G7ZBU3_AZOL4      LVITADTPAWVDAATSSLTGFATSVIGCGCEAAVER-LLTPEETPDSRPGAAVMIFGMST
G7ZAY1_AZOL4      LIVTADTLAWARHAGMAATGFATSVIACGCESGIER-ELSPDETPDGRPGVALLFFATGR
A7IG96_XANP2      LIITADTPRWAHTAAASLTGFATSVIGCGCEAAIER-QLAPDETPDGRPGYAVLIFAMSL
D7A5G4_STAND      LIVTADTPDWALTAGRVTTGFATSVIGCGCEAGIER-VLAPEETPDGRPGVSLLIFAMDF
D7DPS3_METV0      VIITAQNLKWAYHAANAMTGFATSVIGCGVEAGIER-EMTEDETPDGRPGVSILMFAMGS
C6WV19_METML      VIITAQNLKWAYHAANAMTGFATSVIGCGVEAGIER-ELSTKETPDGRPGVSILMFAMGS
C6XDX8_METGS      VIITAQNLKWAYNAAQAMTGFATSVIACGVEAGIER-ELTPEETPDGRPGVSVLMFAMGS
I1XFH4_METNJ      IIITAQNLEWAMHSATAFTGFATSVIACGCEASIER-TLEPSETPDGRPGVACLIFAMGG
I1YJL0_METFJ      IIITAQNTEWAMNSAVAFTGFATSVIACGCEAAIER-TLTPSETPDGRPGVACLIFAMGG
G0A464_METMM      AIITAQNEKWAMISAQAMTGFATSVIACGCEAGIER-VMSPEETPDGRPGVSIMIYAMGA
G4SVI6_META2      AIITAQNEKWAMISAQAMTGFATSVIACGCEAGIER-VLDPSETPDGRPGVSVMIFAMGG
FTR_METCA         VIVTAQNLKWAHHAAQAMTGFATSVIACGCEAGIER-ELDPAETPDGRPGVSALLFAMGG
D5C447_NITHN      VIITAQNLKWAHHSAQAMTGFATSVIACGCEAGIER-ELDPSETPDGRPGVAVLVFAMGG
B2JX59_PARP8      LVITAHTPRWARAAADSLTGFATSVIDCGCEAGIEH-DIPADATPDGRPGISVLMFAVSS
D5WEG1_PARAM      LVITAHTPTWAMHAANSLSGFATSVIGCGCEAGIER-TLAPEATPDGRPGVAVLLFAVST
Q13QW1_PARXL      LVITAHTPAWAMHAANSLTGFATSVIGCGCEAGVER-MLPAGQTPDGRPGVTVLLFAVSS
E1TEU1_BURSG      LVITAHTPAWAMNAAHSLTGFATSVIGCGCEAGVEC-TLEREQTPDGRPGVAVLLFAVSS
B2JVM0_PARP8      LIVTARDATWARNAALAATGFATSVIACGCEAGIER-ELSPDETPDGRPGVALLLFSMSG
A2SJ40_METPP      LVITAHNLEWARHAAVATTGFATSVIACGCEAGIER-ELSPEETPDGRPGIAILIFSMSG
I0HWJ0_RUBGI      IVVTAHTPHWAEQAGLAATGFATSVIGCGCEAGIER-RLSPDETPDGRPGVALLFFAMSG
B1Y0X7_LEPCP      LIITAHNPTWARHAAVAATGFATSVIACGCEAGIER-ELPPDETPDGRPGIAILIFSMSG
C5CPU5_VARPS      ILVTAHNMAWARHAAVSATGFATSVIACGCEAGIER-EILPDESPDGRPGVSVLIFSMSG
                    :*         :     *:. * * .  * .::        : * * *          

E1RKI3_METP4      KSMKENVAARISQCVLTAATASAFDGF-P-----D---AAG-------TR---FHI--KM
Q2NE82_METST      KQVEQQLLERIGQCVLTTATTSVFNLL-P-----D----CD-------NN---TNLGFKL
FTR_METKA         DELKEQLLDRIGQCVMTAPTASAFDAM-P-----E--AEKE-------DE---DRVGYKL
Q0W8U1_METAR      DHVKEQLVERLGECVLTAPTTAIFNWL-PFERMED----KT-------LE---KKVDVKL
D1YXD3_METPS      DKLKEQLIERLGECVLTAPTAAAFNWL-PFERLED----KT-------QE---KRLDVKL
H8I4R1_METCZ      DKLKEQLIERIGECVLTAPTTAVFNWL-PFERLPD----KT-------QE---KRIDVKL
B8GE36_METPE      KKLKEQLIERIGECILTAPTTAAFNGL-P-----G----AE-------EK---IPV--KL
Q2FKY6_METHJ      KKVPEQVMERIAECVLTAATTSVFNGM-P-----D----AE-------EK---FDI--KI
E1REI3_METP4      KKLKEQVVERLAECVLTQPTTAVFDGM-P-----E----AE-------ER---IDV--KL
A3CT61_METMJ      KKLKEQVVERLAECVLTAPTTAVFDGL-S-----DVVAEVP-------EK---LPV--KL
A7I5V0_METB6      KKLKEQVVERLAECVLTAPTTAVFNGI-T-----D----AE-------EK---IPV--KL
F4BTC4_METSG      KNLENSLLMRLGQCVLTAPTAAAFSGM-H-----D----AE-------KQ---FDTGKKL
A0B9N6_METTP      KSLETSLLARIGQCVLTAPTTAVFNGL-P-----E----AE-------KQ---FDTGKKL
G7WRA5_METH6      KNLEASLLARIGQCVLTAPTTAVFNGL-P-----E----AE-------KQ---FDTGAKL
A6UQQ1_METVS      AELEHQLLERIGQCVLTAPTTAVFDAMGE-----D----AT-------EQ---LKVGFKL
A9A952_METM6      AELEHQLLERIGQCVLTAPTTAVFNAMGE-----D----AT-------EE---LKVGFKL
A6VHJ8_METM7      AELEHQLLERIGQCVLTAPTTAVFNAMGE-----D----AT-------EE---LKVGFKL
A4G0W2_METM5      AELEHQLLERIGQCVLTAPTTAVFNAMGE-----D----AT-------EE---LKVGFKL
Q6LWU5_METMP      AEIEHQLLERIGQCVLTAPTTAVFNAMGE-----D----AT-------EE---LKVGFKL
F8AN94_METOI      SELEHQLLERLGQCVLTAPTTAVFDAMGE-----D----AD-------EQ---LKVGFKL
A6UTJ4_META3      SALEHQLLERLGQCVLTAPTTAVFDAMGE-----D----AT-------EH---LKVGFKL
D7DQM5_METV3      SGLEHQLLERLGQCVLTAPTTAVYDAMGE-----D----AE-------EQ---LKVGFKL
F6BCN6_METIK      SELEHQMLERIGQCILTAPTTAAFDAMGD-----E----AE-------EQ---LKVGFKL
D5VSI1_METIM      KGLEEQMLERIGQCVLTCPTTAVFDAM-E-----E----ED-------EK---VKVGFKL
C7P952_METFA      SELEHQMLERLGQCVLTCPTTAIFDAMGD-----K----AE-------EQ---LKVGFKL
D3S4K6_METSF      AELEHQMLERLGQCVLTCPTTAIFDAMGD-----K----AD-------EQ---LKVGFKL
C9RFK4_METVM      AELEHQMLERLGQCVLTCPTTAIFDAMGD-----K----AD-------EQ---LKVGFKL
FTR_METJA         SELEHQMLERLGQCVLTCPTTAIFDAMGD-----M----AD-------EQ---LKVGFKL
FTR_METFV         KKLDHELLERVGMTILTAPTAAAFDAL-E-----N----AE-------EK---VNTGFKL
FTR_METTH         KSLDHELLERIGMGILTAPTTAVFDAL-D-----D----ED-------EK---LNIGFKL
D9PYC7_METTM      KNLDHELLERIGMGILTAPTTAVFDAL-D-----D----ED-------EK---LNVGFKL
F0T892_METLA      DKLDHELLERVGMCILTAATTAVFDWL-D-----E----PD-------EK---LKTGQKL
F6D426_METPW      KKLDHELLERIGMCILTAATTAVFDAM-E-----D----AD-------EK---FKTGHKL
D3E0E8_METRM      KALDHELMERIGMCVLTAPTAAAFNLL-------E----SE-------DE---LKTAFKL
A5UM69_METS3      KQLDHELLERIGMCILTAPTTAAFNVL-D-----D----AD-------EE---LKTGFKL
D7EBE7_METEZ      KDLEDQVLKRLGQCVLTAPTTAVFNGL-L-----E----AK-------KQ---FDTGYKL
FTR_METBF         EALEEQLLERIGQCVLTAPTTAVFNGL-P-----E----AE-------KQ---FNVGFKL
FTR_METAC         EALEEQLLERIGQCVLTAPTTAVFNGL-P-----D----AE-------KQ---FNIGFKL
FTR_METMA         EALEEQLLERIGQCVLTAPTTAVFNGL-P-----D----SE-------KQ---FNVGFKL
F7XL43_METZD      KSLEEQLLERLGQCVLTAPTTAMYNGL-P-----D----AE-------KQ---FDTGFKL
D5E8Y9_METMS      KSLEEQLLERLGQCVLTAPTTAMFNGL-P-----D----AE-------KQ---FDTGFKL
F2KML2_ARCVS      KTLEQQLIARIGQCILTAPTARAFDAL-P-----D----AE-------ER---FDTGNKL
FTR_ARCFU         KGLEEQLLARLGQCVLTAPTTAVFNGL-P-----D----AE-------EK---FDTGFKL
D3RYB3_FERPA      KGLEEQLLARLGQCVLTAPTTAVFNGL-P-----D----AE-------EK---FDTGNKL
E4RM60_HALHG      DNLQKELRKRIGQTIMTAATAACYNGL-------K----SQ-------EE---IKVGSNI
I4BWV4_ACEMN      SGLESQLISRVGQSIMTCPTTACYNDL-------D----DG-------EQ---VDVGGKL
D2R5E2_PIRSD      DALGKAVTNRAGQCLMTCPSTAVFSGL-------S----GT-------ET--SLPLGKHL
D5SRS8_PLAL2      DQLAKAVLNRVGQCLLTCATTAVFDGW-------P----QG-------DPQKRIPLGDGL
F0SSN0_RUBBR      EALGKAIVKRIGQCVLTCATAAVFDGA-------P----ET-------EKDRRLPLGKQL
E8QZI9_ISOPI      DALEKALVKRVGQCVMTCPTTACYNDW-------P----LD-------DR--AIVVGGKL
FTR_RHOBA         KDLEKQIPRRAGQCVLTCPTTALYGGI-------P----GGREVHP--KR---VPIGKSL
D8JYG4_HYPDA      DALIPQIRNRIGQCVLTSPGSACFSGL-------K----AA-------QS---LGLGKAP
F8JBN5_HYPSM      DALLPQVRNRIGQCVLTSPGSACYAGL-------K----AE-------KT---MPLGKGT
B0UF30_METS4      GGLKSQLLKRVGQCVLTSPGSAAYAGIAW-----D----DP-------HRGKAIKLGGAI
B8ITW7_METNO      GGLKTQLLKRVGQCVLTSPGSAAYAGIAW-----D----DP-------NRGKAIKLGGAI
B1LV90_METRJ      NGLKDQLIKRVGQCILTCPGTACYAGV-------D----GP-------TK---IKLGGAI
B1ZIB9_METPB      NGLKDQLLKRVGQCILTCPGTACFAGV-------D----GP-------HK---IKLGGAI
FHCD_METEA        NGLKDQLLKRVGQCILTCPGTACFAGV-------E----GP-------TK---IKLGGAI
A9W3R8_METEP      NGLKDQLLKRVGQCILTCPGTACFAGV-------E----GP-------TK---IKLGGAI
B7KXD3_METC4      NGLKDQLLKRVGQCILTCPGTACFAGV-------E----GP-------TK---IKLGGAI
C7CBT1_METED      NGLKDQLLKRVGQCILTCPGTACFAGV-------E----GP-------TK---IKLGGAI
E8TE70_MESCW      DELQKQLLNRVGQCVLTSPGSACFAGL-------Q----GS-------AE---LKLGSAL
Q1YFY4_AURMS      DGLAKQLGTRLGQCILTSPSSACYADF-------D----SE-------TQ---IDLGSAI
B8EKG2_METSB      DMLQTQLVTRAGQCVLTSPGSACFNDL-------D----AP-------DR---MPIGDQL
J7QQ18_METSZ      KDAEKQLVNRLGQCVLTCPGSAVYSTV-------A----GE-------FE---IKVGDAV
G7ZBU3_AZOL4      GDLAKHVVNRVGQCVMTSPGSACYAGLL------D----GA-------KR---ILLGGGL
G7ZAY1_AZOL4      SVLGKQVETRLGQCILTCPGTACFSGV-------P----RG-------AKEDLIPLGRKL
A7IG96_XANP2      KDLKKVVPLRAGQCVLTSPTSACYSGL-------E----GG-------AA---IALGRAL
D7A5G4_STAND      KQLKTVVPLRLGQCILTCPTTACYAGV-------E----TG-------KR---VPLAKTI
D7DPS3_METV0      KVLMQQLETRMGQCILTCPTAAAFSGI-------D----SD-------EK---INLGKNL
C6WV19_METML      KVLMQQLETRMGQCILTCPTAAAFSGI-------D----GE-------DK---ISLGKHL
C6XDX8_METGS      AVLMKQLETRMGQCVLTCPTAAAFSGL-------E----GG-------DR---INLGKNL
I1XFH4_METNJ      KGLAKQVETRAGQCVLTSPTSALFSGIEG-----E----EG-------KE---IALGKNL
I1YJL0_METFJ      KGLAKQVETRAGQCVLTAPTTALFAGIAG-----E----EG-------KE---IALGKNL
G0A464_METMM      KGLAKQLETRAGQCVLTSPTSALFAGI-------E----GG-------KP---IPLGKNL
G4SVI6_META2      KGLAKQLETRAGQCVLTSPTSALFAGI-------E----SD-------KP---IPLGKNL
FTR_METCA         KGLAKQLETRAGQCVLTSPTSALFAGI-------V----EG-------EQ---IPLGKNL
D5C447_NITHN      KGLAKQLETRAGQCVLTSPTSALFAGI-------H----EG-------EA---LPLGKNL
B2JX59_PARP8      KELAKQITRRVGQCVLTCPTTAVYNGI-------D----PATTRSPLSDV---APLGGSL
D5WEG1_PARAM      KELAKQIGRRVGQCVLTCPSTAVYSGI-------D----PATSRAPLSDP---APLGSGL
Q13QW1_PARXL      KELAKQIERRVGQCVLTCPTTAVYGGI-------D----AGTSRAPLSDR---APLGSAL
E1TEU1_BURSG      KELAKQIERRVGQCVLTCPTTAVYRGI-------D----PQTSRAPLSDL---APLGKNL
B2JVM0_PARP8      KELAKQVERRVGQCVLTCPTTAVFSGI-------E----NG-------EP---IALGRNL
A2SJ40_METPP      RELAKQVEKRVGQCVLTCPTTAVYAGL-------F----EG-------DA---IALGKNL
I0HWJ0_RUBGI      KELAKQLERRVGQCILTCPTTAVYSGL-------A----DD-------EP---VALGRNL
B1Y0X7_LEPCP      KELAKQIERRVGQCVLTCPTTAVFSGI-------A----EG-------EA---VPLGKNL
C5CPU5_VARPS      KELGKQLERRVGQCVLTCPTTAVFAGL-------P----RG---APGSDV---AALGKNL
                        :  * .  ::* . :  :                                    

E1RKI3_METP4      HYFGDSYESRCTV----GG-----RKCWKIPVMEGDYTGEESFGAVK-GIAGGNFLIMGK
Q2NE82_METST      AFFADGYQEKVEK----YG-----KTLYKIPIMSGDFLIEEDFGITN-AVAGGNLFIMAK
FTR_METKA         SFFGDGYQEEDEL----DG-----RKVWKIPVVEGEFIVEDSFGITT-GVAGGNFYIMAE
Q0W8U1_METAR      HFFGDGFESKQVV----GG-----RNVYAIPIMEGDFICEEEYGVQK-GVAGGNFFIMAE
D1YXD3_METPS      HFFGDKFEYQTEV----GG-----RKVWAIPIMNGDFIVEEEYGYKK-GVGGGNFFIMGE
H8I4R1_METCZ      HFFGDKFEYQTKV----GD-----RNVWAIPIMGGEFICEEEYGYKK-GVAGGNFFVMGE
B8GE36_METPE      HFFGDGYEYQQKV----GD-----RDCWAIPLMGGEFIIEEEYGAVK-GVAGGNFFVMGE
Q2FKY6_METHJ      HFFGDKFESKVEI----GG-----RQCWKIPIMEGDYVGEEVFGMVK-GVAGGNFFVMAD
E1REI3_METP4      HFFGDGYEYQKEV----GG-----RNCWAIPIMNGEYIGEENFGIVK-GIAGGNFFIMGE
A3CT61_METMJ      HFFGDGYEEKREV----GG-----RTVWAIPIMEGEYIGEEEFGAVK-GVAGGNFFIMGE
A7I5V0_METB6      HFFGDGYEYQKEV----GG-----RKCWVIPIMNGEYVGEEEFGIVK-GVAGGNFFIMGE
F4BTC4_METSG      SFFGDGYQKTEEM----FG-----RNIWKILLMSGDFIIENSFGAVE-GIAGGNFLILGQ
A0B9N6_METTP      GYFGDGYQCEIKY----CN-----RNFCKIPIMEGDFLVEETIGAVD-GIAGGNFYILGQ
G7WRA5_METH6      KFFGDGFQKEMAY----CD-----RGVCSIPVMSGDFIVEEKMGAVD-GIAGGNFYIMAE
A6UQQ1_METVS      KFFGDGYEKKVNCEE--CG-----KTLYSVPIMGGDFLIEGNFGIKK-GVAGGNFFIMAE
A9A952_METM6      KYFGDGYEKKVTCEE--CG-----KTLYSVPIMGGDFLIEGKLGIKK-GVAGGNFFIMAD
A6VHJ8_METM7      KYFGDGYEKKVTCEE--CG-----KTLYSVPIMGGDFLIESKLGIKK-GVAGGNFFIMAE
A4G0W2_METM5      KYFGDGYEKKVKCEE--CG-----KTLYSVPIMGGDFLIESKLGIRK-GVAGGNFFIMAE
Q6LWU5_METMP      KYFGDGYEKKVKCEE--CD-----KTLYSIPIMGGDFLIESKLGIKK-GVAGGNFFIMAE
F8AN94_METOI      KFFGDGYEKKDKV----GE-----RTVYKIPIMGGEFIVENKLGVKK-GVAGGNFFIMAD
A6UTJ4_META3      KFFGDGYETKEKL----ND-----KVMYSVPIMGGDFKIESKLGIKK-GVAGGNFFIMAD
D7DQM5_METV3      KFFGDGYETKEKTE---EG-----KVIYSVPIMGGDFKIESKLGIKK-GVAGGNFFIMAD
F6BCN6_METIK      KFFGDGYEKKDKL----GD-----RTIYRIPIMSGEFITESKFGVKK-GVAGGNFFILAE
D5VSI1_METIM      KFFGDGFEKKDEL----NG-----RKIYRIPIMGGEFITESSFGIKK-GVAGGNFFIMAD
C7P952_METFA      KFFGDGYEKKDEM----YG-----RKVYRIPIMGGEFITEAKFGIKK-GVAGGNFFIMAD
D3S4K6_METSF      KFFGDGYEKKDEL----YG-----RKVYKIPIMGGEFITEVKFGIKK-GVAGGNFFIMAD
C9RFK4_METVM      KFFGDGYEKKDEL----YG-----RKVYKIPIMGGEFITEAKFGIKK-GVAGGNFFIMAD
FTR_METJA         KFFGDGYEKKDEL----YG-----RKVYKIPIMGGEFITEAKFGIKK-GVAGGNFFIMAD
FTR_METFV         KFFGDGYEKEGEV----QG-----RKVHIIPIMSGEFIVEEKFGIKS-GVAGGNFFIMAE
FTR_METTH         KFFGDGYEKELEI----DG-----RKIHSIPIMSGDFLIESEFGIKD-GVAGGNFFIMGD
D9PYC7_METTM      KFFGDGYEKELEI----DG-----RKIHSIPIMSGDFLIESEFGIKD-GVAGGNFFIMGD
F0T892_METLA      KFFGDGYEQTIDV----EG-----RKVHSIPLMSGDFCVEAELGIKA-GVAGGNFFILAE
F6D426_METPW      KFYGDGYEKVLDI----DG-----RKIHSIPLMSGDFLVESELGIKA-GVAGGNLFILAE
D3E0E8_METRM      KYFGDGFEKDCCI----DG-----RKVHSIPIMSGDFIVESTFGFKA-GVAGGNFFILAK
A5UM69_METS3      KFFGDGFEDELEI----DG-----RKMHSIPIMSGDFLVESTFGFKA-GVAGGNFFILAE
D7EBE7_METEZ      KFFGDGMESETQI----LD-----RKMYSIPIMEGDFLIEESIGAVE-GVAGGNFFIFGD
FTR_METBF         KFFADGMESETQI----AG-----RKVYKVPIMEGDFLAEENIGAIA-GIAGGNFFIFGD
FTR_METAC         KFFGDGMESEAQV----AG-----RKVYKVPIMEGDFVTEENIGAIA-GIAGGNFFIFGD
FTR_METMA         KFFGDGMESEAQI----AG-----RKVFKVPIMEGDFVTEDNIGAIA-GIAGGNFFIFGD
F7XL43_METZD      KFFADGMESEDEM----NG-----RKVYRIPLMEGDFIAEHSVGAVE-GVAGGNFFILGD
D5E8Y9_METMS      KFFADGTESETEV----GG-----RKAYKIPMMEGDFITEHSMGGVK-GVAGGNFFIFGD
F2KML2_ARCVS      RYFGDGFEKQLEI----GD-----RKVWAIPIMEGDFIVENDFGVVQ-GVAGGNFFIMGE
FTR_ARCFU         KFFADGYEKEVEV----GG-----RKCWAVPMMEGDFIIENDIGYTN-GIAGGNFFIMAE
D3RYB3_FERPA      RFFGDGYEKQVDL----YG-----RKMWAVPMMEGDFLIENEIGYVN-GIAGGNFFILGE
E4RM60_HALHG      RYFGDGYQISKLY----DK-----RRFWRIPIMGGEFLIEESFGIKK-GLGGGNIIIVAE
I4BWV4_ACEMN      KFFGDSYQASKML----GK-----RRFWRIPVMDGEFLVEQKFCIKK-GVGGGNLLIISK
D2R5E2_PIRSD      RFFGDGFQKSKQI----AG-----RRYWRIPVMEGEFLIEESVGVER-GVAGGNFILQAT
D5SRS8_PLAL2      RYFGDGYQMSKML----GD-----QRYWRIPVMDGEFVCEDSIGTGK-GVAGGNLIFGGT
F0SSN0_RUBBR      RYFGDGFQASKVI----GT-----TRYWRIPVMEGEFLCADMAGSFR-GIAGGNLLIGGQ
E8QZI9_ISOPI      RYFGDGWQIAKLV----GE-----RRFWRMPTMDGEFACEERFGTLK-GVAGGNLLFQGT
FTR_RHOBA         RYFGDGNQISKQIQHLDADGRSRPVRYWRIPVMDGEFVCQHDVGRVD-AIGGGNFILVGR
D8JYG4_HYPDA      RYFGDGYQTSKKL----GD-----SRYWRVPVMDGEFVIEEETGVTTEAVGGGNMLILGT
F8JBN5_HYPSM      RLFGDGYQTAKKL----GD-----SRYWRVPVMDGEFIIEEDTGVTTDAVGGGNMLIVGR
B0UF30_METS4      QMFGDGFSVAKRV----GG-----RRFWRTPVMDGEFLCEHSVPTIEGAVGGGNLLFLGR
B8ITW7_METNO      QMFGDGFAVAKRF----GG-----RRFWRTPVMDGEFLCEHSVPTIEGAVGGGNLLFLGR
B1LV90_METRJ      RYFGDGFAVAKRL----HDATGKARRYWRIPVMDGEFLCEDAVRAVDGAVGGGNLLFLGR
B1ZIB9_METPB      RYFGDGFAVAKRL----PDPQGKMRRYWRIPVMDGEFLCEDSTRAVDGAVGGGNLLFLGR
FHCD_METEA        RYFGDGFAVAKRL----PDHEGKMRRYWRIPVMDGEFLCEDSVRAVDGAVGGGNLLFLGR
A9W3R8_METEP      RYFGDGFAVAKRL----PDHEGKMRRYWRIPVMDGEFLCEDSVRAVDGAVGGGNLLFLGR
B7KXD3_METC4      RYFGDGFAVAKRL----PDHEGKMRRYWRIPVMDGEFLCEDSVRAVDGAVGGGNLLFLGR
C7CBT1_METED      RYFGDGFAVAKRL----PDHEGKMRRYWRIPVMDGEFLCEDSVRAVDGAVGGGNLLFLGR
E8TE70_MESCW      RYFGDGWQISKKI----GD-----RHFWRIPVMDGEFLCEATTGLTKEAVGGGNFFVMAQ
Q1YFY4_AURMS      RYFADGWQISKKF----SG-----RHFWRMPVMEGEFLCEATTGMTGDGVGGGNLLFMAR
B8EKG2_METSB      RYFGDGWQISKKF----LG-----RHFWRVPVMDGEFLCEGTVGLTKKAVGGGNLLVMGA
J7QQ18_METSZ      RQFGDKWQMSKVV----DG-----RRYWRVPVMDGEFFCEGKVGLTKKSVGGGNLLIMGA
G7ZBU3_AZOL4      RYFGDGHQIAKKF----GD-----RRFWRLPVMDGEFVCEDSVAVGK-GIGGGNFLILAA
G7ZAY1_AZOL4      RYFGDGQQMSKLL----GG-----RRYWRIPVMDGEFLCEESSWSVP-AVGGGNLLILAD
A7IG96_XANP2      RYFGDGYQIAKSI----DG-----RRFWRIPVMEGEFVCDEVVGSTTAAVGGGNFLILAR
D7A5G4_STAND      RYFADGHQISKKI----GD-----KRFWRLPVMEGEFVCDEDTGSVE-GVGGGNILILAR
D7DPS3_METV0      RFFGDGFQTSKLI----SA-----KRYWRVPVMDGEFLCEETTGMVR-AIGGGNFLILAT
C6WV19_METML      RYFGDGYQTSKLI----DG-----KRYWRIPVMDGEFITEETTGMVR-AIGGGNFLILAT
C6XDX8_METGS      RFFGDGFQTSKVF----GG-----KRYWRVPVMDGEFMTEETTGMVR-AVGGGNFLILAE
I1XFH4_METNJ      RFFGDGYQISKMI----DG-----KRYWRIPVMDGEFLTQENTGVVS-SVGGGNFLILAE
I1YJL0_METFJ      RFFGDGFQISKMI----DG-----QRYWRIPVMDGEFLTQENTGVVS-AVGGGNFLILAE
G0A464_METMM      RYFGDGFQIAKKI----GG-----KRYWRVPVMDGEFLTEATTGMVE-AVGGGNFLVLAE
G4SVI6_META2      RYFGDGFQISKVI----GG-----KRYWRVPVMDGEFLTEATTGQVD-AVGGGNFLVLAE
FTR_METCA         RYFGDGFQISKRI----GG-----KRYWRIPVMDGEFLCQETTGMIK-AVGGGNFLILAE
D5C447_NITHN      RFFGDGFQISKLI----NG-----RRYWRVPVMDGEFLTEETVGMIP-AIGGGNFLVLAQ
B2JX59_PARP8      RFFGDGWQISKVL----GG-----VRYWRVPVMDGEFVCEESVQTVK-AVGGGNLLLLAR
D5WEG1_PARAM      RFFGDGWQIAKMIDTGNGP-----TRYWRVPVMDGEFVCEDTAATVK-AVGGGNLLLLAR
Q13QW1_PARXL      RFFGDGWQISKML----GD-----TRYWRVPVMDGEFVCEDTALTVK-AVGGGNLILLAR
E1TEU1_BURSG      RFFGDGWQISKML----GD-----TRYWRVPVMDGEFVCEETAPTVK-AVGGGNLILLAR
B2JVM0_PARP8      RFFGDGWQIAKMI----DG-----KRFWRVPVMDGEFVAEETTSVLK-GVGGGNLLFLAR
A2SJ40_METPP      RFFGDGWQTSKVI----GG-----QRYWRVPVMDGEFVAQETTWVTTQAVGGGNLLLLAT
I0HWJ0_RUBGI      RFFGDGWQIAKQI----GG-----QRFWRVPVMDGEFVAQESTPVVK-AVGGGNLLLLAR
B1Y0X7_LEPCP      RFFGDGWQTSKLI----AG-----QRYWRVPVMDGEFVAQETTAVIK-GVGGGNLLLLAR
C5CPU5_VARPS      RFFGDGWQISKVI----DG-----VRYWRVPVMDGEFVAEEDTPVVK-AVGGGNLLLLAR
                    :.*                           : *::           .:.***: . . 

E1RKI3_METP4      NKESALSAAQAAIEAIR-NREGIITGFPGGIVASGSKVASK--NY-RFPMSASTNHRLCP
Q2NE82_METST      TQQSALVAAEAAVNAIK-EISGVICPFPGGIVASGSKVGSK--KY-KF-MNATTNEGYCP
FTR_METKA         SQPAGLQAAEAAVDAIK-GVEGAYAPFPGGIVASASKVGSK--QY-DF-LPASTNDAYCP
Q0W8U1_METAR      TQGSALMAAQAAVDAIN-QVEGCILPFPGGIVASGSKVGSL--KYSKF-MKASTNHRMAP
D1YXD3_METPS      TQGSALMAAQAAVDAIS-HVEGCITPFPGGIVASGSKVGS---KY-KF-MKASTNEKMAP
H8I4R1_METCZ      TQGSALMGAQAAVDAIA-QIEGCITPFPGGIVSSGSKVGS---KY-KF-MKASTNEKMAP
B8GE36_METPE      NQMAALVGAQAASDAIS-GVEGAITSFPGGIVASGSKVGSK--KY-KF-MNASTNEAYCP
Q2FKY6_METHJ      NQMTALMGAKAAADAIF-EVKGTITSFAGGIVASGSKVGSK--NY-KFPIPATTNEQYCP
E1REI3_METP4      NIPAALMAADAAVAAIR-NVPGCMCSFP--IVASGSKVGSN--KY-KF-MAASTNEKYCP
A3CT61_METMJ      NQMAALTAAQAAVDAIS-GVCGVITPFPGGIVASGSKVGSN--KY-KF-MGASTNEAYCP
A7I5V0_METB6      NQMAALVAAEAAVDAID-EVKGVITSFPGGIVASGSKVGSL--KY-KF-MPASTNEKYCP
F4BTC4_METSG      NQMSGLMAAEAAIDSIR-KVKGAITPFPGGVVSSGSKVGS---KY-KF-LKASTNSAFCT
A0B9N6_METTP      NQPAALMAAEAAVDAIS-KLRGTITPFPGGVVASGSKVGS---RY-KF-LKASTNVAFCP
G7WRA5_METH6      NQAAALMAAEAAVDAIR-EEEGTITPFPGGVVASGSKVGS---RY-KF-LKASTNERFCP
A6UQQ1_METVS      NNTAALVAAEVAVDAIS-MVEKTITPFTGGIVASGSKVGYTNPKY-SF-MAATTNEKMCP
A9A952_METM6      SNMSALVAAEAAVDAIS-QVEKTITPFTGGIVASGSKVGYTNPKY-SF-MAATTNEKMCP
A6VHJ8_METM7      NNMAALMGAEAAVDAIS-QVEKTITPFTGGIVASGSKVGYTNPKY-SF-MAATTNEKMCP
A4G0W2_METM5      NNMAALMAAEAAIDAIN-AVEKTITPFTGGIVASGSKVGYTNPKY-SF-MAATTNEKMCP
Q6LWU5_METMP      NNMAALMAAEAAVDAIS-EVEKTITPFTGGIVASGSKVGYTNPKY-SF-MAATTNEKMCP
F8AN94_METOI      SNMTALTAAEAAIDAIN-TVEKTITPFPGGIVASGSKVGYTNPKY-KF-MVATTNHKMCP
A6UTJ4_META3      SNSSALVAAEAAIDAIN-GVEKTITPFPGGIVASGSKVGYTNPKY-SF-MAATTNQKMCP
D7DQM5_METV3      SNMSALNAAEVAVDAIY-NVEKTITPFPGGIVASGSKVGYTNPKY-SF-MAATTNEKMCP
F6BCN6_METIK      NQTAALVAAEAAVDAIS-SVDGVITPFPGGIVASGSKVGASNPKY-KF-MTATTNHKMCP
D5VSI1_METIM      TNATALMAAEAAVNAIQ-SVDKVITPFPGGIVASGSKVGASNPKY-KF-MVATTNHKMCP
C7P952_METFA      TNASALIAAEAAVNAIA-SVEGVITPFPGGVVASGSKVGASNPKY-KF-MVATTNHKMCP
D3S4K6_METSF      TNASALIAAEAAVDAIA-SVDGVITPFPGGVVASGSKVGASNPKY-KF-MVATTNHKMCP
C9RFK4_METVM      TNATALIAAEAAVNAIA-SVEGAITPFPGGVVASGSKVGASNPKY-KF-MVATTNHKMCP
FTR_METJA         TNASALIAAEAAVNAIA-SVDGVITPFPGGVVASGSKVGASNPKY-KF-MVATTNHKMCP
FTR_METFV         TQGSALLAAEMAVDAIK-SVEGVMTPFPGGIVASGSKVGSK--KY-DF-LDASTNEKMCV
FTR_METTH         SQASALLAAQAAVDAIA-AVEGTVTPFPGGVVASGSKVGSN--KY-KF-LNASTNEKMCV
D9PYC7_METTM      SQASALLAAQAAVDAIA-AVEGTVTPFPGGVVASGSKVGSN--KY-KF-LNASTNEKMCV
F0T892_METLA      NQPAGLLAADAAVDAIE-AVPGAITPFPGGIVASGSKVGSN--KY-KF-LGASTNEKMCV
F6D426_METPW      NQPAGLLAADAAVDAIK-AVPGAITPFPGGIVASGSKVGSN--KYSKF-LNASTNEKMCV
D3E0E8_METRM      DQITGVKAAQMAVAAIR-NIPGTITPFPGGMVASGSKVGSN--KY-SF-LPASTNEKMCV
A5UM69_METS3      NQMAGVMAAEAAVDAIS-AVEGVITPFPGGMVASGSKVGCN--NY-KF-LNASTNEKMCV
D7EBE7_METEZ      SQMSALNAAQSAVEAIN-KVEGTITPFPGGIVASGSKPGAN--KY-TF-LKATANEKYCP
FTR_METBF         SQMTALTAAEAAVDTIA-ELEGTITPFPGGIVASGSKSGAN--KY-KF-LKATANERFCP
FTR_METAC         SQMSALTAAEAAVDAIE-ELEGTIAPFPGGIVASGSKSGAN--KY-KF-LKATANEKFCP
FTR_METMA         SQMSALTAAEAAVDAIA-ELEGTITPFPGGIVASGSKSGAN--KY-KF-LKATANEKFCP
F7XL43_METZD      CQMSALTAAEVAVDAIQ-QTEGSITPFPGGIVASGSKPGAN--KY-KF-LKATANERFCP
D5E8Y9_METMS      CQMSALNAAEAAVEAIE-KVEGSITPFPGGIVASGSKPGAN--KY-TF-LKATANEKFCP
F2KML2_ARCVS      NQPAALAAARAAVDAIS-SVKHVITPFPGGIVASGSKVGAN--KY-KF-LKATTNERFAP
FTR_ARCFU         TQPSALAAAKAAVDAIS-DVEGVITPFPGGIVASGSKVGAN--KY-KF-LKASTNEKFAP
D3RYB3_FERPA      NQPSALAAAKAAVDAIF-EVEGVITPFPGGIVASGSKVGAN--KY-KF-LKASTNEKFAP
E4RM60_HALHG      DQKKALNAAEKAVEAMK-EVEGIIMPFPGGIVSSGSKVKS---KY-SF-LNASTNTPYCP
I4BWV4_ACEMN      DVKSGLEAAQRAVGAMK-KVPGAIMPFPGGVVRSGSKVGS---TY-RF-LSASTNTPYCP
D2R5E2_PIRSD      HLNTVLNASRAAVEAIS-KVPGVITPFPGGVARSGSKVGS---QY-KT-LRASTNELLCP
D5SRS8_PLAL2      TQAQTLLAAEEAVVAAR-SIPGVILPFPGGIVRSGSKVGS---KY-AG-LRASTNDQFCP
F0SSN0_RUBBR      TVTHALSAAEAAVEAMD-AVPGVIMPFPGGVVRSGSKVGS---RY-PA-LRASTNDAHCP
E8QZI9_ISOPI      TPTGTLEAATRAVAAIRAQCEDVILPFPGGIARSGSKVGS---KY-QM-LRASVNDAYAP
FTR_RHOBA         TMQSVTIASRAAIDAMR-ELPGIITPFPGGTTRSGSKVGS---KY-AA-LFASTNDSFCP
D8JYG4_HYPDA      DRAGLLQTAEEAVDAIA-KIDDVITPFPGGIVRSGSKVGA---KY-AG-MFASTNHAFCP
F8JBN5_HYPSM      DRKGLLETAEHAVEEIA-KIDDVITPFPGGIVRSGSKVGA---KY-AG-MHASSNDAFCP
B0UF30_METS4      AHADTLRVAEIAVAAAR-GVPDVILPFPGGIVRSGSKVGA---RT-KG-MMASTNDAYCP
B8ITW7_METNO      AFGDTLKVAEIAVAAAR-SVPDVILPFPGGIVRSGSKVGA---RT-KG-MMASTNDAYCP
B1LV90_METRJ      THAETLKVAEIAVEAAK-AVPGAILPFPGGIVRSGSKVGG---RT-KG-MMASTNDAYCP
B1ZIB9_METPB      KHADTLIVAEIAVEAAK-AVPGAILPFPGGIVRSGSKVGG---RT-KG-MMASTNDAYCP
FHCD_METEA        KHADTLIVAEIAVEAAK-AIPGAILPFPGGIVRSGSKVGG---RT-KG-MMASTNDAYCP
A9W3R8_METEP      KHADTLIVAEIAVEAAK-AIPGAILPFPGGIVRSGSKVGG---RT-KG-MMASTNDAYCP
B7KXD3_METC4      KHADTLIVAEIAVEAAK-AIPGAILPFPGGIVRSGSKVGG---RT-KG-MMASTNDAYCP
C7CBT1_METED      KHADTLIVAEIAVEAAK-AIPGAILPFPGGIVRSGSKVGG---RT-KG-MMASTNDAYCP
E8TE70_MESCW      SSASALAAAEAAVGAIG-MVPGAIVPFPGGIARSGSKIGG---KY-KG-MIASANEAYAP
Q1YFY4_AURMS      TSAQALAAAEAALEAMR-DVPGAIMPFPGGIVRSGSKVGG---KY-KG-MMASTNDAYCP
B8EKG2_METSB      NFATTMNACEHAIEAMN-AVDGAIMPFPGGIVRSGSKVGS---KY-AG-VPASTNDAYCP
J7QQ18_METSZ      DWEKTMRATEAAVSAID-DVADAIAPFPGGIVRSGSKVGS---KY-KG-MSASTNDAYCP
G7ZBU3_AZOL4      SHRQCLAAAEAAVAAIR-PLPGIILPFPGGVVRSGSKVGS---KY-KA-LIASTNTRFCP
G7ZAY1_AZOL4      ARMAALEAAEAAADAMR-AVPNVVLPFPGGVVRSGSKVGA---KY-KG-MPASTNDAYCP
A7IG96_XANP2      SRPAALAAAEAAVEAMG-QVRGAIMPFPGGVVRSGSKVGA---KY-AG-MIASTNDAYCP
D7A5G4_STAND      TRGAALRAAEAAAAAMG-KVEGVILPFPGGVVRSGSKVGS---KY-KG-LFASTNDAYCP
D7DPS3_METV0      SQPAALAAAEAAITAMK-KIPNVIMPFPGGVVRSGSKVGS---KY-KT-MFASTNDAFCP
C6WV19_METML      SQPAALAAAEVAIEAMK-KVPNVIMPFPGGVVRSGSKVGS---KY-KT-MFASTNDAFCP
C6XDX8_METGS      SQPQALAACEAAIEAMK-KIPNVIMPFPGGVVRSGSKVGS---KY-KT-LIASTNDAFCP
I1XFH4_METNJ      SQPQALAACEAAVKAMK-QLPNIIMPFPGGVVRSGSKVGS---KY-KA-LNASTNDAFCP
I1YJL0_METFJ      SQPQALAACEAAIKAMK-QIPNVIMPFPGGVVRSGSKVGS---KY-KA-LNASTNDAFCP
G0A464_METMM      SQPQALAACEAAIEEMK-KIPNVIMPFPGGVVRSGSKVGS---KY-PA-LGASTNDAFCP
G4SVI6_META2      SQPQALAACEAAIEEMR-KIPNVIMPFPGGVVRSGSKVGS---KY-KA-LGASTNDAFCP
FTR_METCA         SQPQALAACEAAIEAMR-RIPNVIMPFPGGVVRSGSKVGS---KY-KT-LPASTNDAFCP
D5C447_NITHN      SQPQALAACEAAIAAME-KIPNVIMPFPGGVVRSGSKVGS---KY-KG-LNASTNEAFCP
B2JX59_PARP8      NLDSALAGAEAAVAAMH-RLANVITPFPGGVVRSGSKIGS---KY-RG-AVASTNDAFCP
D5WEG1_PARAM      DQGAALAAAEAAVAAMR-RLPNVIMPFPGGIVRSGSKIGS---KY-AG-ATASTNDAFCP
Q13QW1_PARXL      DIDAALAAAEAAVAAMR-RLPNVIMPFPGGVVRSGSKVGS---KY-KG-ASASTNDAFCP
E1TEU1_BURSG      DMDAALAAAEAAVAAMR-RLPNVIMPFPGGVVRSGSKVGS---KY-KG-ATASTNDAFCP
B2JVM0_PARP8      DTDAALRAAQTAVRAMR-GVPNVIMPFPGGVVRSGSKVGS---KY-PA-LPASTNDAFCP
A2SJ40_METPP      DTAAALAAAEAAVAAMK-QLPNIVMPFPGGVVRSGSKVGS---KY-PT-LGASTNDAYCP
I0HWJ0_RUBGI      DTDAALVAAEAAVAAMR-RVPNVVMPFPGGVVRSGSKVGS---KY-PA-LSASTNDAFCP
B1Y0X7_LEPCP      DTDAALAAAEAAVVAMQ-RLRDVIMPFPGGVVRSGSKVGS---KY-PS-LMASTNDAFCP
C5CPU5_VARPS      DTDAALAAAEAAVAAMK-RLPNVVMPFPGGVVRSGSKVGS---RY-AN-LNASTNDAFCP
                             *              *.   . *.**              *: *   . 

E1RKI3_METP4      TLKGKIEDSLV-----PEGVNSIYEIVINGTDTGVIEAAMRDGILAAT--EKE---GIMY
Q2NE82_METST      TLKDRISDSKL-----PEDAEGVYEIVFDGLTEESISKATQVAIKAIK--TIP---GVIK
FTR_METKA         TVE----DNEL-----PEGVKCVYEIVINGLNEEAVKEAMRVGIEAAC--QQP---GVVK
Q0W8U1_METAR      TLKSKVEDTQM-----PANVNAAYEIVIDGIDEATVAKAMTVGIKAAC--TIP---GVVK
D1YXD3_METPS      SLKGKV-ESQL-----PPEAKAAYEIVIDGIDEAAVAKAMTVGIKAAC--KIP---GVVK
H8I4R1_METCZ      TLKSKVPDTQL-----PPNVNAAYEIVIDGLDEATVGKAMAAGIKAAC--HVP---GVVK
B8GE36_METPE      SLKGKVEDSKI-----PDGVNSVFEIVIDGVDAETVADAMGAGIRAAC--MIP---GVKF
Q2FKY6_METHJ      TIREKVPDTKV-----PDGVKSIYEIVINGVDEASVKKAMAAGIKAAV--KVP---GVSF
E1REI3_METP4      TIRDRVEDTKV-----PEGVKAVYEIVIDGIDEAAIKASTKAGIEAAV--KIP---GIKL
A3CT61_METMJ      TLRDKVENSKV-----PEGVKAIYELVIDGVDEDSIKTAMAEGIRAAT--RVP---GVKF
A7I5V0_METB6      TLREKVADTKI-----PAGVKAVYEIVIDGVDEKSVAAAMGAGVRAAV--KVP---GVKF
F4BTC4_METSG      SLREDG-VCVL-----AEDVSCVFEIVINGVDREAIENAMRAGIHAAC--QVP---GILK
A0B9N6_METTP      SLKEQG-VCAL-----PENVTAGYEIVINGISREAIEEAMRVGIRAAC--TVP---GVLR
G7WRA5_METH6      TLQDEG-VCIL-----PPSIRASYEVVINGVSREAIERSMRSGIMAAC--KVP---GVVK
A6UQQ1_METVS      TLKGKVEGSEI-----PEDVNGVYEIVIDGVDEASVKAAMKAGISAAV--KIP---GVKK
A9A952_METM6      TLKDTVEGSEI-----PADVNGVYEIVIDGIDEASVAAAMKAGIKAAV--TIP---GVKK
A6VHJ8_METM7      TLKDTVEGSEI-----PADVNGVYEIVIDGIDEAAVAAAMKAGIKAAV--TVP---GVKK
A4G0W2_METM5      TLKDTVEGSEI-----PADVNGVYEIVIDGIDEASVAAAMKAGIKAAV--TIP---DVKK
Q6LWU5_METMP      TLKDTVEGTEI-----PADVNGVYEIVIDGIDEASVAAAMKAGIKAAV--TIP---GVKK
F8AN94_METOI      TLKGVVEDSEV-----PEDVNGVYEIVIDGVDEEAIKEATKAGILAAT--TVK---GVKK
A6UTJ4_META3      TLKDSVEDSEI-----PADVNGVYEIVIDGVDEEAVKEATKVGILAAT--KIE---GVKK
D7DQM5_METV3      TLKDSV-ESSI-----PAEINGVYEIVIDGVDEEAVKAAMKAGIAAAT--KIP---GVKQ
F6BCN6_METIK      TLRDVVEDSEV-----PEDVNGIYEIVIDGISEEAVKEAMKVGILAAT--KVP---GVKK
D5VSI1_METIM      TLKDVVEDSEV-----PEDVNGVYEIVINGLTEDAVKMAMREGILAAT--RVK---GVKK
C7P952_METFA      TLKGVVEDSEV-----PEDVNGVYEIVIDGVDEEAVKEAMKQGILAAT--KVP---GVKK
D3S4K6_METSF      TLKGVVEDSEI-----PEDVNGVYEIVIDGVDEEAVKEAMKQGILAAT--KVP---GVKK
C9RFK4_METVM      TLKGVVEDTEI-----PEDVNGVYEIVIDGVDEEAVKEAMKQGILAAT--TVK---GVKK
FTR_METJA         TLKGVVEDSEI-----PEDVNGVYEIVIDGVDEESVKEAMKQGILAAT--RVK---GVKK
FTR_METFV         TLKDEIEDSEV-----PEDVNGIYEIVIDGIDEESVKKAMKVGIEAAC--KVP---GVKK
FTR_METTH         TLKDEVEDTQI-----PENVNGVYEIVIDGVDEEAVREAMKEGIKAAC--TVP---GIIK
D9PYC7_METTM      TLKDEVEGSEI-----PENVNGVYEIVIDGVNEEVVREAMKEGIKAAC--TVP---GIIK
F0T892_METLA      TLKDEVEGCQI-----PEDVNGVYEIVIDGVDEDAVKAAMKAGIEAAV--KVS---GIIQ
F6D426_METPW      TLKGEVEGCQI-----PEDVDGVYEIVIDGVDEAAVKAAMKAGIEAAV--KVN---GVKQ
D3E0E8_METRM      TLKDQV-DSDI-----REDAEGVFEIVIDGLDEESVKKAMKAGIVAAC--SVD---GVLE
A5UM69_METS3      TLKDKV-DSDI-----REDANGVFEIVIDGIDEESVRAAMKAGIEAAC--NVP---GVLE
D7EBE7_METEZ      SIKDKVEGSMI-----PKDVNAVYEIVINGLDTDVVSEAIETGVKAAV--TLP---GIKK
FTR_METBF         SIKDKIENTEI-----PADVNAVYEIVINGLDEESIKAAMKAGIKAAV--TVP---GVKK
FTR_METAC         SIKDKVENTEV-----PADVNAIYEIVINGLDEASIKAAMKAGIEAAV--TVP---GIKK
FTR_METMA         SIKDKVENTEI-----PADVNAVYEIVINGLDEASIKAAMKAGIEAAV--TVP---GIKK
F7XL43_METZD      SIKDKIEDTQV-----PEDVNGIYEIVINGLDVDAVSTAMAAGIKAAV--KIP---GIKK
D5E8Y9_METMS      SIRDQIEDTQI-----PEGVGAVYEIVINGVSEEAISSAMSAGIKASV--KVP---GIKK
F2KML2_ARCVS      SLKGQV-ESDV-----PEGVNAIYEIVINGLSVEAVSEAMRAGIMAAV--KVP---GIVK
FTR_ARCFU         SIRDQVEGTQI-----PEGVKAVYEIVINGLNADAIKEATRVGILAAT--KIP---GVVK
D3RYB3_FERPA      TIRDQVPDTQI-----PEGVKAVYEIVINGISVDAVKEAMRVGIEAAT--KIP---GVVK
E4RM60_HALHG      TIKAQV-ESEL-----PAEAGSVLEIVIDGLSVKAVEEAMKVGVKAAA---VQ---GVIK
I4BWV4_ACEMN      TLKRLV-KTSL-----PEEANAVYEIVIDGLDERSVRDAMGRGLLAAC--SC----DILS
D2R5E2_PIRSD      TLKGRV-ESQL-----HPDCTTALEVVIDGTTQAAVAEAMRVGMLAAA--EH----PILA
D5SRS8_PLAL2      TIGAIHKDPLL-----PEGTVAVYEIVIDGVDFDAVERSMKAAFQSLL--SVR---GLTV
F0SSN0_RUBBR      TLAPRS-ESHL-----REETGAMFEIVIDGIDETSISKAMQAGLQAAV--ATE---GVTE
E8QZI9_ISOPI      TLRGLV-ASAL-----PESVQCVYELVIDGLSFDAVAQAMRVGLTQPD--FRGL--GLAR
FTR_RHOBA         TLREVT-PSEL-----PSEANAAIEVVIDGLSFDEIAESMRVGITAAC--EAGASEGLLS
D8JYG4_HYPDA      TLRGTV-KSEL-----SADTLAVLEIVIDGLTSKSVADAMRAGLKAVT--DTGAKRGVTR
F8JBN5_HYPSM      TLRGTIKHSEV-----SPDTLAVLEIVIDGLTSKAVADAMHAGLKAVT--DVGASRGVTR
B0UF30_METS4      TLKGRA-GSAL-----PPEVNVVLEIVIDGLSAGAIARAMRAALHAAT--AAGRDLGLVA
B8ITW7_METNO      TLKGRA-GSAL-----PPEVNVVLEIVIDGLSAAAIARSMRAALHAAT--AAGGELGLVA
B1LV90_METRJ      TLKGRA-GSAL-----PAECGVVLEIVIDALTSQGVSDSMRAGLHAAT--EIGGKHGLIA
B1ZIB9_METPB      TLKGRA-GSAL-----PPECGVVLEIVIDALTSQGVAESMRAALHAAT--EIGAKYGLVA
FHCD_METEA        TLKGRA-GSAL-----PPECGVVLEIVIDALTSAAVAESMRAALHAAT--EIGAQHGLVA
A9W3R8_METEP      TLKGRA-GSAL-----PPECGVVLEIVIDALTSAAVAESMRAALHAAT--EIGAQHGLVA
B7KXD3_METC4      TLKGRA-GSAL-----PPECGVVLEIVIDALTSAAVAESMRAALHAAT--EIGAQHGLVA
C7CBT1_METED      TLKGRA-GSAL-----PPECGVVLEIVIDALTSAAVAESMRAALHAAT--EIGAQHGLVA
E8TE70_MESCW      TLRGVV-ASEL-----GPDINAVLEIVIDGETNDAVAAAMKAGIKAVI--ELGPKRGAVR
Q1YFY4_AURMS      TLKGVT-PSAL-----TPDIGSVLEIVIDGLSSQAVADAMRAGLKAAV--DLGPDKGALR
B8EKG2_METSB      TLRGVA-KSAL-----EEDIGCVLEIVIDGLDEKAVAEAMRAGLAAIV--KLGPKDGALR
J7QQ18_METSZ      TLRGVT-KSEL-----DADIGCVLEIVIDGLTDNAVREAMRAGLHAII--EMGPEQGAKR
G7ZBU3_AZOL4      TLRAVEPETLL-----TPDVEAVLELVLDGTDETAIRAGMRAGIAAAV--AGGTAAGVLA
G7ZAY1_AZOL4      TLRGLP-RSRL-----PAEVESVLEIVIDGLTAADVTAATTAGLKCLI--ERGRGSGVWG
A7IG96_XANP2      TLRGVS-QSAL-----PPEVESVLEIVIDGLSEQDVAASMQAGITAVC--GLGAAAGVVA
D7A5G4_STAND      TLRGTV-PSQL-----TADTGSVMEIVIDGVSFDAVAEATRVGILAVC--DIGAEGGVVA
D7DPS3_METV0      TLKGAT-NTEL-----SPEIESVMEIVIDGIGFDDIAESMRVGIQAIC--DLGEASGVKR
C6WV19_METML      TLKGAT-NTEL-----SPEIESVMEIVIDGLTFEDIALSMKVGIEAIC--NLGADSGVRR
C6XDX8_METGS      TLKGIT-KTEL-----SPEIESVMEIVIDGLTADDINKAMKVGIAAAC--ELGAANGIKR
I1XFH4_METNJ      TLKGQT-KSEC-----SPEVESVMEIVIDGLSKEDIDKAMRVGIQAAC--DLGAENGIRR
I1YJL0_METFJ      TLKGQT-KTEC-----SPEVESVMEIVIDGLTKEDIDKAIRVGVQAAC--DLGAENGIRR
G0A464_METMM      TLKGMT-KTDL-----SPEIESVMEIVIDGLSKEDIDKAMRVGIQAVC--DLGAANGIKR
G4SVI6_META2      TLKGIT-KTDL-----SPEIESVMEIVIDGLTKEDIDKAMRVGIQAVC--DLGAANGIKR
FTR_METCA         TLKGQT-RTEL-----SPEIESVMEIVIDGLSDADIAKAMRAGIEAAC--GLGAANGIRR
D5C447_NITHN      TLKGQT-RTEL-----SAEIESVMEIVIDGLSEEDIQKAMRAGISAAC--SLGAQNGISR
B2JX59_PARP8      TLSGLSHRSEL-----DAQTGCVLEIVIDGLTDADVGTAMTAGIEAAS--APGS--GVVR
D5WEG1_PARAM      SLIGLASRSEL-----SADVGRVLEIVIDGLTDADVGAAMTAGIGAAT--GLGRAAGVLR
Q13QW1_PARXL      TLTGLSARSEL-----GAEVGCVLEIVIDGLTDTDVGAAMTAGIGAAA--ESGRAAGLLR
E1TEU1_BURSG      TLTGLSPRSEL-----SAEVGCVLEIVIDGLTEADVGAAMTAGIVAAA--ALGRAGGLLR
B2JVM0_PARP8      GLAELALRTEL-----HGDVRSVLEIVIDGLSEADVAEAMRVGIDAATGGDAGVAHGLVR
A2SJ40_METPP      SLRELAAKSEL-----GPDIGSVMEIVIDGLTDTDVAAAMRTGLKTLI--ERGAASGLKR
I0HWJ0_RUBGI      SLVGLVARTEL-----TPDVGCVMEVVIDGLSAADVAAAMKAGLDAAL--ALGAAGGLRR
B1Y0X7_LEPCP      GLLGLVKHSEL-----DARTRCVMEIVIDGLSEAAVGEAMRVGMQAGI--ALGAAGGLLR
C5CPU5_VARPS      SLVGLVAHSELAGGTSAQEIGCVMEIVIDGLTEADVGAAMRVGMEAAI--AIGPAGGLLR
                   :                      *:*::.     :  .   ..                

E1RKI3_METP4      IGAGNYDGKLGSNNFHLHEILKNV--------NKT-----------
Q2NE82_METST      ISAGNYGGNLGKYKINLIE---------------------------
FTR_METKA         ISAGNFGGKLGQYEIHLHDLF-------------------------
Q0W8U1_METAR      ISAGNYGGKLGPYKFELTKLLQ------------------------
D1YXD3_METPS      ISAGNYGGKLGPFKFELVKLLQ------------------------
H8I4R1_METCZ      ISAGNYGGKLGPYKFELAKLLQ------------------------
B8GE36_METPE      ISAGNYGGSLGPHQFQLKDLF-------------------------
Q2FKY6_METHJ      ISAGNYEGKLGPFQFKLAELF-------------------------
E1REI3_METP4      ITAGNFGGNLGPYQFKLYEIL-------------------------
A3CT61_METMJ      ISAGNFGGSLGPFKFELKDVLAEY--------L-------------
A7I5V0_METB6      ISAGNFGGSLGPFKIELFKVI-------------------------
F4BTC4_METSG      ITAANYEGKLGIHHFPLHSVLE------------------------
A0B9N6_METTP      ISAGNFGGKLGPHQFHLHRILD------------------------
G7WRA5_METH6      ISAGNFEGKLGPHLFKLHEILG------------------------
A6UQQ1_METVS      ITAGNYGGKLGPFQMKLQELF-------------------------
A9A952_METM6      ITAGNYGGKLGPFQIKLQGLF-------------------------
A6VHJ8_METM7      ITAGNYGGKLGPFQIQLQGLF-------------------------
A4G0W2_METM5      ITAGNYGGKLGPFQIKLQELF-------------------------
Q6LWU5_METMP      ITAGNYGGKLGPYQIKLQELF-------------------------
F8AN94_METOI      ITAGNYGGKLGKFQIKLRELFE------------------------
A6UTJ4_META3      ITAGNYGGKLGPHQIKLCELFE------------------------
D7DQM5_METV3      ITAGNYGGKLGKYQIQLQELF-------------------------
F6BCN6_METIK      ITAGNYGGKLGKYQIKLHDLFE------------------------
D5VSI1_METIM      ITAGNYGGKLGPYQIKLRELFE------------------------
C7P952_METFA      ITAGNYGGKLGKYQFNLRELFE------------------------
D3S4K6_METSF      ITAGNYGGKLGKYQFNLRELFE------------------------
C9RFK4_METVM      ITAGNYGGKLGKYQFNLRELFE------------------------
FTR_METJA         ITAGNYGGKLGKYQFNLRELFE------------------------
FTR_METFV         ISAGNYGGKLGKYKLHLHDLF-------------------------
FTR_METTH         ISAGNYGGNLGAYKIKLHDLF-------------------------
D9PYC7_METTM      ISAGNYGGNLGAYQIKLHDLF-------------------------
F0T892_METLA      ISAGNFGGNLGKYQLQLHDVC-------------------------
F6D426_METPW      ISAGNFGGNLGKYQIKLQELF-------------------------
D3E0E8_METRM      ISAGNFDGKLGAYILNLHDLF-------------------------
A5UM69_METS3      IDAGNFGGNLGAYKINLQDLF-------------------------
D7EBE7_METEZ      ISAGNYGGNLGPHQFYLKEILK------------------------
FTR_METBF         ISAGNYGGKLGKYQFKLHELF-------------------------
FTR_METAC         ISAGNYGGKLGKYQFKLHELF-------------------------
FTR_METMA         ISAGNYGGKLGKYQFKLHELF-------------------------
F7XL43_METZD      ITAGNYGGNLGPYKFNLHEIL-------------------------
D5E8Y9_METMS      ISAGNYGGNLGPYKFNLHDLV-------------------------
F2KML2_ARCVS      ITAGNYGGKLGRHAIYLKDLL-------------------------
FTR_ARCFU         ITAGNYGGKLGKHIINLNELF-------------------------
D3RYB3_FERPA      ITAGNYGGKLGKHLIYLNELF-------------------------
E4RM60_HALHG      ITAGNYGGDLGSENIYLHEILRGG--------LSE-----------
I4BWV4_ACEMN      VTAGNYGGNLGQYKFHLLEILKNM----------------------
D2R5E2_PIRSD      ITAGNYGGKLGKFHFRLHEVLAST----------------------
D5SRS8_PLAL2      ISAGNYGGKLGPHHFPISRLGIDG--------LHSA----------
F0SSN0_RUBBR      ISAGNYGGKLGKHHFHLRELIDKL----------------------
E8QZI9_ISOPI      VSAGNYGGKLGPYHFHLRDLLNPP----------------------
FTR_RHOBA         VSAGNYGGKLGRHHFKLHELLADA--------SSASDSGAER----
D8JYG4_HYPDA      ITAGNYGGKLGQHHYHLKDLI-------------------------
F8JBN5_HYPSM      ITAGNYGGKLGQHHYHLKDLI-------------------------
B0UF30_METS4      VTAGNYGGNLGRHHFHLRDLLEAAA---------------------
B8ITW7_METNO      VTAGNYGGNLGRHHFHLRDLLDGT--------AA------------
B1LV90_METRJ      VTAGNYGGNLGRHHYHLRDLIARDDAKPEG----------------
B1ZIB9_METPB      VTAGNYGGNLGRHHYHLRDLLEKPAA--------------------
FHCD_METEA        VTAGNYGGNLGRHHYHLRDLLEKP--------AA------------
A9W3R8_METEP      VTAGNYGGNLGRHHYHLRDLLEKP--------AA------------
B7KXD3_METC4      VTAGNYGGNLGRHHYHLRDLLEKP--------AA------------
C7CBT1_METED      VTAGNYGGNLGRHHYHLRDLLEKP--------AA------------
E8TE70_MESCW      ISAGNYGGKLGKFIYSLKDMLP------------------------
Q1YFY4_AURMS      IGAGNYGGNLGPHHFHLKELAP------------------------
B8EKG2_METSB      VGAGNYGGKLGPFHFHLKDLLP------------------------
J7QQ18_METSZ      VGAGNYGGKLGPFHYHLKELLP------------------------
G7ZBU3_AZOL4      ITAGNYGGKLGPHHFHLHEVMA------------------------
G7ZAY1_AZOL4      VTAGNYGGKLGRHHFHLHELLP------------------------
A7IG96_XANP2      VDAGNYGGNLGPFHFKLRQLMAPV----AGETVV------------
D7A5G4_STAND      IDAGNYGGNLGPFHFKLREIMANEGDVA------------------
D7DPS3_METV0      ISAGNYGGKLGPHHFKLHEIMTSKST--------------------
C6WV19_METML      ISAGNYGGKLGPHLFKLHDILNGS--------NS------------
C6XDX8_METGS      ISAGNYGGKLGPFLFKLREIMSGDYA--------------------
I1XFH4_METNJ      ISAGNYGGKLGPFHFHLQEIMA------------------------
I1YJL0_METFJ      ISAGNYGGKLGPFHFHLQEIMA------------------------
G0A464_METMM      ISAGNYGGKLGPFHFHLQEIMA------------------------
G4SVI6_META2      ISAGNYGGKLGPFHFHLQEIMA------------------------
FTR_METCA         ISAGNYGGKLGPFLFHLREIMA------------------------
D5C447_NITHN      ISAGNYGGKLGPFHFHLQEIMA------------------------
B2JX59_PARP8      ISAGNYGGKLGPYHFRLRELAAPLVQRKTGAAQGGAA---------
D5WEG1_PARAM      ISAGNYGGKLGPYHFHLHELAAGL--------NGGRA---------
Q13QW1_PARXL      ISAGNYGGKLGPYHFYLHSLAAGL--------DGSRA---------
E1TEU1_BURSG      ISAGNYGGKLGPYHFHLQQLAAGL--------GGSSA---------
B2JVM0_PARP8      ISAGNYGGKLGPFHFHLHQLCDQL--------RDQLRDQLTEPEGR
A2SJ40_METPP      IGAGNYGGKLGPFLYHLHKLVPGM--------AEGRS---------
I0HWJ0_RUBGI      VSAGNYGGKLGPFHFHLHELLPGGAP--------------------
B1Y0X7_LEPCP      ISAGNYGGKLGPYHFHLHKLLGEQ--------ARAAT---------
C5CPU5_VARPS      ISAGNYGGKLGPFHFHLHKLLGAA--------GDAP----------
                  : *.*: *.**     :