CLUSTAL format seed alignment for MF_00580

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CH10_CAMJE       --------MNFQPLGKRVLVKRVEE--TKTTASGII--IPDNAK--EKPLMGEVVAVSK-
CH10_HELPY       --------MKFQPLGERVLVERLEE--ENKTSSGII--IPDNAK--EKPLMGVVKAVSH-
CH10_PORGI       --------MNIKPLADRVLVKPAAA--EEKTVSGII--IPDSAK--EKPLKGEVIAVGN-
CH10_THEMA       -------MMKVIPLGERLLIKPIKE--EKKTEGGIV--LPDSAK--EKPMKAEVVAVGK-
CH101_RHIME      -----MASTNFRPLHDRVVVRRVES--EEKTKGGII--IPDTAK--EKPQEGEIVAVGS-
CH104_RHIME      -----MASTDFRPLHDRVVVRRVES--EEKTKGGVI--IPDTAK--EKPQEGEIVAVGS-
CH10_AGRFC       -----MTSTNFRPLHDRVVVRRVES--EAKTKGGII--IPDTAK--EKPQEGEIVAVGS-
CH104_RHILO      -----MAKSKFRPLHDRVVVRRVES--ESKTAGGII--IPDTAK--EKPQEGEIIAVGS-
CH105_RHILO      -----MAKSKFRPLHDRVVVRRVES--ESKTAGGII--IPDTAK--EKPQEGEIIAVGS-
CH103_RHILO      -----MAQSNLRPLHDRVVVRRVES--ESKTAGGII--IPDTAK--EKPQEGEIIAVGS-
CH10_BRUME       -----MADIKFRPLHDRVVVRRVES--EAKTAGGII--IPDTAK--EKPQEGEVVAAGA-
CH10_ZYMMO       --------MNFRPLHDRVLVRRVAA--EEKTAGGII--IPDTAK--EKPQEGEVIAAGN-
CH102_RHILO      --------MTFRPLHDRILVRRIEA--EEKTAGGII--IPDTAK--EKPQEGEVIAIGP-
CH105_RHIME      --------MAFRPLHDRILVRRVES--EEKTKGGII--IPDTAK--EKPQEGEVLAVGP-
CH101_RHILO      --------MKFRPLHDRVVIRRAEG--DTKSKGGII--IPDNAK--EKPQEGEVIAVGP-
CH103_RHIME      --------MTFRPLLDRVVIRRAEG--NTQSKGGII--IPDTAK--EKPQEGEVIAVGP-
CH10_CAUVC       --------MKFRPLGDRVLVKRVEE--ETKTKGGII--IPDTAK--EKPQEGEVVAVGP-
CH102_BRADU      --------MKFRPLHDRVVVKRIDA--EEKTAGGII--IPDTVK--EKPSQGEVIAVGP-
CH101_BRADU      --------MHFRPLHDRVLVRRIDA--EEKTAGGII--IPDTAK--EKPQEGEIIAAGS-
CH10_PARDE       --------MAFKPLHDRVLVRRVQS--DEKTKGGLI--IPDSAK--EKPAEGEITSVGE-
CH101_RHOSH      --------MAFKPLHDRVLVRRVQS--DEKTKGGLI--IPDTAK--EKPAEGEVVSCGE-
CH10_RHOCA       --------MAFKPLHDRVLVKRVQS--EEKTKGGLI--IPDTAK--EKPAEGEVVAVGA-
CH10_HOLOB       -------MTKFKPLGDRILVKRVEA--EERTSGGIV--IPDTAK--EKPIEGTVIAVGP-
CH10_RICPR       --------MSFKPLHDRIAIKPIEN--EEKTKGGII--IPDTAK--EKPMQGEIVAVGN-
CH10_RICCN       --------MSFKPLHDRIAIKPIEQ--EEKTKGGII--IPDTVK--EKPMQGEIVAVGN-
CH10_EHRRW       --------MNLNMLHDNVLIEALE---ESLNNSPIQ--LPESAK--KKPTKGKVVAVGP-
CH10_EHRCH       --------MNLNMLHDNVLIEALE---ECNSSSPIQ--LPDSAK--KKPTQGKVVAVGP-
CH10_ORITS       --------MKYQPLYDRVLVEPIQ---NDEAHGKIL--IPDTAK--EKPTEGIVVMVGG-
CH10_HAEIN       --------MNIRPLHDRVIIKREEV--ETRSAGGIV--LTGSAA--TKSTRAKVLAVGK-
CH10_PASMU       --------MNIRPLHDRVIIKREEV--ETRSAGGIV--LTGSAA--TKSTRAKVLAVGK-
CH10_AGGAC       --------MNIRPLHDKVILKREDV--ETKSAGGIV--LTGSAA--TKSTRAKVLAVGP-
CH10_ACTPL       --------MTLRPLHDKVILKREEV--ETRSAGGIV--LTGSAA--TKSTRGKVIAVGT-
CH10_HAEDU       --------MSIRPLHDKVILKREEV--ETCSAGGIV--LTGSAT--VKSTRGKVIAVGT-
CH10_BUCAI       --------MKIRPLHDRVLVKRQEV--ESKSAGGIV--LTGSAA--GKSTRGTVTAVGK-
CH10_BUCAP       --------MKIRPLHDRVLVKRNEA--ELKSAGGIV--LTGSAA--AKSTRGTITAVGN-
CH10_ECOLI       --------MNIRPLHDRVIVKRKEV--ETKSAGGIV--LTGSAA--AKSTRGEVLAVGN-
CH10_STEMA       --------MNIRXLHDRVIVKRKEV--ETKSAGGIV--LTGSAA--AKSTRGEVLAVGN-
CH10_YERPE       --------MKIRPLHDRVIVKRKEV--ESKSAGGIV--LTGTAA--GKSTRGEVLAVGN-
CH10_SALTY       --------MSIRPLHDRVIVKRKEV--ESKSAGGIV--LTGSAA--GKSTRGEIIAVGK-
CH10_WIGBR       --------MKIRPLHDRVIIKRKEA--ESKSAGGIV--LTGSAA--GKSTRGKVLAVGN-
CH102_VIBCH      --------MNIRPLHDKLIVERLEV--ENKSEGGIV--LTSQSV--KKSNRGKVVAVGL-
CH10_PSEPU       --------MKLRPLHDRVVIRRSEE--ESKTAGGIV--LPGSAA--EKPNRGEIVAVGT-
CH10_PSEAE       --------MKLRPLHDRVVIRRSEE--ETKTAGGIV--LPGSAA--EKPNRGEVVAVGT-
CH10_TATMI       --------MKIRPLHDRVVVRRMEE--ERTTAGGIV--IPDSAT--EKPTRGEIIAVGP-
CH10_LEGPN       --------MKIRPLHDRVVVRRMEE--ERTTAGGIV--IPDSAT--EKPMRGEIIAVGA-
CH10_LEGJE       --------MKIRPLHDRVVVRRLEE--ERTTAGWIV--IPDSAT--EKPMRGEIIAIGA-
CH10_COXBU       --------MKIRPLHDRVVVRRLEE--ERTSAGGIV--IPDSAA--EKPSRGEVISVGP-
CH10_ALLVI       --------MNIRPLHDRVVVRRMEE--ERLSAGGIV--IPDSAT--EKPIQGEIIAVGH-
CH10_FRATH       --------MNIRPLQDRVLVRRAEE--EKKSAGGII--LTGNAQ--EKPSQGEVVAVGN-
CH10_BORPE       --------MALRPLHDRVIVKRLDN--ERKTASGIV--IPDSAA--EKPDQGEVVAVGP-
CH10_RALSO       --------MNLRPLHDRVIVKRLDN--ETKTASGIV--IPDAAA--EKPDQGEVLAIGP-
CH10_NEIMA       --------MTIRPLHDRVVVKRLEA--EEKTASGIV--LPGAAA--EKPDMGEVIAVGA-
CH10_NEIMB       --------MTIRPLHDRVVVKRLEA--EEKTASGIV--LPGAAA--EKPDMGEVIAVGA-
CH10_XANAC       --------MSIKPLHDRVVVKPIEA--DEVSAGGIV--IPDSAK--EKSTKGEVVAIGA-
CH10_XYLFA       --------MSIKPLHDRIVVKPIEA--DEVSPGGIV--IPDSAK--EKSTKGEVIAVGA-
CH10_CHLMU       -MSDQATTLKIKPLGDRILVKREEE--ASTARGGII--LPDTAK--KKQDRAEVLALGT-
CH10_CHLTR       -MSDQATTLKIKPLGDRILVKREEE--ASTARGGII--LPDTAK--KKQDRAEVLALGT-
CH10_CHLPN       -MSDQATTLRIKPLGDRILVKREEE--EATARGGII--LPDTAK--KKQDRAEVLVLGT-
CH10_LEPIN       -------MASIKPLGDRVLVEPRQE--AEEKIGSIF--VPDTAK--EKPQEGKVVEIGS-
CH10_LACLA       ---------MLKPLENRVVLRVKEE--EEKSMGGIV--LTSASQ--EKPQTAEVVAVGE-
CH10_STRP1       ---------MLKPLGDRVVVRFDDE--KEQTVGGFV--LAGTHK--ESTRKATVLAVSET
CH10_SYNE7       MAAVSLSVSTVTPLGDRVFVKVAEA--EEKTAGGII--LPDNAK--EKPQVGEIVAVGP-
CH10_NOSS1       MAAVSLSVSTVKPLGDRVFVKVSAS--EEKTAGGLY--LPDTAK--EKPQVGEVVALGA-
CH10_SYNY3       MAAISINVSTVKPLGDRVFVKVSPA--EEKTAGGIL--LPDNAK--EKPQIGEVVQVGP-
CH10_CYAPA       MATVTLNVKTVRPLGERVLVKVSQS--EEKTAGGIL--LPDTVK--EKPQIGEIIAEGP-
CH10_THEEB       MAAVSLSVSTVKPLGDRIFVKVAES--EERTAGGIL--LPDNAR--EKPQVGEVTAVGP-
CH10_CLOPE       --------MSIKPLGDRVVIKRLEA--EETTKSGII--VTGTAK--ERPQEAEVVAVGP-
CH10_HUNT2       --------MNIRPLGDRVVVKMVET--EETTKSGIV--LPGSAK--EKPQVAEVVAVGP-
CH10_CLOAB       --------MKIRPLGDRVVIKRLEA--EETTKSGIV--LPSSAK--EKPQMAEVVAVGP-
CH10_THEBR       --------MRLKPLGDRVVVKVIQA--EEVTKGGVI--LPGTAK--EKPQQGEVVAVGT-
CH10_CALS4       --------MRLKPLGDRVVVKVIQS--EEVTKGGVI--LPGTAK--EKPQQGEVVAVGP-
CH10_BORBU       -------MKNIKPLADRVLIKIKEA--ESKTISGLY--IPENAK--EKTNIGTVIAVGS-
CH10_TREPA       --------MKIIPLADRVLVKTDKS--ETKTASGII--IPDTAQ--EKMQSGTVIAVGS-
CH10_MYCAV       -----MAKVNIKPLEDKILVQANEA--ETTTASGLV--IPDTAK--EKPQEGTVVAVGP-
CH10_MYCTU       -----MAKVNIKPLEDKILVQANEA--ETTTASGLV--IPDTAK--EKPQEGTVVAVGP-
CH10_MYCLE       -----MAKVKIKPLEDKILVQAGEA--ETMTPSGLV--IPENAK--EKPQEGTVVAVGP-
CH10_CORGL       -----MANVNIKPLEDKILVQINEA--ETTTASGLV--IPDSAK--EKPQEATVIAVGP-
CH10_STRAL       -MTTASSKVAIKPLEDRIVVQPLDA--EQTTASGLV--IPDTAK--EKPQEGVVLAVGP-
CH10_STRCO       -MTTTSSKVAIKPLEDRIVVQPLDA--EQTTASGLV--IPDTAK--EKPQEGVVLAVGP-
CH10_AQUAE       --------MKLRPLYDKIVVERLEEK-EEKTPSGII--IPDTAK--EKPQLGKVVAVGP-
CH10_DEIRA       ---------MLKPLGDRVLVEIIEEA-EQKTAGGLY--VPDSAK--EKSQRGKVVAVGT-
CH10_BACP3       ---------MLKPLGDRIVIEVVET--EEKTASGIV--LPDTAK--EKPQEGRVVAVGA-
CH10_GEOSE       ---------MLKPLGDRVVIEVIET--EEKTASGIV--LPDTAK--EKPQEGRVVAVGK-
CH10_BACHD       ---------MLKPLGDRVVIEQVET--EEKTASGIV--LPDTAK--EKPQEGRVVAVGT-
CH10_BACSU       ---------MLKPLGDRVVIELVES--EEKTASGIV--LPDSAK--EKPQEGKIVAAGS-
CH10_LISIN       ---------MLKPLGDRVVIEVLEA--EEKTASGIV--LPDSAK--EKPQSGKIVAVGS-
CH10_LISMO       ---------MLKPLGDRVVIEVLEA--EEKTASGIV--LPDSAK--EKPQSGKIVAVGS-
CH10_STAAM       ---------MLKPIGNRVIIEKKEQ--EQTTKSGIV--LTDSAK--EKSNEGVIVAVGT-
CH10_STAES       ---------MLKPLGNRVIIEKKEQ--EQTTKSGIV--LTDSAK--EKSNEGVIIAVGQ-
CH10_THET8       --MAAEVKTVIKPLGDRVVVKRIEE--EPKTKGGIV--LPDTAK--EKPQKGKVIAVGT-
CH10_FUSNN       --------MNIKPIGERVLLKPIKK--EEKTKSGIL--LSSKSSNTDTQNQAEVIALGK-
CH10_MYCGE       --------MNITPIHDNVLVSLVESNKEEVSKKGIITSLASNDKSDANANKGIVIALGA-
CH10_MYCPN       --------MKITPIHDNILVSLVESNKEEVSQKGIITALANPDK-NESAHKGTVVALGA-
CH101_VIBCH      --------MNIRPLHDRVIVERQEV--ESKSAGGIV--LTGSAA--EKSTRGKVLAVGK-
                              : ..: :              .   :.           . :   .  

CH10_CAMJE       -EITD---------IANGDKIVFAKYGG-TEIKLDNNEYLVLNLDDILGILK--------
CH10_HELPY       -KISEGC-----KCVKEGDVIAFGKYKG-AEIVLDGTEYMVLELEDILGIVGSGSCCHTG
CH10_PORGI       -GTKDEE-----MVLKAGDTVLYGKYAG-TEIELEGEKYIIMRQNDVLAII---------
CH10_THEMA       -IDDDEK-----FDIKVGDKVIYSKYAG-TEIKIDDEDYIIIDVNDILAKIEE-------
CH101_RHIME      GARDESG-KVVPLDVKAGDRILFGKWSG-TEVKINGEDLLIMKEADIMGVIG--------
CH104_RHIME      GARDESG-KVVPLDVKAGDRILFGKWSG-TEVKINGEDLLIMKEADIMGVIG--------
CH10_AGRFC       GARDEAG-KVVALDVKVGDRVLFGKWSG-TEVKLDGEDLLIMKEADIMGIIG--------
CH104_RHILO      GARDESG-KLVPLDVKAGDRILFGKWSG-TEVKLNGEDLLIMKESDIMGIIG--------
CH105_RHILO      GARDEAG-KLVPLDVKAGDRILFGKWSG-TEVKLNGEDLLIMKESDIMGIIG--------
CH103_RHILO      GARDEAG-KLVPLDVKAGDRILFGKWSG-TEVKLNGEDLLIMKEADIMGIIG--------
CH10_BRUME       GARDEAG-KLVPLDVKAGDRVLFGKWSG-TEVKIGGEDLLIMKESDILGIVG--------
CH10_ZYMMO       GTHSEDG-KVVPLDVKAGDRVLFGKWSG-TEVRVDGEDLLIMKESDILGIIS--------
CH102_RHILO      GARDESG-KLTPLDVKAGDRILFGKWSG-TEIKLNGEDLLIMKESDVMGVIEQTATVKKA
CH105_RHIME      GARGEQG-QIQPLDVKVGDRILFGKWSG-TEIKIDGEDLLIMKESDVMGIIEARAAEKIA
CH101_RHILO      GARDENG-ALVPLDVKAGDLILFGKWSG-TEVKIDGEDLLIMKEADIMGVIDKSVEAKKA
CH103_RHIME      GSRDESG-KLIPLDVKIGDTILFGKWSG-TEVKIDGEDLLIMKESDIMGIVANTVPTAAN
CH10_CAUVC       GARNDKG-DVVALDVKAGDRILFGKWSG-TEVKVDGQDLLIMKESDVLGVVEA-------
CH102_BRADU      GGRDESG-KLIPIDVRVGDRVLFGKWSG-TEVKIDTQELLIMKESDIMGVLADVSSKKKA
CH101_BRADU      GGRNEQG-QLIPIDVKPGDRVLFGKWSG-TEVKIDGQDYLIMKESDLLGVVDKTGSVKKA
CH10_PARDE       GARKDSG-ELIAPAVKAGDRVLFGKWSG-TEVTVDGEELLIMKESDILGIIA--------
CH101_RHOSH      GARKDSG-ELIAMSVKAGDRVLFGKWSG-TEVTIDGAELLIMKESDILGILS--------
CH10_RHOCA       GARKDSG-ELIAPAVAVGDRILFGKWSG-TEVTLDGVEMLIMKESDIMGIIS--------
CH10_HOLOB       GARDPQG-NLIALEVKQGDRVLFGKWSG-TEVKLSGEDYIVMKESDVFGTIA--------
CH10_RICPR       GVLNKNG-EIHPLELKVGDKVLYGKWAG-TEIEIKGEKLIVMKESDVFGIIN--------
CH10_RICCN       GIRNEKG-EIHPLELKVGDKVLYGKWAG-TEIEIKGTKLIVMKESDVFGIIN--------
CH10_EHRRW       GSYNNNG-NLIPMTLKVGDVVFYRQWAG-NEVEFSDKKYIVMKESDIIAKEV--------
CH10_EHRCH       GVYNHSG-NILPMTIKVGDVVFYRQWAG-NEIEFHEKKYIVMKESDIIAKEA--------
CH10_ORITS       GYRNDKG-DITPLKVKKGDTIVYTKWAG-TEIKLESKDYVVIKESDILLVKS--------
CH10_HAEIN       GRILENG-TVQPLDVKVGDIVIFNDGYGVKSEKIDGEEVLIISENDILAIVE--------
CH10_PASMU       GRILENG-TVQPLDVKVGDTVIFNDGYGVKAEKIDGEEVLIISENDILAIVE--------
CH10_AGGAC       GRLLENG-SVHPMHVKVGDTVIFSDGYGVKTEKIDGEEVLIISESDILAIVE--------
CH10_ACTPL       GRLLENG-SVQALAVKVGDVVIFNEGYGVKSEKIDGEEVLILSENDILAIVE--------
CH10_HAEDU       GRLLENG-SIQPLSVKEGDMVIFNEGYGAKVEKIDGEEILILSENDILAIVE--------
CH10_BUCAI       GRVLDNG-DIKPLDVKVGDVVIFNEGYGAKTEKIDNEELLILTESDILAIVE--------
CH10_BUCAP       GRVLDNG-QIKPLDVKVGDVVIFNEGYGAKTEKIDNEELLILNESDILAIVE--------
CH10_ECOLI       GRILENG-EVKPLDVKVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA-------
CH10_STEMA       GRILENG-EVKPLDVKVGDIVIFNDGYGVKSEKIDNEEXLIMSDSDXLAIVEA-------
CH10_YERPE       GRILDNG-EIKPLDVKVGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA-------
CH10_SALTY       GRILDNG-TVQPLDVKVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA-------
CH10_WIGBR       GRILDNG-ETKPLDVKIGDIVIFNDGYGVKVEKIDNDEVLIMSESDILAIVEK-------
CH102_VIBCH      GRPLKNG-DRARMEVKTGDQIIFNDGYGVKTEKVDGKEYLILSESDVLAIVE--------
CH10_PSEPU       GRILENG-EVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVIEG-------
CH10_PSEAE       GRVLDNG-EVRALAVKVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVLED-------
CH10_TATMI       GKVLENG-DVRALAVKVGDVVLFGKYSG-TEVKISGQELVVMREDDIMGVIEK-------
CH10_LEGPN       GKVLENG-DVRALAVKVGDVVLFGKYSG-TEVKVDGKELVVMREDDIMGVIEK-------
CH10_LEGJE       GKILDNG-DVRAFVVKVGDVVLFGKYSG-TEVKVAGQELVVMREDDIMGVIEK-------
CH10_COXBU       GKPLDNG-EVRSLDVKVGDQILFGKYAG-TEVKLAGDEYIVMREDDIMGVIEK-------
CH10_ALLVI       GKILDNG-SVRALDVKVGDSVLFGKYSG-TEVKLDGKEFLVMREEDIMAVVEG-------
CH10_FRATH       GKKLDNG-TTLPMDVKVGDKVLFGKYSG-SEVKVGDETLLMMREEDIMGIIA--------
CH10_BORPE       GKKTEDG-KILPVDLKAGDKVLFGKYAG-QTVKVDGEELLVIREDEILAVIQ--------
CH10_RALSO       GKKDDKG-NPIALDVKVGDRVLFGKYAG-QAVKVDGQELLVMREEDIMAVVTK-------
CH10_NEIMA       GKIGKDG-ARRPLDVKVGDKIIFGKYSG-QTVKADGEELLVMREEDIFGIVEK-------
CH10_NEIMB       GKIGKDG-SRRPLDVKVGDKIIFGKYSG-QTVKADGEELLVMREEDIFGIVEK-------
CH10_XANAC       GKPLDNG-SLRAPVVKVGDKVIYGQYAG-SSYKSEGVEYKVLREDDILAVIG--------
CH10_XYLFA       GKPLDNG-NVRTPCVKVGEKVIYGQYAG-STYKAEGVEYKVLREDDILAIIG--------
CH10_CHLMU       GKKDDKG-QQLPFEVQVGDIVLIDKYSG-QELTVEGEEYVIVQMSEVIAVLQ--------
CH10_CHLTR       GKKDDKG-QQLPFEVQVGNIVLIDKYSG-QELTVEGEEYVIVQMSEVIAVLQ--------
CH10_CHLPN       GKRTDDG-TLLPFEVQVGDIILMDKYAG-QEITIDDEEYVILQSSEIMAVLK--------
CH10_LEPIN       GKYED-G-KLIPLEVKVGDTVLYGKYSG-TEIKSEGKEYLIIRESDILAVVKK-------
CH10_LACLA       GKTNHHG-TLISPLVKVGDTVIFEKFAG-TTVKMDGEEFLILKDSDLLAIVE--------
CH10_STRP1       GVRTITG-DSVLPSVSVGQEVLVENGHD-LEVTVDDEKVSIIRESDIIAIVTK-------
CH10_SYNE7       GKRNDDG-SRQAPEVKIGDKVLYSKYAG-TDIKLGNDDYVLLSEKDILAVVA--------
CH10_NOSS1       GKRNDDG-SRQELEVKVGDKVLYSKYAG-TDVKLGTEEYVLLSEKDILAVVG--------
CH10_SYNY3       GKRNDDG-TYSPVEVKVGDKVLYSKYAG-TDIKLGGDDYVLLTEKDILASVA--------
CH10_CYAPA       GRRNDDG-SFQPLEVTVNSKVLYSKYAG-TDIKLENEEYVLLSEKDILAIIA--------
CH10_THEEB       GKLTEDG-KRQPMDVKVGDKVLYSKYAG-TEVKLAGEDYVLLSEKDILAIVG--------
CH10_CLOPE       GAIVD-G-KRTEMEVKIGDKVLYSKYAG-TEVKFEGEEYTILRQDDILAIVE--------
CH10_HUNT2       GTVVD-G-KEVKMEVKVGDKVIISKYAG-TEVKFDGQEYTILRQNDILAVVE--------
CH10_CLOAB       GGVVD-G-KEIQMQVKTGDKVFFSKYSG-TEIKVDNEELLILRQDDILGIVEE-------
CH10_THEBR       GEYID-G-KKVELEVKVGDRVIFSKYAG-TEVKLDGEEYLLLRESDILAIIE--------
CH10_CALS4       GQYID-G-KRVEPEVKVGDRVIFSKYAG-TEVKLDGEEYLLLRESDILAIIE--------
CH10_BORBU       NKEE--------ITVKVGDTVLYEKYAG-AAVKIENKEHLILKAKEIVAIIEE-------
CH10_TREPA       DSEK--------IKVSVGQRVMHDKYAG-NPVKIDGEEHLLLKGADILAVIE--------
CH10_MYCAV       GRWDDDGAKRIPLDVSEGDTVIYSKYGG-TEIKYNGEEYLILSARDVLAVVSK-------
CH10_MYCTU       GRWDEDGEKRIPLDVAEGDTVIYSKYGG-TEIKYNGEEYLILSARDVLAVVSK-------
CH10_MYCLE       GRWDEDGAKRIPVDVSEGDIVIYSKYGG-TEIKYNGEEYLILSARDVLAVVSK-------
CH10_CORGL       GRFDDKG-NRIPLDIKEDDVVIFSRYGG-TEIKFGGVEYLLLSARDILAIVEK-------
CH10_STRAL       GRFE-NG-ERLPLDVKTGDVVLYSKYGG-TEVKYNGEEYLVLSARDVLAIIEK-------
CH10_STRCO       GRFE-DG-NRLPLDVSVGDVVLYSKYGG-TEVKYNGEEYLVLSARDVLAIVEK-------
CH10_AQUAE       GKLLDNG-ELKPLSVKEGDVVLFNKYAG-NEVEIEGKIYLVMSEDEVLAVVEDYSSLIGG
CH10_DEIRA       GKTLDNG-TKVAMEVKEGDTVYFAKYGG-TEVSLEGKNYSLLSERDLLAIVE--------
CH10_BACP3       GRVLDNG-QRIGRKSKVGDRVIFSKYAG-TEVKYDGKEYLILRESDILAVIR--------
CH10_GEOSE       GRVLDSG-ERVAPEVEVGDRIIFSKYAG-TEVKYDGKEYLILRESDILAVIG--------
CH10_BACHD       GRVTENG-EKIALEVKEGDSVIFSKYAG-TEVKYDGKEYLILRESDILAIIG--------
CH10_BACSU       GRVLESG-ERVALEVKEGDRIIFSKYAG-TEVKYEGTEYLILRESDILAVIG--------
CH10_LISIN       GRVLDNG-TKEPLEVAEGDTVIFAKYSG-TEVTYEGTDYLILRESDILAISK--------
CH10_LISMO       GRVLDNG-TKEPLEVAEGDTVIFAKYSG-TEVTYEGTDYLILRESDILAITK--------
CH10_STAAM       GRLLNDG-TRVTPEVKEGDRVVFQQYAG-TEVKRDNETYLVLNEEDILAVIE--------
CH10_STAES       GRLLDNG-TQVAPQVSEGDTIVFQQYAG-TEVKRGDKTYLILNEEDILAIIE--------
CH10_THET8       GRVLENG-QRVPLEVKEGDIVVFAKYGG-TEIEIDGEEYVILSERDLLAVLQ--------
CH10_FUSNN       GEKLE-G-------IKVGDKVIFNKFSG-NEIEDGDVKYLIVNAEDILAIIG--------
CH10_MYCGE       GPAYGKT-EKPKYAFGVGDIIYFKEYSG-ISFENEGNKYKIIGFEDVLAFEKPESGKQ--
CH10_MYCPN       GPAYGKS-EKPKYAFGIGDTIYFKEYSG-ISFEEEGTKYKIISLEDVLAFEKHGNTKTTT
CH101_VIBCH      GRILENG-SVQPLDVKVGDTVIFAESYG-TKTEKIDGKEVLILAEHDILAIVE-------
                                  .. :      .            ::   . .            

CH10_CAMJE       --------------------
CH10_HELPY       NHDHKHAKEHEACCHDHKKH
CH10_PORGI       --------------------
CH10_THEMA       --------------------
CH101_RHIME      --------------------
CH104_RHIME      --------------------
CH10_AGRFC       --------------------
CH104_RHILO      --------------------
CH105_RHILO      --------------------
CH103_RHILO      --------------------
CH10_BRUME       --------------------
CH10_ZYMMO       --------------------
CH102_RHILO      A-------------------
CH105_RHIME      A-------------------
CH101_RHILO      A-------------------
CH103_RHIME      AA------------------
CH10_CAUVC       --------------------
CH102_BRADU      A-------------------
CH101_BRADU      A-------------------
CH10_PARDE       --------------------
CH101_RHOSH      --------------------
CH10_RHOCA       --------------------
CH10_HOLOB       --------------------
CH10_RICPR       --------------------
CH10_RICCN       --------------------
CH10_EHRRW       --------------------
CH10_EHRCH       --------------------
CH10_ORITS       --------------------
CH10_HAEIN       --------------------
CH10_PASMU       --------------------
CH10_AGGAC       --------------------
CH10_ACTPL       --------------------
CH10_HAEDU       --------------------
CH10_BUCAI       --------------------
CH10_BUCAP       --------------------
CH10_ECOLI       --------------------
CH10_STEMA       --------------------
CH10_YERPE       --------------------
CH10_SALTY       --------------------
CH10_WIGBR       --------------------
CH102_VIBCH      --------------------
CH10_PSEPU       --------------------
CH10_PSEAE       --------------------
CH10_TATMI       --------------------
CH10_LEGPN       --------------------
CH10_LEGJE       --------------------
CH10_COXBU       --------------------
CH10_ALLVI       --------------------
CH10_FRATH       --------------------
CH10_BORPE       --------------------
CH10_RALSO       --------------------
CH10_NEIMA       --------------------
CH10_NEIMB       --------------------
CH10_XANAC       --------------------
CH10_XYLFA       --------------------
CH10_CHLMU       --------------------
CH10_CHLTR       --------------------
CH10_CHLPN       --------------------
CH10_LEPIN       --------------------
CH10_LACLA       --------------------
CH10_STRP1       --------------------
CH10_SYNE7       --------------------
CH10_NOSS1       --------------------
CH10_SYNY3       --------------------
CH10_CYAPA       --------------------
CH10_THEEB       --------------------
CH10_CLOPE       --------------------
CH10_HUNT2       --------------------
CH10_CLOAB       --------------------
CH10_THEBR       --------------------
CH10_CALS4       --------------------
CH10_BORBU       --------------------
CH10_TREPA       --------------------
CH10_MYCAV       --------------------
CH10_MYCTU       --------------------
CH10_MYCLE       --------------------
CH10_CORGL       --------------------
CH10_STRAL       --------------------
CH10_STRCO       --------------------
CH10_AQUAE       EVRWQQRQLSTTRKQGQN--
CH10_DEIRA       --------------------
CH10_BACP3       --------------------
CH10_GEOSE       --------------------
CH10_BACHD       --------------------
CH10_BACSU       --------------------
CH10_LISIN       --------------------
CH10_LISMO       --------------------
CH10_STAAM       --------------------
CH10_STAES       --------------------
CH10_THET8       --------------------
CH10_FUSNN       --------------------
CH10_MYCGE       -----RKR------------
CH10_MYCPN       VKKGAKKK------------
CH101_VIBCH      --------------------