CLUSTAL format seed alignment for MF_00587

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRMYL_VIBCB      -MRSFVLRARAAPTTSK--ALLEGVGNEAHTEILAHTMMNTMFVAQSHREDVVVHFVLES
TRMYL_VIBPA      -MRSFVLRARAAPTTSK--ALLEGVGNEAHTEILAHTMMNTMFVAQSHREDVVVHLVLES
TRMYL_VIBVU      -MRTFVLRARAAPTNSR--ALLEGVGNEAHTEILAHTLMNTMFVAQSHRQDVVVHLVLES
TRMYL_ALCBS      -MRTFVLRARAASTHSQ--TLLANVGGDAHSEILAHTLMNAIFVAQSHRDDVVVHLVLES
TRMYL_VIBCH      -MRSFILRARSAPTDSQ--RLLDEIGGKCHTEILAHCMMNSLFTAQSHREDVVIHLVLES
TRMY_METMP       -MKEFIIKANKAVTNGE-INLKDLPGSSGRLDLLCRCVNSAFFLSHDMRRDTIFYSVNYG
TRMY_METM7       -MKEFIIKANKAVTNGE-INLKDLPGSSGRLDLLCRCVNSAFFLSHDMRRDTIFYSVNYG
TRMY_METM5       -MKEFIIKANKTVTNGE-INLKDLPGSSGRLDLICRCVNSAFFLSHDLRRDTIFYSVLYG
TRMY_METVS       -MKEFIIKANKAVTNGE-INLKDLPGSSGRLDLICRCVNSAFFLSHDLRRDTIFYSVNYG
TRMY_META3       -MIEFIFKANKSITNGE-INLKDLPGSSGRMDLVCRCVSSAFFLSHDLRRDTIFYSVHYG
TRMY_METJA       -MREFIFKANKTITSSD-INLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYG
TRMY_PYRAB       -MRVFIIKANEAHTAND-FSLKDLPGTSGRIDLICRALNSAFHLSHSFRKNVRVYVTLLG
TRMY_PYRHO       -MRVFIVKANEAHTDYD-FSLKDLPGTSGRIDLICRALNSAFHLSHSFRKNVRVYVTLLG
TRMY_PYRFU       -MRIFIIKSSTAHTAFD-YSIKDIPGTSGRLDLICRSLNAAFQLSHSFRKNVRVYTVLYG
TRMY_THEKO       -MRTFILKANTAVTSPD-FSLKDLPGTGGRIDLLCRFLNSAFLLSHGIRKDVRVFMTLYG
TRMY_METKA       -MREFLVLFNHAPTSPDRVRLKDLPG-SGRFDLVCRVTTQALLYSHGVRTDTVVHLLLRG
TRMY_ARCFU       <VRGFLIVGNKAFTQP--FSLNDLPG-AGRMDVLCRCTSQALFISHGIRRDVEVYLLLLG
TRMY_HALMA       -MRQFVIIGHDAPTTPE-FSLDDLAGAAGRLDVLCRCVTSAFFLSHAIREDVRVHLILGD
TRMY_NATPD       -MRQFIVIGHDVPTDPDAVSLADLPGA-GRLDVLCRCLNSAFFLSHDLRDNVRVWLVVGD
TRMY_HALSA       -MRQFVVLGHDAPTTPD-FPLDDLPGAAGRLDVLCRCVSAALFVSHGIRDDVEVFLVLGD
TRMY_METAC       -MRDIVIIGHKAKTSGD-FSLNDLPGSAGRMDILCRCVSSALFLSFGMRRDVNVHLLLLG
TRMY_METMA       -MRDIVIIGHKAKTSGD-FSLNDLPGSAGRMDILCRCVSSALFLSFGMRRDVNVHLLLLG
TRMY_METBU       -MRNFVIIAHKALTTGD-FSLNDLPGSAGRMDILCRCINSCLFLSHDLRRDVQVHLLLLG
TRMY_METTP       -MRDFVIVGHIAKTTPD-FSLEDLPGTSGRIDVLCRCVNSAFMLSHGIRRDVRCHLILMG
TRMY_METLZ       -MLRFAVIGHKAVSTPD-FSLNDMPGGAGRMDVLCRCINASFFLSHDLRRDTECFLILKG
TRMY_METHJ       -MTSFTVIGHTACTDAS-FPLDDLPGKGGRMDLLCRAVASSLFLSHGIREDTTCDIMLLG
TRMY_METAR       -MRRFVVVGHRAVTTPK-FSLNDLPGGAGRMDIIARCVNASLFLSHDLRRDVEFFAILLG
TRMY_AERPE       -MSLYVVISPTGRTDGN-IPARGYAGPSGRLDVIARAYNAIL------EPNATLAALLMG
                  :    .      :           *   : :::.:     :      . :.       .

TRMYL_VIBCB      ----TKDFSRTITIRSNDITNIG-GFHESTLIAAVARALDASVG---MGKEQLREVEPGI
TRMYL_VIBPA      ----TKDYSRTITIRSNDITNIG-GFHESTLIAAVARALDASVG---MGKEQLREVEPGI
TRMYL_VIBVU      ----TKDFSRTITIHSNEVSNVG-GFHEANLLNIVVRALDASTG---MGKEELRNVEPGV
TRMYL_ALCBS      ----TQDYSRTITFVAAEMRDIG-GFHEQALLAKVVRALDASAG---MGKEQMKAVESGI
TRMYL_VIBCH      ----TRDYSRTITVEANEISDVG-GFHEAALIALLVKALDASVG---MGKEQTRVVQPGL
TRMY_METMP       ----SPNPPVALKFVGSELKRV--SPDERSIALFIKKALEK------DASELWKESTSGI
TRMY_METM7       ----DPNPPVTLKFVGSELKRV--SPDERSIALFIKKALEK------DATELWKESTSGI
TRMY_METM5       ----PPNPPIALQFVGNELKRV--SPDERSIALFIKKALEK------DASELWKESTSGI
TRMY_METVS       ----NPNPPVALKFIGDELKRL--SPDERSIAMFIQKALSK------DASEIWKESTSGI
TRMY_META3       ----APNPPVAIKFVGSELKRV--SPDERSIALFIKKALDK------SPMQLWKESTSGI
TRMY_METJA       ----QPNPPVCIKFVGSELKKV--SPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGI
TRMY_PYRAB       ----PPDPPKSLRFEGPELKPKILNPDELSTAKIIGKALER-GKDIKRKSTEEIKVLPGI
TRMY_PYRHO       ----PPSPPKTIRFEGPKLRPKILNPDELSIAKVIIKALNA-GKNLKGSSTKELEVLPGV
TRMY_PYRFU       ----PPDPPKTIRFEGAKIKPKTLNPDEVSTAKLIGKILNA-GKDIK-EPTKEREVLPGI
TRMY_THEKO       ----RPNPPKTIHFEGPKLKVR-LNPDERSTALILKKALKI-GEDLR-EPTKEVEVFPGV
TRMY_METKA       ----PDDPPKTITVTGRRVRRLY--PDERTTAIHLRRALEA------DPDT---EPHPGI
TRMY_ARCFU       ----PPSPPKSILIKGDEVRRMS--PDERNVAGHIKKALAV------ECGKSWKKVHSGV
TRMY_HALMA       --------EYTVTFEGSDLRRLN--PDERSTAALIRKALEEREE---AIGHIPVETSPGV
TRMY_NATPD       --------EYAIRFEGSELRRLN--PDERSTAALVRGALAAREK---AIGSMAANPSPGV
TRMY_HALSA       --------EVTVRIDAGAVQYMH--PDERNVAGLLKQALDAKTE---AIGHQEASSSPGI
TRMY_METAC       ----EPEPGKIIRFEGLHLRYLN--PDERSSGSLIQKALQK------TVTEKDIRSTPGV
TRMY_METMA       ----EPDPGKIIRFEGLHLRYLN--PDERSSGSLIQKALLK------NAAGQDIRSTPGV
TRMY_METBU       ----EPEPGKIIRFDSEHVRYLN--PDERSAGSLIKKALQK------TAGEYEVRSTPGV
TRMY_METTP       ----GPEP-KILRFDGSRLRHLN--PDERSTAALIKRALSI------DASPSWRESTPGI
TRMY_METLZ       GEQADPANTVTLRFSGEKIKSLN--PDERSAGALIKKALVT------IPEEEYQRAAPGI
TRMY_METHJ       ----QPHPGRIIRFDGSALRSLS--PDERNIASSIKRALAI------PAGKTFREAGPGL
TRMY_METAR       ----EPTPPVTIKFSGEHVRYLS--PDERSPAALIKKALERG-----IPVEGEAEATPGV
TRMY_AERPE       ----GPLPPRLLIAPLSCKDIVR---SERSFMIEASRALRG--------------RRSCF
                            :               *          *                  . .

TRMYL_VIBCB      TVRTVSFERLVQELAED-HQLYMLDKKGEFVRDAEIGG------NPCFLLTDHIPMPKKS
TRMYL_VIBPA      TVRTVSFERLVQELAED-HQLYMLDKKGEFVRDAEIGE------NPCFLLTDHIPMPKKS
TRMYL_VIBVU      TVRTISFERLVQQLAEN-HQLYMLEKKGEFVRDIKFAA------NPCFLLTDHIPMPKKT
TRMYL_ALCBS      TVRTQSFEKVVKELAEDGHQLYMMDPKGENIRELDFAQ------KPCFLLTDHIPMPKKS
TRMYL_VIBCH      TVRTISFEALLGELAEH-HSLYMMDKKGDSIRDIKIGP------NPCFILTDHIPMPKKS
TRMY_METMP       YSSKREFRDIILEKKNEGKRIFYLHLNGKPLEDFEFKNQ--DDEDFLFVLGDHIGIGDED
TRMY_METM7       YSSKREFRDIILEKKNEGKRIFYLHLNGKPLEDFEFK----DDEDFLFVLGDHIGIGDED
TRMY_METM5       YSSKWEFRDIILKKKNEGKRIFYLHLNGKPLENFEFK----NDEDFVFILGDHIGIGEED
TRMY_METVS       YYSNHEFKEIILEKKNSGKKIFYLHLNGKPLENFDFK----NESDVVFILGDHIGLSKED
TRMY_META3       YIAKKEFKDIILEKKNEGKEIYYLHKDGEDIENIFNKENNAENKNIVFILGDHIGIGEED
TRMY_METJA       YVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIE-------NPVFIIGDHIGIGEED
TRMY_PYRAB       YVSNMSFEDVIRVVIK-RFPLYILEEDGKDITEVEFPKN-----NVAFVLGDHIGLSSED
TRMY_PYRHO       YVSNMTFEDVIRKNI--RMNLYVLEEGGADIMKVKFPRN-----NVAFILGDHIGLSEED
TRMY_PYRFU       YISRMTFEDVVRKNI--KYNLYLLEENGVDIEKVKFPQD-----NVGFILGDQNGFTEEE
TRMY_THEKO       YVSNMTFEDVVRRVMK-DSTLYYLVEDGKPITEIEFPQ------NPAFVLGDHLGLSKED
TRMY_METKA       FVRRADLEDLL-GEMKGA-KLYYLSEDGRDLEEVEPEP------DAVFVLGDHEGPTPEQ
TRMY_ARCFU       YVSRKGLEELI-EELSEKYSIIYLKEDGVDISNAQLPP------NPLFVIGDHEGLTEEQ
TRMY_HALMA       SLTRRGFEGTLDDVAR-RGTVVQLHEDGDPIVGVAPPS------DPVFVLSDHHDFRDEE
TRMY_NATPD       YIRTQSLSGLLESVAD-DGPLVTLHEDGQPVVDIDPSA------EPTFVLSDHHSFDDAE
TRMY_HALSA       HVSKRGFEAVLDAVS---GPVVALHEDGDALAAVDPLA------DPVFVLSDHRDFTAAE
TRMY_METAC       WVRNGDLNTLLASFE--GRTLFYLREDGEDIRGLDREIR-----DPVFILGDHMGVTEEE
TRMY_METMA       WTRTGDLNSLLASFE--GRTLLYLREDGKDFREIAREIQ-----DPVFILGDHTGVTEEE
TRMY_METBU       FIRSGNLGTLLNEFKDAGRRLIYLHEDGEDIRELSDLTN-----NAVFILGDHMGVTEEE
TRMY_METTP       YIRKGDLRSLLESLRDEGQRLYYLREDG---APLSESVS-----DGVFVLGDHTGMTGDE
TRMY_METLZ       SIRKSGLAKLLEEHP----FAV-LDENGEDIR--TAETL-----PENFILSDHQNFTEEE
TRMY_METHJ       LTRKGTLADQLSEKH----YAV-LDESGVDIRKVATEEL-----PDAFLLSDNRNFSDDE
TRMY_METAR       YISKRSFADLINGMD----NLVYLHEDGEDIRS-VELTG-----NETFVLSDHQNLTPEE
TRMY_AERPE       TVNDEGVEALASLLRRFKPRILLAEKGGDISSHWGEMCS----SSPTFIAGSHLDPPHGL
                       .                    *                   *:  .:       

TRMYL_VIBCB      YNSLKR--LGTEKISLGPKMLFASQCVVLIHNELDIREF---------------
TRMYL_VIBPA      FNSLKR--LGTEKISLGPKMLFASQCVVLIHNELDIREF---------------
TRMYL_VIBVU      FNSLKR--LGTQNISLGPKMLFASQCVTLIQNELDLQE----------------
TRMYL_ALCBS      FNSLKR--LGTEKISLGPTMLFASQCVVLINNELDLAGF---------------
TRMYL_VIBCH      GNSMKR--LGVEKISLGPKMLFASQCVTLIHNEIDHQEAGW-------------
TRMY_METMP       EEFLEE--IGAEKISLSPLELHADHCIILVHNILDRLK----------------
TRMY_METM7       EEFLEE--IGAEKISLSPLELHADHCIILVHNILDRLK----------------
TRMY_METM5       EEFLEE--IGAEKISLSPLELHADHCIILVHNILDKLK----------------
TRMY_METVS       EEFLEE--IGAEQISLSPLELHADHCIILVHNVLDRLK----------------
TRMY_META3       EKFLED--IGALKVSLSPLELHANHCITIVHNALDKAKLK--------------
TRMY_METJA       ERFLDE--IKAKRISLSPLELHANHCITIIHNVLDKKRICEI------------
TRMY_PYRAB       LSFLES--V-GMKVSIGPKAYLTSHVIAYVNIYLDRLGIP--------------
TRMY_PYRHO       LKTLEG--I-AKKISIGPKAYLTSHVISYVNIHLDRIGVP--------------
TRMY_PYRFU       LNFLEG--L-VPKITIGPKPYLTSHVIAFVNIYLDRIGIP--------------
TRMY_THEKO       ERFLEG--I-AKKVRIGRRSYLASHVVAFVNIWLDGM-----------------
TRMY_METKA       DRLLRR--HADAVISLGPIPYHADQCIVILHRYLDVKRPPEYAHGPSNVM----
TRMY_ARCFU       EKVVER--YAALKLSLSPLSLLAEQCVVIAHHHLDRLQF---------------
TRMY_HALMA       AALLAD--RADERVSLGPKALHADHSITVAHNYLDTAGFERY------------
TRMY_NATPD       TALLAA--HADRRVSLGPEPLHADHAITVAHNYLDTDGYNRY------------
TRMY_HALSA       ASLLAD--ASDHRVRVGPTVLHADHAITVAHNHLDTAGFDAY------------
TRMY_METAC       EKQLLE--AGAKIISVGPISLHSNHCITLLHNELDRAEAERGEIPGGEKLRAGE
TRMY_METMA       EKQLLE--AGAQVISVGPISLHSNHCITLIHNELDRAEAERGEIPGGNISRPED
TRMY_METBU       EQLIKE--HEAKTISLGPIPLHADHCIILINNEIDRNLSGKSQ-----------
TRMY_METTP       EHLLDS--MGAETVSIGPLSLHADHCIVIVNWMCDNAALRR-------------
TRMY_METLZ       MELI----KDLPKYSVGPRVLHADHTIIIILNEFDRRGEQA-------------
TRMY_METHJ       MELI----RDIPKYSLGPAIVHADHAIVLILNEIDRRRSGWI------------
TRMY_METAR       EAVLEA--KGAKKVSLGKKLYHADHCIVMVNWETDRR-----------------
TRMY_AERPE       IKHLERSLGGFLRVSVGPLSLHTDHVFLLVSALRLPMHATSIEHH---------
                    :           :.     :.: .