CLUSTAL format seed alignment for MF_00586

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GATD_THEAC        ----------------------MERAVLRYK----NSVISGLIINE----SNGLITLKAS
GATD_THEVO        ----------------------MQNVEIIYK----NAKVRGILINE----ANGLITIKAD
Q6KZ70_PICTO      -------------------MDTGDIISFKYN----GRDYSGIYINE----SNGFYTLKLS
S0AS32_FERAC      -------------------MLIGQKIIFSYK----GQEYAGTYISS----GKNTITVKLG
GATD_PYRAB        --------MRVDEFLKERNINVGDFVRITKEEDGEEVTYEGYIMPPYELSAGDTLVLKLE
GATD_PYRHO        --------MRVEEFLKEKNINIGDFIRVIKEEDGEEVIYEGYVMPPYELSPGDTLVLKLE
GATD_PYRFU        --------MRVEEFLKQKGIEVGDYVRIIKVEDGEKVEYEGIVMPPYELSEGDTVVIKLD
GATD_METKA        MRVLSEYKGKAGELLREHGLSVGDRVRIVR-DDG--VVVEGIIMPRSELGDDEHIVVKMD
GATD_METJA        -------------------MNVGDVIRVET----DKGIFEGILLP---STNENIITIKMK
GATD_METTH        ----MSYQGRARKFLESASIDVGDMVLVEK----PDVTYEGMVLDRADDADDRHIVLKLE
GATD_METAC        -----------------MEFKQGDWVRIER----NGTVYEGKVMPS----MEGYITIKMK
GATD_METMA        -----------------MEFKQGDRVRIEK----NGTVYEGKVMPS----MEGYITIKMK
GATD_HALSA        -----------------MTADPGDRVRVTH----GDASHEGVLVPSP---SDDHLVVKLD
A7I697_METB6      -----------------------------------------------------MAVVKLA
GATD_ARCFU        ------MRPKSWGWISMSERLEGKRVRIKA----KGKIFEGIVMPS----FTGNFVLKLD
A0RZ07_CENSY      -------------------------------------------MPRYEGGG-DRLVLKLD
K0IDH1_NITGG      -------------------MEVGDNVKVATN----DGEMSGVLMPRYESASEDYIVIKLK
GATD_AERPE        -------------------------MEVRR---GDGSVFRGVLMPKHETSHPDTVVIKLG
GATD_PYRAE        ---------------------MYKKVRVVL---ENGDVFEGVMLPPTQFSDSDIVVLKLK
GATD_SACS2        --MQENYKGKAYDILKNLNIEEGDLIEIKK----GDLRIRGILLPSYS-KDDRIFVIKLD
GATD_SULTO        --MLEGYRGKALEFLSSHNVDVGDLIELQK----DGLSIKGVVMPSYS-KEDDIIVIKLD
GATD_NANEQ        --------------------MVGELYRFITD----FGVIEGYIIKE----EPNYYLIKLK
D2EFB0_9ZZZZ      ---------MAIKRIEMNNLSFEDLIEVVIN----NQIFNGEFIKE----EENLAVIKLK
                                                                          :*  

GATD_THEAC        NGYNMTFDRSEVEFIE----RKKEESPERKSIEAVEKG----------QGDRKISVLATG
GATD_THEVO        NGYNLTFDRSEVEILS----RVTIEEKKEKKTEVESFG----------TGEKSISILATG
Q6KZ70_PICTO      NGYNIIVDKSDVKIEA----IKKPENSE-PSKKIKYK-----------KGDKKLVIMTTG
S0AS32_FERAC      SGYNITVDASSIEIKK----EYSMEKGDKPGAETKNSG----------CGENGVCILTTG
GATD_PYRAB        NGYNIGIALEKIRR------IEVLERAKVKPEVHFEAL------IEGKPGLPEVTIIGTG
GATD_PYRHO        NGYNIGIALSKIRR------VEVIERAKVKPEIHFEAF------IEGKPHLPDVTIIGTG
GATD_PYRFU        NGYNIGIAIEKIQE------INVIEKAKAKPEVHFKAE------LEPRKELPTITILGTG
GATD_METKA        NGYNVGVRVDRIEK------LEAPGEGHEPSFKPMEGE------IEYDPKLPNVSVMSTG
GATD_METJA        NGYNVGILKENVKN------IEIIAKGEKPKYELPPLN------IEKNEKLKTISILSTG
GATD_METTH        NGYNIGVEISDAR-------IELLEKGSEPRIELPPVE------AAEDPELPDVSIISTG
GATD_METAC        SGYNAGFSIDKVRITLLENNGETANGSRNGGKGCKTNE---EELPEPGKKLPKIAILSTG
GATD_METMA        SGYNAGFSIDKVSITPLENNGEAANGGNGGKNGQKEPEPAKEKVSKPG--LPKVSILSTG
GATD_HALSA        SGYNVGVDTADADIDVLDADAVTVDGDTGEDAAGSTVE------FDDD--LPTIALISTG
A7I697_METB6      SGYNIGVEKACCTL---------VSPAPASTPRSAPIK------QDPK--LPELAIISTG
GATD_ARCFU        NGYNVGFKEYELLE--------VLEVEPFEPHLPELVK-------REG--LPDVKIISTG
A0RZ07_CENSY      SGYNVGIELGWIKG------VEKLPDIERPAAAAAAAP-----APAG--GLPKVLLLSTG
K0IDH1_NITGG      SGYNTGIQVGRIKS------ITKLQKSE-PAATTARAP-----ETTEDKGLPRIALISTG
GATD_AERPE        NGYNIGVLVGEGDD---IVVKGSLRPGTPGALVPLLEE------PLQPAE-ERVYIIGAG
GATD_PYRAE        NGYNVGFKKGRIKE---IVELGEVQT------APLSAK------PMPKIEGEKVWLLATG
GATD_SACS2        NGYNIGISIDNITE------IKPIEKKSSKDRESERRE-------VHNGAKSEIKIISTG
GATD_SULTO        NGYNIGVSISGISN------FKLVEKKRQNIQVNKGEQ-------KPLKEKSEVKIISTG
GATD_NANEQ        NGYNIGIKKSQIKE------MENLNEKIKVGQFPKRKP--------KGIGN--LGFIYTG
D2EFB0_9ZZZZ      SGYDIAIPKSSIDN------IKIIEKGNREETKQKENK--------KEIEDPDITIITTG
                  .**:  .                                              : .: :*

GATD_THEAC        GTIASRVDYETGAVSPVSDPELIFGGSDILTRFTVA--VKPILNEFSENLKPADWIRIGQ
GATD_THEVO        GTIASRVDYETGAVKPVSDPRLLFGGTELESKFNIR--VVNVMNQLSENMKPADWIHLAR
Q6KZ70_PICTO      GTIGSTVDYSTGAVRPVKDPEFIYNYIPYIDDFDIK--YEVLDNMLSENVTAEKMMNFAR
S0AS32_FERAC      GTIASSVDYTTGAVKPVKDISYLYNFVNNISQFKLY--HESIDNILSENVNAEKWVQFAR
GATD_PYRAB        GTIASRIDYETGAVYPAFTAEELAKAVPEIFEVANV-KPKLLFNIFSEDMKPKHWVKIAH
GATD_PYRHO        GTIASRIDYETGAVYPAFTAEELAKAVPEIFEIANI-KPKLLFNIFSEDMKPKHWIKIAH
GATD_PYRFU        GTIASRIDYETGAVYPAFTAEELAKAVPEIFEIANI-KPKLLFNIFSEDMKPKHWIEIAH
GATD_METKA        GTIACRVDYETGAVKPAFTAEELVGAVPELLDVINIVDARAVLDLLSENMEPKHWMKIAE
GATD_METJA        GTVASKVDYKTGAVHPSFTADDLIRAVPELLDIANI-KGRAVMNILSENMKPEYWRKIAE
GATD_METTH        GTVASIIDYRTGAVHPAFTADDLLRANPELLDIANI-RGRAVFNILSENMKPEYWVETAR
GATD_METAC        GTIASKIDYRTGAVTSQFTADDILAAIPELKEIADF-KGRVISSILSENMDSDSWQNLSK
GATD_METMA        GTIASKIDYRTGAVTSQFTADDILAAIPELKEIADF-KGRAISSILSENMDPDSWQNLAR
GATD_HALSA        GTIASTVDYRTGAVTAQFDAEDVLRAVPDLAGRANY-RGRVVANILSENMEPSIWQDLAA
A7I697_METB6      GTIASRIDYRTGAVTSQFDADDILTAIPALAEIGRY-RTKVLYTILSENMTPAIWQELAR
GATD_ARCFU        GTIASKVDYRTGAVTSQFTAEEIASEVPELTEICNV-DAELLYNILSENMKPENWIELAR
A0RZ07_CENSY      GTIASRIDYRTGAVTPALGPEEIYQSVPELAKIAEI-TPRVIFSEHSENLQPDHWKKIAE
K0IDH1_NITGG      GTIASKIDYRTGGVHAALSASELYASVPELANHASI-DPEVLLSEYSENLRPDHWTMIAD
GATD_AERPE        GTIASRVDYETGAVKPYLDASELATTIPELQRYASI-EAEQLFSILSEDMKPSMWEAIVD
GATD_PYRAE        GTILSRVDYVTGGVYPTLSVDYLFEVLGGLE--API-EAEEVTAKFSEDMTPALWGVIAE
GATD_SACS2        GTIVSRVEYETGAVRPALTTEEIIQFLPEINEIAKV-DAEVLFSILSENMKPEFWVKIAE
GATD_SULTO        GTIVSKVEYETGAVRPALTTEEIINFMPEINEIAKI-DAEVLFSILSENMKPEYWIKIAE
GATD_NANEQ        GTIGSKVDYLTGGVSAIMDIEELLAIADLPYDIK---IIDSPFVKFSEDLNPKDWVEIVK
D2EFB0_9ZZZZ      GTISSKIDYKTGGVSPSVDSDYYFKISPDLDKQGKI-SIINLMKKLSENMLPSDWIKIAK
                  **: . ::* **.* .                              **:: .        

GATD_THEAC        AVADESSE--ADGVVVAHGTDTMAYTSSALAFMF-ERMRVPVVFVGAQRSSDRPSSDSRE
GATD_THEVO        KVMDETKH--SSGIVVSHGTDTMSYTSSALAFMF-ERLAQPIIFVGSQRSSDRPSSDTKE
Q6KZ70_PICTO      RAYNYLKE--NIPVLIFHGTDTMQYTASALAFMF-EKLSAPVIFVGSQRSPDRPSSDAFI
S0AS32_FERAC      KARDAMKK--GNSVIIFHGTDTMQYSASALSFMF-EEQTEPIIFTGSQRSSDRPSSDAFL
GATD_PYRAB        EVAKALNSGD-YGVVVAHGTDTMGYTAAALSFML-RNLGKPVVLVGAQRSSDRPSSDAAM
GATD_PYRHO        EVAKSLNSGD-SGVVVAHGTDTMGYTAAALSFML-RDLGKPVILVGAQRSSDRPSSDAAM
GATD_PYRFU        ETAKALNSGN-EGVVIAHGTDTMGYTAAALSFML-RNLTKPVVLVGAQRSSDRPSSDAAM
GATD_METKA        EVVDALSDPDVEGVVIGHGTDTMAFTAAALSFVI-EGLNGPVVLVGAQRSSDRPSSDAAS
GATD_METJA        EIKKEIEE-GADGIVIAHGTDTMSYTASALSFMV-K-ADVPIILVGAQRSSDRPSSDAAL
GATD_METTH        AVYGEIKD-GADGVVVAHGTDTMHYTSAALSFML-R-TPVPVVFTGAQRSSDRPSSDASL
GATD_METAC        AVVEEIEA-GADGVIVTHGTDTMMYSAAALSFMI-K-TPVPIVFVGSQRSADRPSSDNAM
GATD_METMA        AVVEEIEA-GADGIIVTHGTDTMMYSAAALSFMI-E-TPVPIVFVGSQRSADRPSSDNAM
GATD_HALSA        AVREEIEA-GADGVVVMHGTDTMQFSASALSFML-E-TPVPVVFTGSQRSADRPSSDNVM
A7I697_METB6      AIHDEIKH-GVTGVIVTHGTDTMAYSAAAVSFML-D-TPVPVVFVGSQRSADRPSSDNAM
GATD_ARCFU        HVYKALK--DHEGVIITHGTDTMHFSAAALSFML-S-TPKPVVFVGAQRSSDRPSSDAAM
A0RZ07_CENSY      ELHAASGEG-FGGVIVAHGTDTMQYTASYLSFAL-SGFPAPVALVGSQRSPDRPSSDAAQ
K0IDH1_NITGG      KVAEKVRSGRYRGVVVSHGTDTMHYTAAALSFAL-QDLPIPVVLVGAQRSSDRPSSDAAL
GATD_AERPE        RAARVLEA-GYDGVVVAHGTDTMAFTASALSFAFHKGLPSPVILTGSQRSSDRPSSDAAF
GATD_PYRAE        RVAEAFKK-GARGVVVLHGTDTMQYTAAALAFAF-KSAPGPIALVGAQRSSDRPSTDAVL
GATD_SACS2        SVKKAFDE-GNTGIVIAHGTDTMAYTASALAFSL-RSLQGPVVLVGSQRSSDRPSSDSAI
GATD_SULTO        SAKKALDE-GNLGVVIAHGTDTMAYTASALAFSF-KSLTGPIVLVGSQRSSDRPSSDSPI
GATD_NANEQ        SIERTYKK-GAEGIIVAHGTDTMHFSSAYAYYAL-EN-PIPIAFTGAQRSSDRASTDAVI
D2EFB0_9ZZZZ      EAYNNISK-GSKGIIITSGTDTMHFASSALSFLL-NPLSSPVVFTGSQRSTDRGSTDAST
                               :::  ***** ::::   : .      *: :.*:***.** *:*   

GATD_THEAC        NMQAAINFA-GTDLGEVGISMHASTSDGHVSLLRSVRSRKMHTSRRDAFESIGIPPLAEY
GATD_THEVO        NMEGAINFA-ATDLGEVGIAMHKGISDGSIVLHRAVRSRKMHTSRRDAFESIDTVHLAEY
Q6KZ70_PICTO      NIGAAANFS-LMDLGEVSIAMHSYTSD-IVGLSRAVRTRKMHTSRRDAFKPIDDDYIAFF
S0AS32_FERAC      NIEGSIHFA-STDMGEVGIAMHTDTSDDSISLYRATRARKMHTSSRDAFKSISEPPLGLY
GATD_PYRAB        NLICSVRMA-TSEVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDVPIAKI
GATD_PYRHO        NLICSVRMS-TSDVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDVPIAKV
GATD_PYRFU        NLICATRMA-VSDAAEVMVVMHGETSDTYCLAHRGTKVRKMHTSRRDAFRSINDIPIAKI
GATD_METKA        NLIAACAFAGDGEVGEVTVCMHGWTSDEVCLVHRGVRVRKMHTSRRDAFRSVESIPIAKV
GATD_METJA        NLISAVLAA-REPIKGVYVVMHGESGDTFCYLHKGVKVRKCHSSRRDAFKSINSIPVAKI
GATD_METTH        NIQCSVRAA-TSEIAEVTVCMHATMDDLSCHLHRGVKVRKMHTSRRDTFRSMNALPLAEV
GATD_METAC        NAICAARVA-ISDIAEVVVVMHGTTSDDFCEIHRGTKVRKLHTSRRDAFKSVNSLPVGTV
GATD_METMA        NAICAARVA-ISDIAEVVVVMHGTSSDDYCEIHRGTKVRKMHTSRRDAFKSVNSLPIGTV
GATD_HALSA        NAVCAVEAA-KSDVAEVMVCMHATESDDRCALHRGTRVRKTHTSRRDAFETVGATPLGYV
A7I697_METB6      NGVCAALAA-ESDLGEVAVVMHATTNDDACAIHRGTRVRKMHTSRRDAFQSIGIPPVGTV
GATD_ARCFU        NLLCAAKAA-TEDIGEVVVCMHGSTSDDYCLVHRGVKVRKNHTSRRDAFQSVNAKPIGRI
A0RZ07_CENSY      NLAAAASFLTQVD-SGIYVVMHLDGNDGASACHLGTRVRKNHTSKRGAFQTVGGSPAYTI
K0IDH1_NITGG      NLLGATVFAAKSEYAGVFVAMHASTSDDAIACHIGTRVRKNHTSRRDAFESIDVTPVALV
GATD_AERPE        NLTASVLAASRAPFAEVAVVMHGETGDTYALAHRGVRVKKMHSSRRDAFQSVNDKPLARI
GATD_PYRAE        NLKAAIAVTARAPFAESVVVMHKTSGDTVVAVHRGTRVRKMHTSRRDTFQSINTTPIAEY
GATD_SACS2        NLLSAVITAKYAPFGEVVVNMHAESSDTYALVHRGVKVRKMHSSRRDAFQSVNDKPLAKV
GATD_SULTO        NLYSAILVAKNSPFAEVTINMHGESSDTYTLVHRGVKVRKMHTSRRDAFQSINDIPLAKV
GATD_NANEQ        NLFASSIYANSNIG-EVAIVMHETINDDTAIAIRGISARKMHSTRRDAFKSINEEPLARI
D2EFB0_9ZZZZ      NLLLSAFTAKNFQGGESVICMHANLNDGYNYILRGNKARKMHTERRDAFRPINIEPLAKV
                  *   :             : **   .*       .   :* *:  *.:*..:        

GATD_THEAC        --------------DGSVKFLIDYRRVSDTVEFRPDLDDRVSMIYFHPGLNAGDLENMIA
GATD_THEVO        --------------TSSVRFFSDYRKAEEENLLLDHLDEKVSIIYFHPGLVASDVENMIE
Q6KZ70_PICTO      --------------DGKLKINENYKKRDDETILMDKLNDNVSIVYFYPGMKSDDFSSLVS
S0AS32_FERAC      A-------------DGKVKEIKNIRHKSDSIILKDRLDKNIGLIYFYPGMAEEDFYNLSY
GATD_PYRAB        ----------WPNGEIEFLRKDYRKRSDEEVEVDDKIEEKVALVKVYPGISSEIIDFLVD
GATD_PYRHO        ----------WPNGKIEFLRDDYRRRSDSEVWVDDKLEEKVALVKVYPGISSEIIEFFID
GATD_PYRFU        ----------WSDGKIEFLRDDYRKRSEGEVWVDDKLEEKVALVKVYPGMSAELIDFLVD
GATD_METKA        DVKD------LRNPKIEFLRSDYRRPEDGEPEISGGFEEKVALVKFAPGMDPEVLDFYVD
GATD_METJA        NPFT---------KEIIYLQEVEKSDNSKKVEINTNLEEKVALIKVYPGMDGEIIRFYVD
GATD_METTH        TP-----------DGIKILEENYRKRGSDELELSDRVEERVAFIKSYPGISPDIIKWHLD
GATD_METAC        DYGT---------GEIKTFIDYTR-RGEKALKFKPGMEPKCALVKFTPGADPTVLDYYIS
GATD_METMA        DYDT---------GEIKTFIEYTG-RGEKSLKFKPGMEPKCAIVKFTPGADPSVLDCYVD
GATD_HALSA        DYDAASEAATADARGVTVEGAHAA-RGDATLDVASALEPAVELVKFTPGMNESLLAAC--
A7I697_METB6      DYAS---------RTVTLTGDAVK-RGTHKLALHDQLEPHCGLIQFYPGMSPDLLKAY--
GATD_ARCFU        DYPS---------LSVEWLSWRYR-RGERELKLTDRLERKVVLIKFFPGLSSDILEYYHS
A0RZ07_CENSY      RDGR------LEAGPGD-RLAPGEYRP------RIAVDPRASLVKYHPGYDPAVLDSILD
K0IDH1_NITGG      RNNT------IEMQKSEIKLAKRSEGSGSLATVKTKFDGKVALLKYHPGFDPSLIEHAAK
GATD_AERPE        YPFE---------GRVEMLRDDYRRRGESGLEVDNGFEERVALVKHFPGLISEVIDALLD
GATD_PYRAE        YPEK---------ELLQVLTDVYKERG--GLDYTAKFEEAVALVKFYPGMHPRLLEALLE
GATD_SACS2        LWKE---------RKLVMLNEKYISKKD-ETLLDAKFDNRVFLLYYYPGLDRDFLEQMLT
GATD_SULTO        FWKE---------KEIKLLRNDYIKRKE-ENALDAKFDTRVFLLKYYPGINPEIIEYLIS
GATD_NANEQ        YYPS---------GKLEIINKKYRKRSDKEMVAKPYLDTKGALIWVYPGFDPSILEYYR-
D2EFB0_9ZZZZ      HTDG---------KIDELSSEIIPK--NQNTKFNNKLDDNVKLIYSYPSMGGDIIDYYI-
                                                      .:    ::   *.     .     

GATD_THEAC        --EKHAVVILGTGLGHMAKDLIPVVKKYTAD---GNYAIMASQCIYGSTDLNVYSTGREL
GATD_THEVO        --GKHAVVIMGTGLGHIAKDLIPVFKNFTKD---GNFAIMTSQCIYGSVDMNVYSTGREL
Q6KZ70_PICTO      --GKDAVIIMGTGLGHVSDNIIEEIKR-HKD---TKF-FMTSQCIFGNTNLNVYSTGRKL
S0AS32_FERAC      --NKKAVIIMGTGLGHTSTGIIDVIRKLSRE---THF-FMTSQCIYGNVNMNVYSTGREL
GATD_PYRAB        -KGYKGIVIEGTGLGHTPNDIIPSIERAVEE---GVAVCMTSQCIYGRVNLNVYSTGRKL
GATD_PYRHO        -KGYRGIVIEGTGLGHTPNDIIPSIQRATEE---GIAVCMTSQCIYGRVNLNVYATGRRL
GATD_PYRFU        -KGYKGIVIEGTGLGHTPSDLIPSIKRAVDE---GVAVCMTSQCLYGRVNLNVYATGRKL
GATD_METKA        -RGYRGIVLEGTGLGHVSEQWLESIERAVDD---GIAVVMTSQCLYGRVNMNVYRTGRLL
GATD_METJA        -KEYKGIVLEGTGLGHAPEYIFEHIKYATDK---GVVVVMTTQTINGRVNMNVYSNGREL
GATD_METTH        -EGYRGIVIEGTGLGHCPDTLIPVIGEAHDM---GVPVAMTSQCLNGRVNMNVYSTGRRL
GATD_METAC        -NGYKGLVVEGTGLGHISTKWIPLLRKATDA---KMPVIVTSQCLNGRICDRVYDTGRDM
GATD_METMA        -GGYKGLVLEGTGLGHVSTKWIPFIRRAVDA---KMPVIVTSQCLNGRVCDRVYDTGRDM
GATD_HALSA        -EGSAGVVIEGTGLGHVHSDLTDTIGSLVDD---GTTVVMTSQCLEGRVCDRVYDTGRDL
A7I697_METB6      -EGYKGLILSGTGLGHVSTAMIPQIKNLVAG---GTQVVMTSQCMHGRVCDRVYDTGRDL
GATD_ARCFU        -KGYRGFVIEGTGLGHVSTDWIDTLRRVCED---SV-VVMTSQCLWGRVCDRVYDTGRDI
A0RZ07_CENSY      -AGARGIIFEGTGLGHVGRQMYEAVGRAAEK---GVFMGMTSQCIDGRVSMTVYESGRDL
K0IDH1_NITGG      -AGYRAIILEGTGLGHVSKECFPALRKVVDS---GMMVCMTSQCIWGRIRMTVYDTGRDL
GATD_AERPE        -RGFKGIVVEGTGFGHVSSDAIKSIERARDQ---GVPIVITTQTVFGRVNLNVYSTGRKM
GATD_PYRAE        -VGMKGVVIEGTGFGHVGEGVLPAVKKLIDA---GVIVAMTSQTLYGRVNLYVYRRGREL
GATD_SACS2        NTKIRGIIIAGTGLGHTSSDHIELFRKATKD---GIFIGMTTQCLFGRVNMNVYTTGRQL
GATD_SULTO        -SGIRGIIVEGTGLGHTSTEFVDYFKKATKD---GVFIGMTSQCLFGRVNMNVYTTGRLL
GATD_NANEQ        NYR--GIIIAGTGMGHTSKELIPMLKELSKD----LFIGITTQCIYGITHPYVYSRGREL
D2EFB0_9ZZZZ      DNKVHGIVIAATGFGNLPLEDKTIINALKKAEKNSIPLVITPQTIYGSTNKFVYSTLREI
                       ..:. .**:*:        .              ::.* : *     **   * :

GATD_THEAC        LAAGVIE-AGNMVPEVAYVKAMYLLGQYPH--DLFRDLFRKNMRGEIVERDLPVEIIKLG
GATD_THEVO        IAAGVIS-AGDMVPEVAYVKAMFTLGNYGR--EEFINVFNRNLRGEILNRLIPREVYI--
Q6KZ70_PICTO      IDAGVIS-LGNMLPETAYVKAMYILGSHP---DKLEEMMLLNLRGELSDRILLR------
S0AS32_FERAC      IDAGVIP-LQNMLAETAMVKAMYLSANYP---DNFVELMQKNLRGEFEDTVK--------
GATD_PYRAB        LKAGVIP-CEDMLPETAYVKLMWVLGHTQNL-EEVRKMMLTNYAGEITPYTRFDTYLR--
GATD_PYRHO        LKAGVIP-CEDMLPETAYVKLMWVLGHTQDL-EEVRRMMLTNYAGEITPYTRFDTYLR--
GATD_PYRFU        LKAGVIP-CEDMLPETAYVKLMWVLGHTNDL-REAKKMMLTNYAGEITPYTKPNTFLI--
GATD_METKA        RAVGVIP-GEDMLPEVAYVKLMYVLDRTDDI-KEVERLMRTNIAGEIEGGRVLGGFEPAD
GATD_METJA        QKLGVIG-CEDMPPEVALVKLMYLLGNYE-P-EEVKKLINKNLVGEIEYRSRFDAY----
GATD_METTH        LQAGVIP-CDDMLPEVAYVKMCWVLGQTDDP-EMAREMMRENIAGEINERTSIAYFRG--
GATD_METAC        LKAGAIE-GEDTLPETALVKLMWVLGQTDDF-EKAAGMLREDLSGEITECTQR-------
GATD_METMA        LKAGAIE-GEDTLPETALVKLMWVLGQTDEF-EKAVSMLGENLSGEINECTLR-------
GATD_HALSA        LAAGVVE-AGDTLPGTAKVKLMWALANADDPEAAMQESVAGALTTQSRPWTA--------
A7I697_METB6      LAAGVIE-GGDMLPEVALVKQMWVLGNEKDP-AKAATMMATDLKGECMRRSAHGL-----
GATD_ARCFU        LRAGVIE-GEDMLPEVALIKLMWLLGNYSIE--EAKEMVKKSVAGEIEPTTQY-------
A0RZ07_CENSY      LGLGITP-LGDMLSETALVKLMWALGIKDDI-KGVRNIMLDRIAGEFSPGVF--------
K0IDH1_NITGG      LDIGVVP-LSDMISETATVKAMWALANSKDP-K---KTMQENLANEISSSIPI-------
GATD_AERPE        LAAGAIP-AGDMTSEAAYAKLSWILARTREL-EVVRKMFQRNLAGEVSERHILRLYRHIG
GATD_PYRAE        LSMGVIP-LEDMLPETAYAKMSWALANFKR--EEVPRVLTTPIAYEMSPRSDPLVFGGL-
GATD_SACS2        LDAGVTP-LEDMLPEVALVKLMWVLAHEQDL-EKIQNLMITNLVGEINPRHTLDLFPRWS
GATD_SULTO        QESGVTP-LEDMLPETALVKLMWVLAHESDL-DKIRSLMLTNFVGEINYRHVPEYFPRWF
GATD_NANEQ        SKFATYL---QGTPEKNYVKLLYVLGKESDL-DGIKKEMKRLP-----------------
D2EFB0_9ZZZZ      SKFDNIIYVGDMTTETAFVKLMFALGNSKKM-EEIKKIMSTNLAGEIKDRSKINEFLI--
                            :  .     *  :               .                     

GATD_THEAC        R------
GATD_THEVO        -------
Q6KZ70_PICTO      -------
S0AS32_FERAC      -------
GATD_PYRAB        -------
GATD_PYRHO        -------
GATD_PYRFU        -------
GATD_METKA        GPHHRL-
GATD_METJA        -------
GATD_METTH        -------
GATD_METAC        -------
GATD_METMA        -------
GATD_HALSA        -------
A7I697_METB6      -------
GATD_ARCFU        -------
A0RZ07_CENSY      -------
K0IDH1_NITGG      -------
GATD_AERPE        GV-----
GATD_PYRAE        -------
GATD_SACS2        YE-----
GATD_SULTO        HDGIRLQ
GATD_NANEQ        -------
D2EFB0_9ZZZZ      -------