CLUSTAL format seed alignment for MF_00589

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBU_NOSS1      MKGLVRLLTVFSLL-LGCWGWLGTTQIAQAGSLQSFLVPQIPVLAIER-QNRADAKLATE
PSBU_TRIV2      MKGLVRLLTVFSLL-LGCWGWLGTTQIAQAGSLQSFLVPQVPVLAIES-QNRADAKLATE
PSBU_PHOLA      MKRLVGVLMILGLM-LTSWGLLGSPQTAIAASLSPLSFNPSPVLAEQQFRNAMDDKLATD
PSBU_THEVB      MQRLGRWLALAYFVGVSLLGWINWSAPTLAATAST----------EEELVNVVDEKLGTA
PSBU_SYNJB      MRWLLSILVRVVLV-LCLC-------FAPLGIPVVAR--------------AAELPPVKH
PSBU_SYNJA      MRRLLSALVSILLL-LCLC-------LVPLGIPAVA----------------AELPPVKH
PSBU_SYNY3      MKFISRLLVACSLL-IGL--------MGFLGADLAQA---LTPNPILAELNAVDAKLTTD
PSBU_CROS5      MKTIVRLFAILMVL-ISS--------VGFVGSAVA------------AELNPVDAKLTTE
PSBU_MICAN      MKNLVRLLAVIALI-IGSFWGK----VPAQALNLTSI---ALPSLPVAVLNAADAKLTTE
PSBU_SYNP2      MSRVVSALMGLVLM-FGCAFFS----VQPQAQALDLSNGFVSAAVLGERVNPADKVLESE
PSBU_TRIEI      MKKIGLLLTIFSLC-LGCLGLVPSDKAHAGNLNLTTWPSASILAVESRTVNNADKKL-GE
PSBU_SYNE7      MKQLAQRLFSLALVLALVLGI------SVQSAQALSLQSPLLAVAEAEIRNEADAQR-IE
PSBU_SYNP6      MKQLAQRLFSLALVLALVLGI------SVQSAQALSLQSPLLAVAEAEIRNEADAQR-IE
PSBU_SYNSC      MKRLLSWLTGALVMASLMAG-------LVMPSSVYADDDLRNKYSGNEIRNIADDKI-AA
PSBU_PARMW      MKRLLSWLTGALLMAGLLAG-------LILPGSVHADEDLVGKYSGNEIRNIADDKI-AA
PSBU_SYNS9      MKRLLSWLTGALVMAGLLSS-------LVLPSAVYAEEDLLGKYSGSEIRNVVDDKI-AE
PSBU_SYNPW      MKRLLSWLTGLVVMAGLLFS-------LATPSGVQA----------ADIRNVADDKI-AE
PSBU_SYNS3      MKRLLSWLTGLVVIAGLLIG-------LLVPPSVSA----------AEIRNVADDKL-AE
PSBU_SYNR3      MSRLFRRLSTLLLCSLLVLGVW-----LTQPLSVQA----------AEIRNKVDDKI-AE
PSBU_PROM3      MKRLLSLLTGVLVMTGLLMA-------LIFPQSAYA--------------NVSDEKL-GD
PSBU_PROMM      MKRLLSLLTGVLVMTGLLMA-------LIFPQSAYA--------------NVSDDKL-GD
                *  :   :    .                                        :      

PSBU_NOSS1      FGEKIDLNNTNVRAFQQYPGLYPTLAKKIIQNAPYGKVEDVLNLPGLSDGQKQLLQSNFD
PSBU_TRIV2      FGKKIDLNNTNVRAFQQYPGLYPTLARKIIQNAPYSKVEDVLDLPGLSDGQKQLLQSNFD
PSBU_PHOLA      FGKKIDLNNTNVRAFMQYPGMYPTLARMILKNAPFESVEDVLKMPGLTDTQKEILKNNFS
PSBU_THEVB      YGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLE
PSBU_SYNJB      LDTPIDVNNTILRNYRQLPGFYPTLARILVKNAPYKSLEDMLQISGLTEQQKALIKANAE
PSBU_SYNJA      LDTPIDVNNTILRNYRQLPGFYPTLARILVKNAPYNSLEDMLQIPELTEQQKALIKANAE
PSBU_SYNY3      FGQKIDLNNSDIRDFRGLRGFYPNLASEIIKNAPYDTVEEVLDIPGLSETQKSRLEANLG
PSBU_CROS5      YGQKIDLNNEDVRGFRQLRGFYPNLAAKIIKYSPYDSVEEVLDIPGLSERQRQRLEANLD
PSBU_MICAN      FGAKIDLNNSDIRDFRDLRGFYPNLAGKIIKNAPYEEVEDVLNIPGLSDTQKERLQANLE
PSBU_SYNP2      YGKKIDLNNASVRLFRELRGFYPTLAKRIIENAPYDSVEDVLNIPDLSEKQLARLEENLE
PSBU_TRIEI      IGEKLDLNNSPLRSFRKYRGMFPTIAAQIVDNAPYEKVEDVLEMPGLTEEQKKLLEANLK
PSBU_SYNE7      AGGKLDLNNIGVRAFQQFPGMYPYLASKIVLGGPYDSVDDVLKLD-LSDRQREVFEQYKE
PSBU_SYNP6      AGGKLDLNNIGVRAFQQFPGMYPYLASKIVLGGPYDSVDDVLKLD-LSDRQREVFEQYKE
PSBU_SYNSC      RDGKVDLNNSSVRRFQQFPGMYPTMAGKIVLGGPYDSVDDVLSLD-LTERQQELFAKYRD
PSBU_PARMW      REGKVDLNNSSVRRFQQFPGMYPTMAGKIVLGGPYNDVDEVLNLD-LSERQIELFNKYKE
PSBU_SYNS9      REGKVDLNNSSVRRFQQFPGMYPTMAGKIVLGGPYNNVDDVLELD-LSERQKELFAKYRD
PSBU_SYNPW      RGDKVDLNNSSVRRFQQFPGMYPTLAGKIVLGGPYESVDDVLALD-LTDRQKELFEKYRD
PSBU_SYNS3      RGDKVDLNNSSVRRFQQFPGMYPTFAGKIVLGGPYENVDDVLKLD-LSERQKELFEKYRD
PSBU_SYNR3      TAGKVDLNNASVRRFQQYPGMYPTLAGKIVVGGPYDQVEDVLKLD-LTERQKELFEKYKE
PSBU_PROM3      RGEKVDLNNSSVRAFRQFPGMFPTIAGKIVVGGPYSSVSDASSV--LDASQKSVFDKYKD
PSBU_PROMM      RGEKVDLNNSSVRAFRQFPGMFPTIAGKIVVGGPYASVSDASSV--LDASQKSVFDKYKD
                    :*:**  :  :    *::* :*  ::  .*:  :.:   :  *   *   :     

PSBU_NOSS1      KFTVTELEPAFNEGDDRFNNGIYR
PSBU_TRIV2      KFTVTELEPAFNEGDDRFNNGIYR
PSBU_PHOLA      NFVVSPPLDALVEGGDRFNNGIYR
PSBU_THEVB      HFTVTEVETALVEGGDRYNNGLYK
PSBU_SYNJB      NFVFGEYQEGANQLENRINQGYYG
PSBU_SYNJA      NFVFGEYQEGANQLENRINQGYYG
PSBU_SYNY3      SFTVTEPSIELTSGDDRINPGVY-
PSBU_CROS5      KFVVTPPSSELNEGGDRINPGLY-
PSBU_MICAN      KFTVTEPSKEFIEGDDRFNPGVY-
PSBU_SYNP2      RFTVTPPADVFIDGDQRLNTGDY-
PSBU_TRIEI      NFTVTKTADVYNEGDYRLNTGSYD
PSBU_SYNE7      NFTVTPPRDALNEGDDRINNGIYR
PSBU_SYNP6      NFTVTPPRDALNEGDDRINNGIYR
PSBU_SYNSC      NFTVTPPSIALNEGDDRINDGQYR
PSBU_PARMW      NFTVTPPEIALNEGDDRINDGQYR
PSBU_SYNS9      NFTVTPPSIALNEGDDRINDG---
PSBU_SYNPW      NFTVTAPSIALNEGFDRINDGQYR
PSBU_SYNS3      NFVVTAPSIALNEGFDRINDGQFR
PSBU_SYNR3      NFTVTDPEIALNEGFDRINDGQYR
PSBU_PROM3      NFTVTDQEIAVNEGFDRINDGQYR
PSBU_PROMM      NFTVTDQEIAVNEGFDRINDGQYR
                 *..        .   * * *