CLUSTAL format seed alignment for MF_00583_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KPRS_BACSU       -----------------MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSD
KPRS_CORAM       -----------------MSTQYLNSNLKVFSLNSNKELAEQIAKHIGVGLGKCSVDRFSD
KPRS_BACCL       -----------------MSDCQ--HQLKLFALNSNMKLAKEIAEVMGIELGKCSVSRFSD
KPRS_ALKHC       -----------------MANYG-DPNLKVFTLNSNKGLAYEITERIGVPMGKSSVTRFSD
KPRS_STAAM       ----------------MLNNEYKNSSLKIFSLKGNEALAQEVADQVGIELGKCSVKRFSD
KPRS1_LISIN      -----------------MSNEYFDPKLKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSD
KPRS1_LISMO      -----------------MSNEYFDPKLKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSD
KPRS1_STRPN      -----------------MSFSD----LKLFALSSNKELAERVAQEIGIELGKSSVRQFSD
KPRS1_STRP1      -----------------MSYSD----LKLFALSSNKELAEKVASAMGIQLGKSTVRQFSD
KPRS1_LACLA      -----------------MSYSN----LKLFSLSSNHELAQKVAKEIGIELGKVSVGAHSD
KPRS_AGRFC       --------------------------MKVFAGNSNRHLAEAICKYLNVPLGNATVKRFAD
KPRS_RHIME       --------------------------MKVFAGNSNRLLAEAICNYLNLPLGKATVRRFAD
KPRS_BRUME       --------------------------MKLFAGNSNRVLAESVAQYLNIPLGKASVRRFAD
KPRS_RHILO       --------------------------MKLFAGNSNRVLAEAVARYLNIPLGKATVRRFAD
KPRS_CAUVC       --------------------------MKLLSGNSNRPLSQAIAEYLDMPLTRAQVRRFAD
KPRS_ECOLI       ---------------------M--PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSD
KPRS_SALTY       ---------------------M--PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSD
KPRS_YERPE       ---------------------M--PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSD
KPRS_BUCAI       ---------------------M--PDMKLFSGNSIPKLAKFIANRLYINLGKASVGRFSD
KPRS_HAEIN       ---------------------M--PDIKLFAGNATPELAKRISERLYISLGDATVARFSD
KPRS_PASMU       ---------------------M--PDIKLFTGNATPELAKRISERLYLSLGDATVGRFSD
KPRS_VIBCH       ---------------------M--PDMKLFAGNAIPELAQRIADRLYISLGDATVSRFSD
KPRS_NEIMA       ------------------MAAY--DSLMVFTGNANPELAQRVVRHLDISLGNASVSKFSD
KPRS_PSEAE       ---------------------M--SKMMVFTGNANPDLARRVVRQLHIPLGDVSVGKFSD
KPRS_RALSO       -------------------MSS--EGLMVFTGNANPKLAEAVVKHLNIPLGKALVGRFSD
KPRS_XANAC       ------------------MQDQ--RNLLVFSGNANKPLAQSICKELGVRMGKALVTRFSD
KPRS_XANCP       ------------------MQDQ--RNLLVFSGNANKPLAQSICKELGVRMGKALVTRFSD
KPRS_XYLFA       -----------------MPTIQDERNLMVFSGNANKPLTQSICKELGVRMGKSLVSRFSD
KPRS_HELPY       ------------MKARGFKAKM--RGFKIFSGSAHPAFGKEVSKHLGFPLSKAVIGKFSD
KPRS_HELPJ       ------------MKARGFKTKM--RGFKIFSGSAHPAFGKEVSKHLGFPLSKAVIGKFSD
KPRS_CAMJE       ---------------------M--RGYKIFSGSANVEFARQVSKYLSLPLSDAGVKRFSD
KPRS_MYCGE       ---------------MKLSIDN--KKHVIFSLSKSKTLVENICKKLNISEGKMVCEHFAD
KPRS_MYCPN       -------------------MDR--HNHVVFSLSKTHDLVSRICQKLKMPMGLITHNEFAD
KPRS_UREPA       ------------------MSKN--DDILLFSLSNSHQLANKIANLLKIELSPIRIDKFAD
KPRS_MYCPU       -------------------MNK--EKTIIFSMPNTHVLAQEICDELKMKLHSVNKTIFAD
KPRS_MYCLE       ------------MLSHDWTDNR--KNLMLFSGRAHPELAEQVAKELDMHVTTQDAREFAN
KPRS_MYCTU       -------------MSHDWTDNR--KNLMLFAGRAHPELAEQVAKELDVHVTSQDAREFAN
KPRS_CORGL       -------------MTAHWKQNQ--KNLMLFSGRAHPELAEAVAKELDVNVTPMTARDFAN
KPRS_STRCO       -------------MTGIKTTGE--KKMMFFSGRAHPELAEEVAQQLGVGVVPTKAFDFAN
KPRS_DEIRA       -----------------MNSRR--SPLLVFSGQSNRPLAQAICDNLGVPLGRSRTEKFTN
KPRS_AQUAE       ---------------------M--NGVKIIAGTSNKTLSEEIAGYLGLRLTDALITTFSD
KPRS_NOSS1       ---MLSSATFKLQPTATGLTEN--HRLRLFSGSSNVQLSQEVARYLGMDLGPMIRKRFAD
KPRS_SYNE7       ---MIRSATLPFASALPSLPDN--HRLRLFSGSSNSALSQEVSRYLGIDLGPMIRKRFAD
KPRS_SYNY3       MSAVSRIATLTRQSMLSALSDN--NRLRLFSGSSNPSLSQEVARYLGMDIGPMLRKRFAD
KPRS_THEMA       ------------------MSFS--NEMKVFSGNANRPLAEKIANYLNLQLGDCEVGRFAD
KPRS_CLOPE       -----------------MENHS--KNIKIFTGNSHPELAREIAKALNIPLGKAEVGTFSD
KPRS_CALS4       -----------------MARYT--NSLKIFTGNSNPKLASEIAEHLGLKLADSEVGTFSD
KPRS_CLOAB       -----------------MINHG--KNIKIFTGNSYPSLAEEIADIIGVQVGDSRVGKFSN
KPRS_FUSNN       -----------------MINF---NNVKIFSGNSNLELAKKIAEKAGLQLGKAEIQRFKD
KPRS2_STRP1      -----------------MTERYADKQIKLFSLTSNLPIAEKIAKAAGIPLGKMSSRQFSN
KPRS2_STRP8      -----------------MTERYADKQIKLFSLTSNLPIAEKIAKAAGIPLGKMSSRQFSD
KPRS2_STRPN      -----------------MSDR---KNMKLFALNSNQEIAQKIAQAVGVPLGKLSSRQFSD
KPRS2_LACLA      -----------------MVYS--DSHLKLFALNSNPGLAEKISQFTGVPLGKLSSKQFSD
KPRS2_LISIN      -----------------MTGK-----MKLFSVTSERPLATKIADYLDIPLCEVELQKFSD
KPRS2_LISMO      -----------------MAGK-----MKLFSVTSERPLATKIADYLDIPLCEVELQKFSD
                                             .::      :   :               . :

KPRS_BACSU       GEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQ
KPRS_CORAM       GEVQINIEESIRGCDVFIIQSTSFPVNEHIMELLIMIDALKRASAKTINIVIPYYGYARQ
KPRS_BACCL       GEIQINIEESIRGDDVFVIQSTSVPVNEHLMELLIMIDALKRASARTINIVMPYYGYARQ
KPRS_ALKHC       GEVQINIEESIRGCDVFLIQSTAAPANEHIMELLIMIDAVKRASAKTINVVIPYYGYARQ
KPRS_STAAM       GEIQINIEESIRGCDVFIIQPTSYPVNLHLMELLIMIDACKRASAATINIVVPYYGYARQ
KPRS1_LISIN      GEIQINIEESIRGCHVYVIQSTSNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQ
KPRS1_LISMO      GEIQINIEESIRGCHVYVIQSTSNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQ
KPRS1_STRPN      GEIQVNIEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQ
KPRS1_STRP1      GEIQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQ
KPRS1_LACLA      GETVVHIDESVRGDHVFILQSTSDPVNDNLMELLIMMDALRRASAASINIVLPYYGYARQ
KPRS_AGRFC       QEIFVEISENVRGEDVFIVQSTSFPANDHLMELLIMIDAMRRSSAKRITAVLPYFGYARQ
KPRS_RHIME       QEIFVEIGENVRGEDVFIVQSTSFPTNDHLMELLIMIDAVRRSSARRITAVLPYFGYARQ
KPRS_BRUME       QEIFVEIQENVRGEDVFVLQSTSYPANDHLMELLIMIDAFRRSSARRITAVLPYFGYARQ
KPRS_RHILO       QEIFVEIQENVRGEDVFILQSTSFPTNDHLMELLIMIDAFMRSSAKRITAVIPYFGYARQ
KPRS_CAUVC       LEVFVTIDENVRGEDVFVIQSTSYPANDNLMELLICIDALKRASGKRITAVIPYFGYARQ
KPRS_ECOLI       GEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQ
KPRS_SALTY       GEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQ
KPRS_YERPE       GEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQ
KPRS_BUCAI       GEISVQINENVRGSDVFIIQSTCSPTNDNIMELVVMVDSLRRASAGRITAVIPYFGYARQ
KPRS_HAEIN       GEIQVQINENVRGADVFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQ
KPRS_PASMU       GEIQVQINENVRGSDVFIIQSTCAPTNDNLMELIVMVDALRRASAGRITAVIPYFGYARQ
KPRS_VIBCH       GEVAVQINENVRGSDVFIIQSTCAPTNDNLMELVVMIDAMRRASAGRITAVIPYFGYARQ
KPRS_NEIMA       GEVAVELLENVRGRDVFILQPTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQ
KPRS_PSEAE       GEISVEINENVRGKDVFLIQPTCAPTNDNLMELVVMADAFRRSSATRITAVIPYFGYARQ
KPRS_RALSO       GEVQVEIQENVRGKHVFILQSTCAPTNDNLMELMVMVDALKRASARRITAAIPYFGYARQ
KPRS_XANAC       GEVQVEIEESVRRQEVFVIQPTCAPSAENLMELLVLIDALKRASAQSVTAVIPYFGYSRQ
KPRS_XANCP       GEVQVEIEESVRRQEVFVIQPTCAPSAENLMELLVLIDALKRASAASVTAVIPYFGYSRQ
KPRS_XYLFA       GEEQVEIEESVRRQEVFVVQPTCAPSAENLMELLVIIDALKRASVSSVTAVIPYFGYSRQ
KPRS_HELPY       GEINIQISESVRGKDIFIIQPTCVPVNDNLMELLVMVDALRRSSANSITAVLPYFGYARQ
KPRS_HELPJ       GEINIQISESVRGKDIFIIQPTCVPVNDNLMELLVMVDALRRSSANSITAVLPYFGYARQ
KPRS_CAMJE       GEISVQIDESVRGKDVFIIQSTCAPTNDNLMELLILTDALRRSSANSITAIIPYFGYARQ
KPRS_MYCGE       GETYIRFDESVRNKDIYIFQSTCPNVNDSLMELLIAIDALKRGSAKSITAILPYYGYARQ
KPRS_MYCPN       GETYIRFEESVRNKDVFIFQSTCAPVNDSLMELLIAIDALKRGSAKSITAILPYYGYARQ
KPRS_UREPA       GELIVAPQVPVRGRRVIIIQSTSKPVNDSLMELLIAIDSIKRASAKAISVVIPYYGYARQ
KPRS_MYCPU       GEVLLSSKETVRSKDVFIVASTSHPANNNIMDLLIFVDSLKRASAKTINVILSYYGYARQ
KPRS_MYCLE       GEIFVRFHESVRGCDAFVLQSCPAPVNTWLMEQLIMIDALKRGSAKRITAVIPFYPYARQ
KPRS_MYCTU       GEIFVRFHESVRGCDAFVLQSCPAPVNRWLMEQLIMIDALKRGSAKRITAVMPFYPYARQ
KPRS_CORGL       GEIYVRFEESVRGSDCFVLQSHTQPLNKWLMEQLLMIDALKRGSAKRITAILPFYPYARQ
KPRS_STRCO       GEIYVRYQESARGADCFLIQSHTAPINKWVMEQLIMIDALKRASARSITVIVPFYGYARQ
KPRS_DEIRA       DNLIVHYEESLREGDVFIVQTFSTPVSDAIMELMLMIDAAKSASAGRVTAVIPYYSYARS
KPRS_AQUAE       GEIRVQINESIRGYHVYVITSLSNPVNHNLMELLLTLDAVKRSSPKEITAVVPYYAYGRQ
KPRS_NOSS1       GELYVQIQESIRGCDVYLIQPCCQPVNDHLMELLIMVDACRRASARQVTAVIPYYGYARA
KPRS_SYNE7       GELYVQIQESIRGCDVYLMQPTCWPVNDHLMELLIMIDACRRASARQITAVLPYYGYARA
KPRS_SYNY3       GELYIQIQESIRGGDVYLIQPCCHPVNDNLMELLIMIDACRRASARQITAVLPYYGYARA
KPRS_THEMA       GEINVRINETVRGHDIFLIQPTSPPVNENLMELLIMIDAFKRASANTIAVVIPYYGYARQ
KPRS_CLOPE       GEISVNIKETVRGCDVFIVQSTCSPVNNNLMELLIMIDAFKRASAGRINAVIPYYGYARQ
KPRS_CALS4       GEISVRIGESVRGASVFVIQSTCAPVNNNLMELLIMIDAFKRASAAEINAVIPYYGYARQ
KPRS_CLOAB       GETAVDINETVRGTDLFLIQTLCEPVNDSIMELLIMLDAFKRASAGRITAVIPNYAYARQ
KPRS_FUSNN       GEVYIEIEETVRGRDVFVVQSTSEPVNENLMELLIFVDALKRASAKTINVIIPYYGYARQ
KPRS2_STRP1      GEIMINIEETVRGDDIYIIQSTSFPVNDNLWELLIMIDACKRASANTVNIVLPYFGYSRQ
KPRS2_STRP8      GEIMINIEETVRGDHIYIIQSTSFPVNDNLWELLIMIDACKRASANTVNIVLPYFGYSRQ
KPRS2_STRPN      GEIQVNIEESVRGYDVYIIQSTSFPVNNHLMELLIMVDACVRASAHSINVVLPYFGYARQ
KPRS2_LACLA      GEIMINMEESVRSQDIFIVQSTSCPVNDHLWELLIMIDACKRASARTINVVIPYFGYARQ
KPRS2_LISIN      GEVKINIEESIRGTNAYVVQSMNANVNERLMELLIMVDALKRASVHSINIIMPYYGYARQ
KPRS2_LISMO      GEVKINIEESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQ
                  :  :      *     :. .        : : :   *:   .*   :   :. : *.* 

KPRS_BACSU       DRKA-RSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFE
KPRS_CORAM       DRKA-RSREPITSKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFE
KPRS_BACCL       DRKA-RSRNPITAKLVANLLETAGASRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFK
KPRS_ALKHC       DRKA-RAREPITAKLVANLLETAGATRVLTLDLHATQIQGFFDIPVDQLMGVPILAEFFE
KPRS_STAAM       DRKA-RSREPITAKLVANLIETAGATRMIALDLHAPQIQGFFDIPIDHLMGVPILAKHFK
KPRS1_LISIN      DRKA-RSREPITAKLVANLIETAGATRMITLDMHAPQIQGFFDIPIDHLNAVRLLSDYFS
KPRS1_LISMO      DRKA-RSREPITAKLVANLIETAGATRMITLDMHAPQIQGFFDIPIDHLNAVRLLSDYFS
KPRS1_STRPN      DRKA-RAREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFE
KPRS1_STRP1      DRKA-RSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFD
KPRS1_LACLA      DRKA-RAREPITSKLVANMLQIAGADRLITFDLHAPQIQGFFNIPVDHLMGSPLIAEYFR
KPRS_AGRFC       DRKA-GPRTPISAKLVANLITEAGADRVLTLDLHAGQIQGFFDIPTDNLFAAPILARDVK
KPRS_RHIME       DRKP-GPRTPISAKLVANLITEAGADRVLTLDLHAGQIQGFFDIPTDNLYAIPILARDVK
KPRS_BRUME       DRKP-GPRTPISAKLVANLITEAGASRVLTLDLHAGQIQGFFDIPTDNLYAVPVIARDVK
KPRS_RHILO       DRRA-SGRTPISAKLVANMITRAGVDRVLTLDLHAGQIQGFFDIPTDNLFSVPVMARDVK
KPRS_CAUVC       DRKT-GGRTPISAKLVANLITRSGADRVLTMDLHAGQIQGFFDIPTDNLLPSRLMAEDIR
KPRS_ECOLI       DRRVRSARVPITAKVVADFLSSVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDML
KPRS_SALTY       DRRVRSARVPITAKVVADFLSSVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDML
KPRS_YERPE       DRRVRSARVPITAKVVADFLSSVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDML
KPRS_BUCAI       DRRVRSARVPITAKVVADFLSSIGVDRVLTVDLHAEQIQGFFDVPVDNVFGSLILLEDML
KPRS_HAEIN       DRRVRSARVPITAKVVADLLSIVGIDRVLTCDLHAEQIQGFFDVPVDNVFGSPVLIHDIL
KPRS_PASMU       DRRVRSARVPITAKVVADFLSSVGVDRVLTCDLHAEQIQGFFDVPVDNVFGSPVLVHDML
KPRS_VIBCH       DRRVRSARVPITAKVVADFLSNVGVDRVLTIDLHAEQIQGFFDVPVDNIFGTPVLLEDMK
KPRS_NEIMA       DRRPRSVRVPISAKLVANMLYSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIK
KPRS_PSEAE       DRRPRSARVAISAKVVADMLTVVGVNRVLTVDLHADQIQGFFDIPVDNIYGSPVLVDDIE
KPRS_RALSO       DRRPRSARVAISAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPILLEDLR
KPRS_XANAC       DRRMRSSRVPITAKVAAKMICAMEADRVLTVDLHADQIQGFFDVPVDNVYASPLLLADIW
KPRS_XANCP       DRRMRSSRVPITAKVAAKMICAMEADRVLTVDLHADQIQGFFDVPIDNVYASPLLLADIW
KPRS_XYLFA       DRRMRSLRVPITAKVAAKMISAIGADRVLTIDLHADQIQGFFDVPVDNVYASPLLLADIW
KPRS_HELPY       DRKA-APRVPITAKMVANLMQEVGIERIITMDLHAGQIQGFFDVPVDNLYGSIVFRDYIR
KPRS_HELPJ       DRKA-APRVPITAKMVANLMQEVGIERIITMDLHAGQIQGFFDVPVDNLYGSIVFRDYIR
KPRS_CAMJE       DRKA-NPRVPITAKLVANLIQAAGIDRVATIDLHAGQIQGFFDIPVDNLYGSIVFNDYIK
KPRS_MYCGE       DRKT-KGREPITSKLIADMLTKAGANRVVLTDIHSDQTQGFFDIPVDSLRTYHIFLFRVI
KPRS_MYCPN       DRKT-MGREPITSKLVADLLTTAGVSRVALTDIHSDQTQGFFNIPVDTLRTYHVFLTRTV
KPRS_UREPA       DRKA-KPREPITARLVAKMIESAGATSVLTWDIHSLQTQGFFDIPFDSLEAVWVLMKHYF
KPRS_MYCPU       DRKA-EGRQPIAAKLLADLLQVAGISRIVVVDLHNPSIQGFFNIPVDDIKAQYILSKEFT
KPRS_MYCLE       DKKH-RGREPISARLVADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIK
KPRS_MYCTU       DKKH-RGREPISARLIADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIR
KPRS_CORGL       DKKH-RGREPISARLIADLMLTAGADRIVSVDLHTDQIQGFFDGPVDHMHAMPILTDHIK
KPRS_STRCO       DKKH-RGREPISARLIADLMKTAGADRILAVDLHTDQIQGFFDGPVDHLFALPLLADYVG
KPRS_DEIRA       DKKD-SPRISIAGRLVADLLQEAGADRVLTMTLHSPQVHGFFKVPVDHLSADVVLSQHFK
KPRS_AQUAE       DRQD-KPRTPISAKLVADLIQKAGANRVIVVDLHSPQIQGFFDIPVEHLTAIPVLYDYIR
KPRS_NOSS1       DRKT-AGRESITAKLVANLITQAGANRVLAMDLHAAQIQGYFDIPFDHVYGSPVLLDYLT
KPRS_SYNE7       DRKT-AGRESITAKLVANLITQAGANRVLAMDLHSAQIQGYFDIPFDHVYGSPVLIDYLR
KPRS_SYNY3       DRKT-AGRESISAKLVANLITGAGAQRVLAMDLHSAQIQGYFDIPCDHMYGSPVIIDYLK
KPRS_THEMA       DRKA-KGRDPISAKLVANLITVAGATRVLTVDLHAEQIQGFFDIPVDNLWSYPVFAEELL
KPRS_CLOPE       DRKA-KSRDPITAKLVADLLTAAGADRVLTMDLHAAQIQGYFNIPVDHLLGSPILAKYFV
KPRS_CALS4       DRKA-KARDPITAKLVADLITAAGAHRVVTMDLHAPQIQGYFNIPVDHLLGGPILAKYFM
KPRS_CLOAB       DRKA-KARQPITAKLMADLIHTAGADRVLTMDLHAPQIQGFFDIPVDHLEGVPILAKYFI
KPRS_FUSNN       DRKS-KPREPITSKLVANLLTTAGVNRVVAMDLHADQIQGFFDIPLDHMQALPLMARYFK
KPRS2_STRP1      DRVA-KPREPITAKLVANMLTKAGIDRVVTLDLHAVQVQGFFDIPVDNLFTVPLFAERYS
KPRS2_STRP8      DRVA-KPREPITAKLVANMLTKAGIDRVVTLDLHAVQVQGFFDIPVDNLFTVPLFAERYS
KPRS2_STRPN      DRIA-CPREPLTAKLVANMLVKAGVDRILTLDLHAVQVQGFFDIPVDNLFTVPLFAKHYC
KPRS2_LACLA      DRTA-TSREPITAKLVADMIVKAGADRLLTLDIHAVQVQGFFDIPVDNLFTVPLFADYYR
KPRS2_LISIN      DRKA-RSREPITAKLMANLIQRAGANRLITVDLHAAQIQGFFNIPIDHLSAVPLIGDYLI
KPRS2_LISMO      DRKA-RSREPITAKLMANLIQRAGANRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLI
                 *:     * .::.:: *.::       :    :*  . :*:*. * : :    ::     

KPRS_BACSU       GK---NLEDIVIVSPDHGGVTRARKLADRLK--APIAIIDKRR--PRPNVAEVMNIVGNI
KPRS_CORAM       TK---GLKDIVIVSPDHGGVTRARKMADRLK--APIAIIDKRR--PRPNVSEVMNIIGNI
KPRS_BACCL       SK---QLEDIVVVSPDHGGVTRARKLADRLK--APIAIIDKRR--PKPNVAEVMNIVGQV
KPRS_ALKHC       KK---GLDDVVVVSPDHGGVVRARKLADRLK--APIAIIDKRR--PKPNVAEVMNIVGHI
KPRS_STAAM       DDPNINPEECVVVSPDHGGVTRARKLADILK--TPIAIIDKRR--PRPNVAEVMNIVGEI
KPRS1_LISIN      ERH--LGDDLVVVSPDHGGVTRARKMADRLK--APIAIIDKRR--PRPNVAEVMNIVGNV
KPRS1_LISMO      ERH--LGDDLVVVSPDHGGVTRARKMADRLK--APIAIIDKRR--PRPNVAEVMNIVGNV
KPRS1_STRPN      RR-GMVGSDYVVVSPDHGGVTRARKLAEFLK--TSIAIIDKRRSVDKMNTSEVMNIIGKV
KPRS1_STRP1      RH-GLVGEDVVVVSPDHGGVTRARKLAQFLQ--TPIAIIDKRRSVDKMNTSEVMNIIGNV
KPRS1_LACLA      RQLVSAGDDIVVVSPDHGGVGRARKLANFLK--APLSIIDKRR--PRANVAEIMNIIGDV
KPRS_AGRFC       DHY-DT-NNVMVVSPDVGGVVRARALSKRLD--CLLAIVDKRR--DRPGESEVMNVIGDV
KPRS_RHIME       ENY-NL-KNVMVVSPDVGGVVRARALAKRLD--CLLAIVDKRR--DRPGESEVMNVIGEV
KPRS_BRUME       ANY-AT-GNCMVVSPDVGGVVRARSLAKRID--AQLAIVDKRR--ERPGESEVMNVIGDV
KPRS_RHILO       AKY-KQLGNVVVVSPDIGGVVRARALAKRFD--AQLAIVDKRR--ERPGESEVMNIIGAV
KPRS_CAUVC       RHY-PMGDDLMVVSPDVGGVVRARALAKRLDD-ADLAIVDKRR--SGPGQSEVMNIIGDV
KPRS_ECOLI       QL--NL-DNPIVVSPDIGGVVRARAIAKLLND-TDMAIIDKRR--PRANVSQVMHIIGDV
KPRS_SALTY       QL--NL-DNPIVVSPDIGGVVRARAIAKLLND-TDMAIIDKRR--PRANVSQVMHIIGDV
KPRS_YERPE       QQ--NL-ENPIVVSPDIGGVVRARAIAKLLND-TDMAIIDKRR--PRANVSQVMHIIGDV
KPRS_BUCAI       QR--EL-KNPIVVSPDIGGVVRARAIAKLLYD-TDMAIIDKRR--PRANVSQIMNIIGDV
KPRS_HAEIN       KKS-DL-KNPIVVSPDIGGVVRARAVAKLLND-TDMAIIDKRR--PRANVAQVMHIIGDV
KPRS_PASMU       KKI-DM-QNPIVVSPDIGGVVRARAIAKLLND-TDMAIIDKRR--PRANVAQVMHIIGDV
KPRS_VIBCH       AR--NL-EDPVVVSPDLGGVVRARATAKALGD-IDIAIVDKRR--PRANVSEVMNLIGDV
KPRS_NEIMA       QQ--RI-ENLTVVSPDIGGVVRARAVAKSLN--ADLAIIDKRR--PKANVAEVMNIIGDI
KPRS_PSEAE       DQ--RF-ENLMIVSPDIGGVVRARAVAKSLG--VDLAIIDKRR--PKANQSEVMHIIGDV
KPRS_RALSO       KK--NY-DNLLVVSPDVGGVVRARALAKQLG--VDLAIIDKRR--PKANVAEVMNIIGEV
KPRS_XANAC       RAY-GT-DNLIVVSPDVGGVVRARAVAKRLDD-ADLAIIDKRR--PRANVATVMNIIGDV
KPRS_XANCP       RAY-GT-DNLIVVSPDVGGVVRARAVAKRLDD-ADLAIIDKRR--PRANVATVMNIIGDV
KPRS_XYLFA       RAY-GT-DNLIVVSPDVGGVVRARAMAKRLGD-TDLAIIDKRR--PRANVATVMNIIGEV
KPRS_HELPY       SK---ALKNPVIASPDVGGVTRARYFANQMG--LDLIIVDKRR--EKANESEVMNIIGSA
KPRS_HELPJ       SK---ALKNPIIASPDVGGVTRARYFANQMG--LDLIIVDKRR--EKANESEVMNIIGSA
KPRS_CAMJE       AK---HFKNAIIGSPDIGGVARARSVAKHLG--LDIVIVDKRR--EKANESEVMNIIGDV
KPRS_MYCGE       ELL-G-KKDLVVVSPDYGGVKRARLIA--NTLELPLAIIDKRR--PSHNVAESINVLGEV
KPRS_MYCPN       ELL-G-KKDLVVVSPDYGGVKRARLIA--TSLELPLAIIDKRR--PAHNVAESINVLGEV
KPRS_UREPA       SAY-KDSSNITIVSPDYGGVKRAREIS--IATGATLAIVDKRR--SGKNQVEINNVLGDV
KPRS_MYCPU       IKD-E---KFTIVSPDHGGTIRARIMAEIISNDVKIAIIDKRR--VSTNKTEVLGVIGDI
KPRS_MYCLE       NNY-PDT-NMVVVSPDSGRVRIAEKWGDALGG-VPLAFIHKTRDLRVPNQVVSNRVVGEV
KPRS_MYCTU       DNY-PDG-NMVVVSPDSGRVRIAEKWADALGG-VPLAFIHKTRDPRVPNQVVSNRVVGDV
KPRS_CORGL       ENY-NLD-NICVVSPDAGRVKVAEKWANTLGD-APMAFVHKTRSTEVANQVVANRVVGDV
KPRS_STRCO       AKV-DRS-KLTVVSPDAGRVRVADRWCDRLG--APLAIVHKRRDKDVANQVTVHEVVGDV
KPRS_DEIRA       KCV-PDAHNGVVLAPDAGSIKRASQIARRLD--SGLAMIDKER--LSDTEVRPRALIGDV
KPRS_AQUAE       KNV-VLE-NPIVVSPDAGGVKRARDLANKLG--CGIGVILKRR--PEPNKAEVMDVVGDI
KPRS_NOSS1       SKQ-LH--DIVVVSPDVGGVARARAFAKKLND-APLAIIDKRR--QAHNVAEVLNVIGDV
KPRS_SYNE7       SKN-LA--DLVVVSPDVGGVARARAFAKKLDD-APLAIIDKRR--QAHNVAEVLNVIGDV
KPRS_SYNY3       SKQ-LT--DLVVVSPDVGGVARARAFAKKLND-APLAIIDKRR--QSHNVAEVLNLIGDV
KPRS_THEMA       KRENIVPEETVVVSPDVGGVRRARRMAERLG--TSLAILDKRR--PSDNVAEVVNIIGEV
KPRS_CLOPE       EKGLADRDDVVVVSPDLGSVTRARKFADKLN--APIAIIDKRR--PKANVSEIMNIIGDV
KPRS_CALS4       DKELGD--DVVVVSPDHGSVTRARYFAEKLN--APLAIIDKRR--PKANVAEVMNIIGDV
KPRS_CLOAB       NQNSNT-DDLIVVSPDIGGVKRTRKFAEKLH--APIAIIDKRR--PKPNVSEVMSIIGDV
KPRS_FUSNN       EKGFKG-DEVVVVSPDVGGVKRARKLAEKLD--CKIAIIDKRR--PKPNMSEVMNLIGEV
KPRS2_STRP1      KLG-LSGSDVVVVSPKNSGIKRARSLAEYLD--SPIAIIDYAQ---DDSEREQGYIIGDV
KPRS2_STRP8      KLG-LSGSDVVVVSPKNSGIKRARSLAEYLD--SPIAIIDYAQ---DDSEREQGYIIGDV
KPRS2_STRPN      DKG-LLGSDVVVVSPKNSGVKRARSLAEYLD--APIAIIDYPQ---DDATRNEGYIIGDV
KPRS2_LACLA      KSG-LFGDDVIVVAPKNSGIKRARSLAEYLE--SAIAIVDYED---DDKNRENGYVIGNV
KPRS2_LISIN      EK--YGEEDVVVVAPDHSGVVRARRIADRLN--APIAILNRKP---RPHEDEIMSVIGDV
KPRS2_LISMO      EN--YGEKDVVVVAPDHSGVVRARRIADRLN--APIAILNRKP---RPHEDEIMSVIGDV
                         .  : :*. .    :            : .:                ::*  

KPRS_BACSU       EGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERIN-NSTIKELV
KPRS_CORAM       EGKTALLIDDIIDTAGTITLAANALVENGASEVYACCTHPVLSGPAIERIQ-NSNIKELV
KPRS_BACCL       AGKTAILIDDIIDTAGTITLAANALAESGAKEVYACCTHPVLSGPAIERIQ-SSKIKELV
KPRS_ALKHC       EGKTAIIIDDIIDTAGTITLAANALVEHGAKEVYACCTHPVLSGPAIERIK-NSKIKELV
KPRS_STAAM       EGRTAIIIDDIIDTAGTITLAAQALKDKGAKEVYACCTHPVLSGPAKERIE-NSAIKELI
KPRS1_LISIN      EGKVCIIIDDIIDTAGTITLAAKALREAGATKVYACCSHPVLSGPAMKRIE-DSPIEKLV
KPRS1_LISMO      EGKVCIIIDDIIDTAGTITLAAKALREAGATKVYACCSHPVLSGPAMKRIE-ESPIEKLV
KPRS1_STRPN      EGKTCILIDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQ-KSAIKKLV
KPRS1_STRP1      SGKKCILIDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQ-RSAIEKLI
KPRS1_LACLA      QGKKCILIDDMIDTAGTITLAANALKELGATEVYASCTHAVLSGPAIERIN-NSAITKLV
KPRS_AGRFC       SGKDCILIDDIIDSGGTLCNAAEALLKKGATSVTAYITHGVLSGGAVARVA-SSKLRELV
KPRS_RHIME       NGKDCLLIDDIVDSGGTLCNAAEALLKNGATSVTAYITHGVLSGGAVARVT-SSMLKELV
KPRS_BRUME       SGKDCLLFDDIVDSGGTLCNAAEALLNKGANSVTAYITHGVLSGGAVARIA-SSKLKELV
KPRS_RHILO       AGKDCLLIDDIVDSGGTLCNAADALLANGATSVTAYITHGVLSGGAVARIS-GSKLQELV
KPRS_CAUVC       KDRRCILFDDIADSAGTLCNAAQALMAHGAKSVSAYITHGVLSGAAADRVA-NSVLTELV
KPRS_ECOLI       AGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAANNLR-NSVIDEVV
KPRS_SALTY       AGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAANNLR-NSVIDEVV
KPRS_YERPE       AGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAVDNIR-NSVIDEVI
KPRS_BUCAI       ANRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPVFSGDAPKNLK-NSVIDEVV
KPRS_HAEIN       ADRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFSGAAAKNLA-SDAIDEVV
KPRS_PASMU       AGRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFSGSAAKNLA-SDALDEVV
KPRS_VIBCH       EGRDCVIVDDMIDTGGTLCKAAEALKERGAKRVFAYATHAVFSGNAAKNIK-NSVLDQVI
KPRS_NEIMA       QGRTCLIVDDMIDTANTLCKAAVALKERGAERVLAYASHAVFSGEAVSRIA-SSEIDQVV
KPRS_PSEAE       EGRTCVLVDDMVDTAGTLGHAAKALKEHGAAKVIAYCTHPVLSGRAIENIE-KSVLDELV
KPRS_RALSO       EGRNCVIMDDMIDTGGTLCKAAQVLKERGAKQVFSYCTHPVLSGGAAARIA-DSALDEVV
KPRS_XANAC       QGKTCVLVDDLVDTAGTLCAAAAALKQRGALKVVAYITHPVLSGPAVDNIN-NSQLDELV
KPRS_XANCP       QGKTCVLVDDLVDTAGTLCAAAAALKQRGALKVVAYITHPVLSGPAVDNIN-NSQLDELV
KPRS_XYLFA       NGKTCVLVDDLVDTAGTLCAAAVALKQNGATKVVAYITHPVLSGPAVDNIN-NSELDELV
KPRS_HELPY       KERDVILVDDMIDTAGTICKAALALKEQGATSVMALGTHAVLSGNAIKRIK-ESALDEVV
KPRS_HELPJ       KERDVILVDDMIDTAGTICKAALALKEQGATSVMALGTHAVLSGNAIKRIK-ESALDEVV
KPRS_CAMJE       KDKEVILVDDIIDTAGTIVKAAEALKEKGAKSVMACCTHAVLSGKAYERIA-SGVLDELV
KPRS_MYCGE       KNKNCLIVDDMIDTGGTVIAAAKLLQKEQAKKVCVMATHGLFNNDAEQKFM-EAFDQKLI
KPRS_MYCPN       ANKNCLIVDDMIDTGGTVIAAAKLLREHHAKKVCVMATHGLFNGEAPQRFQ-KAFNEGLV
KPRS_UREPA       KDRDCVIVDDMIDTGGTILGAAKIVREKGAKSITIIATHGLFNNNARQHFQ-QAIKDRII
KPRS_MYCPU       NNENAVIVDDIIDTGGTIVNAAEVLKKNGAKKISIVASHGIFS----KGFD-IFEDADVI
KPRS_MYCLE       EGRTCVLIDDMIDTGGTVAGAVQLLRNDGASDVIIAATHGVLSPPAAERLA-QYGTREVI
KPRS_MYCTU       AGRTCVLIDDMIDTGGTIAGAVALLHNDGAGDVIIAATHGVLSDPAAQRLA-SCGAREVI
KPRS_CORGL       DGKDCVLLDDMIDTGGTIAGAVGVLKKAGAKSVVIACTHGVFSDPARERLS-ACGAEEVI
KPRS_STRCO       KGRICVLVDDMIDTGGTICAAADALFAHGAEDVIVTATHGVLSGPAADRLK-NSKVSEFV
KPRS_DEIRA       DGKTVFIVDDEISTAGSLVETVSIARSMGAKDVYVAVTHGVYSGPAIERIA-ALDVTQVA
KPRS_AQUAE       EGKEAIIVDDIIDTAGTLVAAANLLVNKGVKRVIACATHGIFSGPAVERLT-NSPIEKVI
KPRS_NOSS1       KGKTAVLVDDMIDTGGTIAAGAKLLREEGARQVYACATHAVFSPPAVERLS-SGLFEEVI
KPRS_SYNE7       QGKTAVLVDDMIDTAGTICEGARLLRKQGASQVYACATHAVFSPPAIERLSASGLFEEVI
KPRS_SYNY3       DGKTAVLVDDMIDTAGTLSEGSRLLRAQGARQVYACATHAVFSEPAINRLS-GGLFEEVI
KPRS_THEMA       EDKVVIMFDDIIDTAHSIVKGAEALKNAGAKRIIACATHGVFSDRALERIE-NSSIDTVY
KPRS_CLOPE       KDKVCILIDDMIDTAGTITNAANALKDLGAKNVYACCTHGVLSGPAFERIN-NSAIEELV
KPRS_CALS4       KGKKAILVDDLIDTAGTLVQAAEALLDHGAVEIYACATHGVLSGPAIERLK-ESPIKEVV
KPRS_CLOAB       KGKKAILVDDMIDTAGSIVNAAEALVKMGAKEVSACCTHGVLSGPAIERLE-NSPLKEVV
KPRS_FUSNN       EGKIAIFIDDMIDTAGTITNGADAIAQRGAKEVYACCTHAVFSDPAIERLE-KSVLKEIV
KPRS2_STRP1      SGKKAILIDDILNTGKTFAEAAKILERSGATDTYAVASHGLFAGGAADVLE-TAPIKEII
KPRS2_STRP8      SGKKAILIDDILNTGKTFAEAAKILERSGATDTYAVASHGLFAGGAADVLE-TAPIKEII
KPRS2_STRPN      EGKKAILIDDILNTGRTFSEASKIVEREGATEIYAVSSHGLFVEGAAELLD-NTNIKEIL
KPRS2_LACLA      SGKKVILIDDILNTGVTFANAANVVREAGASEIYAVASHGLFTSGAADVLE-KVDIKEIL
KPRS2_LISIN      KGKVAIVVDDIIDTGVRATTSADILLEKGAVEVIACATHSVMAGDATERLQ-NSRIKEVI
KPRS2_LISMO      KGKVAIVVDDIIDTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQ-NSNIKEVI
                   .  ...**  .:.              .       :* :        .        . 

KPRS_BACSU       VTNSIKLPEE-----KKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS-----------
KPRS_CORAM       VTNSIVLPEE-----KKIDKVHELSVAPLIGEAIIRVYEEESVSVLFN-----------
KPRS_BACCL       VTNSIALPEE-----KKIDKIVKLSVRPLIAEAITRVYEMKSVSVLFD-----------
KPRS_ALKHC       VMNTIELEEE-----KLIDKITTLSVAPLMAEAIVRVHEHSSVSLLFD-----------
KPRS_STAAM       VTNSIHLDED-----RKPSNTKELSVAGLIAQAIIRVYERESVSVLFD-----------
KPRS1_LISIN      VTNSIALPEE-----KWIDKMEQLSVAALLGEAIVRVHENASVSSLFE-----------
KPRS1_LISMO      VTNSIALPEE-----KWIDKMEQLSVAALLGEAIVRVHENASVSSLFE-----------
KPRS1_STRPN      VLDTIYLPEE-----RLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI------
KPRS1_STRP1      VLDTIYLPKE-----RLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN--------
KPRS1_LACLA      VLDTIEMPEE-----RQSEKIVQLSIAHLLADAIIRIHERRPLSPLFELHLPSEQI---
KPRS_AGRFC       ITDSIQPTTG----VQSAHNIRVVSTAGLLGEAINRTAQEQSVSGLFD-----------
KPRS_RHIME       ITDSIQPTTA----VQSAHNIRVISTAALLGEAISRTSQEESVSSLFD-----------
KPRS_BRUME       ITDSIQPTTA----INDAPNIRVLSISDLIGEAIARTAAEESVSSLFD-----------
KPRS_RHILO       ITDSIQPTQG----VLDAPNIRVISIADLMGEAISRTATEESVSSLFD-----------
KPRS_CAUVC       VTDSIEASDP----AKACPKIRYVSCAPLIGEAIRRIANEESVSKLFD-----------
KPRS_ECOLI       VCDTIPLSDE----IKSLPNVRTLTLSGMLAEAIRRISNEESISAMFEH----------
KPRS_SALTY       VCDTIPLTDE----IKALPNVRTLTLSGMLAEAIRRISNEESISAMFEH----------
KPRS_YERPE       VCDTIPLSAE----IKALKNVRTLTLSGMLAEAIRRISNEESISAMFEH----------
KPRS_BUCAI       VCDTIPLSEN----IELLPNVRTLTLSGMLAEAIRRISNEESISAMFEH----------
KPRS_HAEIN       VTDTIPLSEE----MKAIGKVRVLTLSSMLAEAIRRISNEESISAMFN-----------
KPRS_PASMU       VTDTIPLSPE----IKALNKVRVLTLSGMLAEAIRRISNEESISAMFT-----------
KPRS_VIBCH       VTDSITLSKE----MAATGKVTQLTLSSMLAEAIRRISNEESISAMFN-----------
KPRS_NEIMA       VTDTIPLSEA----AKNCDRIRQVTIAGLLAETVRRISNEESVSYLFNEEVMTGSMLLP
KPRS_PSEAE       VTNTIPLSAA----AQACGRIRQLDIAPVVAEAMRRISNEESISAMFR-----------
KPRS_RALSO       VTDTIPLRDD----AAQCGKIRQLSTAPLLAETFTRIVRGDSIMSLFAE----------
KPRS_XANAC       VTDTIPLSEA----ARTCAKIRQLSVAELLAETIRRIAFGESVSSLYVD----------
KPRS_XANCP       VTDTIPLSAA----ARTCPKIRQLSVAELLAETIHRIAFGESVSSLYVD----------
KPRS_XYLFA       VTDTIPLSDA----ARECRKIRQLSVAELLAETIRRIAFGESVSSLYVD----------
KPRS_HELPY       VTNSIPL-------VQKCDKITTLSVAPLFAEVIRRIYHNESVQSLFT-----------
KPRS_HELPJ       VTNSIPL-------VQKCDKITTLSVASLFAEVIRRIYHNESVQSLFT-----------
KPRS_CAMJE       VTDTIPL-------KEQLPNIKVLSVTPVFAEVIRRVYHNESVNSLFI-----------
KPRS_MYCGE       DFLFVSNSIPQYK-FKAVKQFEVVDLASLYEEVVLCYANSLSVSAIYERHIEWIKKHV-
KPRS_MYCPN       DYLFVSNSIPQTK-FDQCPQFQVIDLAPLFEEVLLCYANNSSISAIYTRHIEWIKKHV-
KPRS_UREPA       NKICIADTIENEP-FDGLEIVSIAPAIAKCIEIYSEGTGSMSFVHDENSKVLFAKKIY-
KPRS_MYCPU       DEVIVTNSIDNYELAKKYKKLKIVSLAPFLSKVIRSIMDSKSVSDIYAKYLESK-----
KPRS_MYCLE       VTNTLPIGEE-----KRFPQLTVLSIAPLLASTIRAIFENGSVTGLFDGEA--------
KPRS_MYCTU       VTNTLPIGED-----KRFPQLTVLSIAPLLASTIRAVFENGSVTGLFDGDA--------
KPRS_CORGL       TTDTLPQSTE------GWSNLTVLSIAPLLARTINEIFENGSVTTLFEGEA--------
KPRS_STRCO       FTNTLPSASE-----LELDKITVLSIAPTIARAVREVFEDGSVTSLFDEQ---------
KPRS_DEIRA       SCNTVLVPQDKLD--RAGGKLAVLDVAPLFASAIANIHTGASVSTLFT-----------
KPRS_AQUAE       VTNTLPVYEK------KFGKLEVVSIAPLIGEAIRRIQEGTSVSSLFT-----------
KPRS_NOSS1       VTNTIPIPES-----DRFPQLVVLSVANLLGETIWRIHEDTSISSMFR-----------
KPRS_SYNE7       VTNTIPIPEE-----NRFPQLTILSVANLLGETIWRIHEESSVSSMFR-----------
KPRS_SYNY3       VTNTIPVPDD-----HHFPQLTILSVANLIGEAIWRIHEESSVSSMFR-----------
KPRS_THEMA       ITDTIYHE-------NLPEKVKVISVANLIGEAIMRIRKHLSVSTLFR-----------
KPRS_CLOPE       MLNTIALPEG-----EGLNKFKSLSVAPIMADAINRIYDDEPLSGLFQD----------
KPRS_CALS4       ITDTIPLPEE-----KKIDKIKVRSVAPLFAEAILRIHEGMSVSKLFT-----------
KPRS_CLOAB       ILNTIPIEGD-----KRIDKIKVLSVAPIFAEAIRRIYEDMPVSKIFQEE---------
KPRS_FUSNN       ITDSIALPER-----KKIDKIKILSVDSVFANAIDRITNNQSVSELFN-----------
KPRS2_STRP1      VTDSVKT-KN-----RVPENVTYLSASDLIAEAIIRIHERRPLSPLFSYQPKGKNNA--
KPRS2_STRP8      VTDSVKT-KN-----RVPENVTYLSASDLIAEAIIRIHERKPLSPLFSYQPKGKNNA--
KPRS2_STRPN      VTDSVAT-KE-----KTPKNVCYITASELIGDAIVRIHERKPVSPLFAYNKKK------
KPRS2_LACLA      VTDSVVT-NH-----RKPLNVKYLSAAEYLASAILRIHEGRPVSPLFEHEKPQD-----
KPRS2_LISIN      TSDSIDLPEE-----KQFEKLTTISIGRILGRAIEGVQENRSLHPLF------------
KPRS2_LISMO      TSDSIDLPED-----KQFDKLTTISIGRILGRAIEGVQENRSLHPLF------------
                     :                                    ..