CLUSTAL format seed alignment for MF_00596

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GUAC_ECOLI            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHSGQSWSGVPIIAA
GUAC_SHIDS            -------MRIEEDLKLGFKEVLIRPKRSTLKSRSDVELERQF-TFKHSGQSWSGVPIIAA
A0A077ZKL2_TRITR      -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHSGQSWSGVPIIAA
GUAC_SALTY            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHSGQTWSGVPIIAA
GUAC_SALAR            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHSGQTWSGVPIIAA
GUAC_CITK8            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHSGQTWSGVPIIAA
D2TGP0_CITRI          -------MRIEEDLKLGFKDVLIRPKRSTLKSRSEVELERQY-TFKHSGQSWSGVPIIAA
GUAC_ENT38            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHSGQTWSGVPIIAA
GUAC_KLEP7            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELEREF-TFKHSGLTWSGVPIIAA
I2BCR2_SHIBC          -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFKHAGITWSGVPVIAA
A0A089R8G6_PLUGE      -------MRIEEDLKLGFKDVLIRPKRSTLKSRSEVELEREY-TFKHSGLTWSGVPIIAA
GUAC_SERP5            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSEVELERQF-TFKHSGLSWSGVPIIAA
GUAC_YERPE            -------MRIEEGLKLGFKDVLIRPKRSTLKSRSEVALERQF-TFKHSGWNWSGVPIIAA
H2IR16_RAHAC          -------MRIEEDLKLGFKDVLIRPKRSTLKSRSEVELERTF-TFKHSGFNWSGTPIIAA
Q6D0J7_PECAS          -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQF-TFLHAGGNWSGVPIIAA
GUAC_EDWI9            -------MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELAREY-RFKHSGWQWSGVPLIAA
E1SDA6_PANVC          -------MRIEEDLKLGFKDVLIRPKRSTLQSRSQVELERSF-TFRHSGLSWSGVPIIAA
D4GJT9_PANAM          -------MRIEEDLKLGFKDVLIRPKRSTLKSRSQVELDRRF-TFKHSGLSWSGVPVIAA
E6W7N0_PANSA          -------MRIEEDVKLGFKDVLIRPKRSTLKSRSDVELERTF-TFKHSGLSWTGVPVIAA
D8MN59_ERWBE          -------MRIEEDIKLGFKDVLIRPKRSTLKSRSQVELTRQF-TFKHSGVAWSGVPIIAA
B2VD55_ERWT9          -------MRIEEDIKLGFKDVLIRPKRSTLQSRSQVELERQF-TFKHSGIAWSGVPVIAA
E0SG62_DICD3          -------MRIEEDIKLGFKDVLIRPKRSTLKSRADVELTREF-TFLHAGCGWSGVPIIAA
GUAC_AERHH            -------MRIEEDLKLGFKDVLFRPKRSTLKSRSQVSLTRQF-TFKHTQTQWQGVPVIAA
H2G0I1_OCESG          -------MRIEEDLKLGFRDVLFRPKRSTLNSRAQVELNREF-TFKHSGRRWSGVPVIAA
GUAC_TOLAT            -------MRIEEDLKLGFKDVLFRPKRSTLSSRSQVELHREF-RFRHTQTSWRGVPIIAA
GUAC_VIBPA            -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVNLTRDF-TFKHSGRQWSGVPVIAA
A0A0Q2SHT9_VIBFU      -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVNLTREF-TFKHSGRQWSGVPVIAA
GUAC_VIBCH            -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVNLTREF-TFKHSGRQWSGVPVIAA
GUAC_VIBVY            -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVNLTREF-TFKHSGRQWSGVPVIAA
GUAC_ALIF1            -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVELTRDF-TFKHSGRQWSGTPVIAA
F7YSH0_VIBA7          -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVNLTRDF-TFKHSGRQWSGVPVIAA
GUAC_VIBA3            -------MRIEQELKLGFKDVLFRPKRSTLKSRSQVELTRDF-TFKHSGRQWSGTPVIAA
GUAC_PHOPR            -------MRIEQDLKLGFKDVLFRPKRSTLKSRSQVELTRDF-TFKHSGRQWSGVPIIAA
GUAC_SHEPA            -------MRIEQDLKLGFKDVLIRPKRSTLKSRSQVDLNRQF-TFKHSGKTWSGVPIIAA
GUAC_BUCAI            -------MRIEEDIKLGFKDVLIRPKRSILKSRSQVNLARCF-SFKYSASIWSGIPIIAA
GUAC_BUCBP            -------MRIEEDIKLGFKDVLIRPKRSILKSRSQVDLTRLF-IFKHAQNKWSGIPLIAA
B9M3C4_GEODF          -------MRVETDLKLGFKDVLIRPKRSNLKSRAQVKMERTF-TFLHSKRQWTGVPIIAA
B5E8E4_GEOBB          -------MFLESDIKLGFSDVLIRPKRSNLKSRSQVDLQRHF-KFLHSRHEWTGVPVIAA
E1SUL4_FERBD          -------MHIEADLKLGFKDVLFRPKRSTLSSRSQVDIRRTF-QFKHAEGSWTGIPVIAA
A5FEF2_FLAJ1          -------MRIEMDLKLGFKDVMFRPKRSTLKSRSEVSLEQNF-KFLHSTASWTGIPIMAA
D5BLL1_ZUNPS          -------MRIEQDLKLGFKDVMIRPKRSTLKSRSQVSLEREY-TFLHSNMKWTGVPIMAA
C6X3I6_FLAB3          -------MRIEYEIKLGFKDVMIRPKRSTLKSRSQVSLDRTF-TFRNSQKKWTGVPIIAA
GMPR2_HUMAN           ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQTYSGVPIIAA
A0A2J8TRA2_PONAB      ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQTYTGVPIIAA
A0A096NXA5_PAPAN      ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQTYTGVPIIAA
A0A0D9RTU7_CHLSB      ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQTYTGVPIIAA
I3M079_ICTTR          ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQMYNGVPIIAA
GMPR2_MOUSE           ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVELTRSF-SFRNSKQMYSGIPVIAA
G3HDD3_CRIGR          ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQIYNGIPIIAA
L9L2T7_TUPCH          ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQMYTGIPIIAA
G5B285_HETGA          ------MPHIDSDLKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQMYTGIPIIAA
G1Q1Z0_MYOLU          ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQMYTGIPIIAA
G1MCQ6_AILME          ------MPHIDSDIKLDFKDVLLRPKRSTLKSRNEVDLTRSF-SFRNSKQMYTGIPIIAA
M3Y310_MUSPF          ------MPHIDSDIKLDFKDVLLRPKRSTLKSRSEVDLTRSF-SFRNSKQMYTGIPIIAA
GMPR2_BOVIN           ------MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSF-AFRNSKQMYTGIPIIAA
H0XFQ0_OTOGA          ------MSHIDNDVKLDFKDVLLRPKRNTLKSRSEVDLTRSF-TFRNSKQMYTGIPIIAS
H3A6N7_LATCH          ------MPRIDNDIKLDFKDVLLRPKRSTLKSRSEVDLMRSF-TFRNSKHSYTGIPIIAA
GMPR1_MOUSE           ------MPRIDADLKLDFKDVLLRPKRSSLKSRSEVDLERTF-TFRNSKQTYSGIPIIVA
GMPR1_RAT             ------MPRIDADLKLDFKDVLLRPKRSSLKSRSEVDLERTF-TFRNSKQTYSGIPVIVA
Q5RCX6_PONAB          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
G1QJZ0_NOMLE          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
GMPR1_HUMAN           ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
A0A0D9R5G2_CHLSB      ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
A0A096NL36_PAPAN      ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
H0WTF3_OTOGA          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
G5BT40_HETGA          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLASTF-TFRNSKQTYSGIPIVVA
H0VKD1_CAVPO          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLESTF-TFRNSKQTYSGIPIIVA
L8YC64_TUPCH          ------MPRIDADLKLDFKDVLLRPKRSSLRSRAEVDLERTF-TFRNSKQTYSGIPIIVA
W5PRM0_SHEEP          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
M3Y216_MUSPF          ------MPRIDADLKLDFKDVLLRPKRSSLRSRAEVDLERTF-TFRNSKQTYSGIPIIVA
L5KVF4_PTEAL          ------MPRVDVDLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
G1NUB9_MYOLU          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
L5LV55_MYODS          ------MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTF-TFRNSKQTYSGIPIIVA
H3CHM5_TETNG          ------MPRVDADLKLDFKDVLFRPKRSSLRSRSEVDLQRTF-TFRNSKQTYTGIPVIAA
M3ZN43_XIPMA          ------MPRVDADLKLDFKDVLFRPKRSSLKSRSEVDLRRTF-TFRNSKQTYTGIPIIAA
H3AAS2_LATCH          ------MPRVDADLKLDFKDVLLRPKRSSLKSRSEVDLMRTF-TFRNSKQTYTGIPIMVA
H3D8K8_TETNG          ------MPRIENDIKLDFKDVLLRPKRSTLKSRSEVDLMRSF-TFRNSKGSYCGIPIIAA
H3D8L3_TETNG          ------MPRIENDIKLDFKDVLLRPKR-TLKSRSEVDLMRSF-TFRNSKGSYCGIPIIAA
M3ZHJ2_XIPMA          ------MPRIENDIKLDFKDVLLRPKRSTLKSRSEVDLLRSF-TFRNSKGSYRGIPIIAA
A0A087XT47_POEFO      ------MPRIENDIKLDFKDVLLRPKRSTLKSRSEVDLLRSF-TFRNSKGSYRGIPIIAA
V3YXI2_LOTGI          ------MPRIDNDIKLDFKDVLFRPKRSTIRSRSDVDLTRSF-LFRNSGQSYTGIPVMAA
D6WQX7_TRICA          ------MPNINYEIKLDFKDVMLRPKRSTLKSRSDVNLFREI-TFRNSKQVYNGIPVMAS
A0A067RNR4_ZOONE      ------MPNIINEIKLDFKDVLLRPKRSTLRSRADVDLYREI-TFRNSKQTYKGIPVIAS
E2B9Y1_HARSA          ------MPNIINDIKLDFKDVLLRPKRSTLKSRSDVDLFREI-TFRNSKQTYKGIPVMAS
T1J263_STRMM          ------MPRIDSDIKLDFKDVLLRPKRSTLKSRADVDLYRTI-TFRNSKLTYYGIPVMGA
E9GCV2_DAPPU          ------MPRIDNDVKLDFKDVLLRPKRSTLKSRADVDLFREI-KFRNSKQTIRGIPIIAS
T1L391_TETUR          ------MPTIQYDVKLDFKDVLLRPKRSTLKSRSEVDLNRCI-KFKNSNQEFTGVPIIAA
C3ZRF7_BRAFL          ------MPRIEADVKLDFKDVLIRPKRSTLRSRSDVELVRTISKFRNSGQSYSGIPVIAA
B3RVD3_TRIAD          ------MPRIDNDIKLDFKDVLFRPKRSTLKSRSEVELVRKL-QFRNSGNSYEGIPIIAA
T1FNV9_HELRO          ------MWQIDGKKKLDFKDVLIQPASNKLASRTEVDLTTEH-VFRNSKNKYEGVPLMAS
T1FGC2_HELRO          ------MPRLDTDVKLDFKDVLFRPKRSTIASRADVDLTREY-IFRNSKMKYEGVPVMAS
E3LKR8_CAERE          ------MPRIEFEPKLDFKDVLLRPKRSTLKSRADVDLDREY-IFRNSKATYTGVPVVAS
E3LKS3_CAERE          ------MPRIEFEPKLDFKDVLLRPKRSTLKSRADVDLDREY-IFRNSKATYTGVPVVAS
A8WIY8_CAEBR          ------MPRIEFEPKLDFKDVLLRPKRSTLKSRADVDLDREY-IFRNSKATYTGVPVVAS
G0MTG7_CAEBE          ------MPRIEFEPKLDFKDVLLRPKRSTLKSRADVDLDREY-VFRNSKTTYTGVPVVAS
GMPR_CAEEL            ------MPRIENEPKLDFKDVLLRPKRSTLKSRADVELDREY-VFRNSKATYTGVPVVAS
GMPR_ONCVO            ------MPTIENEPKLDFKDVLLRPKRSTLKSRADVDLVREF-VFRNSKKKYVGIPIVAS
A0A1I7V702_LOALO      ------MPRVEYELKLDFKDVLLRPKRSTLKSRADVDLVREF-IFRNSQKKYVGIPIVAS
A0A0M3HZC0_ASCLU      ------MPRIEFEPKLDFKDVLLRPKRSTLRSRAEVDLMREY-VFRNSKKTYVGVPVVAS
A0A0B2V3V8_TOXCA      ------MPRIEFEPKLDFKDVLLRPKRSTLKSRADVDLTREY-VFRNSKKKYVGVPVVAS
X6NW02_RETFI          ------MVKIEWDIKLDFQDVLIRPKRSKLKSRKDVDLRREY-VFVNSKQKWNGIPVIAA
E4XTK9_OIKDI          ------MPRIDSEVKLDFKDVLFRPKRSTLKSRSEVVLEREY-VFRNSKKTYKGVPVMAA
H3G8N5_PHYRM          ------MPRIETEVRLDFKDVLIRPKRSTLKSRSQVDVQREF-RFLNSKRTWSGVPVIAA
G4ZSW0_PHYSP          ------MPRIETEVRLDFKDVLIRPKRSTLKSRSQVDVQREF-RFRNSKRTWSGVPVIAA
A0A067CE59_SAPPC      ------MPRLETDVKLDFKDVLIRPKRSTLKSRSQVDVSRTY-TFRNSGRTWSGVPVIAA
A9UWE3_MONBE          -------MRIEEDIKLDFKDVLIRPKRSTLKSRSEVTLERTY-KFLHSKQEWTGVPIIAA
F2UI21_SALR5          -------MRIEADVKLDYKDVLIRPKRSTLRSRAEVDLDRKY-TFLHSKKTWTGVPIVAA
C5K4T9_PERM5          ------MVRIDQDIKLDFKDVLFRPKRSSLSSRSQVTLDREL-HFMHSSLTWAGVPVIAA
Q6N148_RHOPA          MKPGVACVHIDLNPKLDFRDVLIRPKRSVLSSRFEANIKRSL-RFRHSSRAWTGFPLIAS
G7ZI81_AZOL4          -------MIIESDLKLDFKDVLIRPKRSTLQSRNDVDVNRTF-TFLHTQRDWTGFPLIAA
G2KQP8_MICAA          -------MRIEEDLKLDFKDVLIRPKRSTLASRRDVDIRRDY-DFKWSKKSFHGIPVIAA
A4G886_HERAR          -------MHIEESVKLDFKDVLIRPKRSTLTSRLEVDIRREF-LFHHSRQTYRGIPIIAS
H9UL20_SPIAZ          -------MLIEEGLRIDFSDVLFKPMRSTLRSRSEVQLIRKM-KFRHSPATWEGVPIMAA
B2KDI6_ELUMP          -------MRIYDDIQLDYCDVLLRPKRSRLSSRSEVDIEREY-DFKWCPLKIKGTGVMAA
GMPR_LEIMA            --MAALGSLPTLPEGLTYDDVLLIPQRSPVRSRKAVNTSTRL-----SRNIHLKIPIVAS
A4HXF5_LEIIN          --MAALGSLPTLPEGLTYDDVLLIPQRSPVRSRKAVNTSTRL-----SRNIHLKIPIVAS
A4H923_LEIBR          --MAALGGLPTLPQGLTYDDVLLIPQRSPVRSRKAVNTSTHL-----SRNIRLKIPIVAS
V5BAV1_TRYCR          ---MSVSGVGSIPVALTYDDVLLVPQKSPVRSRKDVSTTTRL-----SRNIKLHIPIVAS
                                     : : :*:: *    : **  .                    :: :

GUAC_ECOLI            NMDTVGTFSMASALASFDI--LTAVHKHYSVEEWQAFINNS-------------------
GUAC_SHIDS            NMDTVGTFSMASALASFDI--LTAVHKHYSVEEWQAFINNS-------------------
A0A077ZKL2_TRITR      NMDTVGTFSMASALASFDI--LTAVHKHYSVEEWQAFINNS-------------------
GUAC_SALTY            NMDTVGTFEMAQALAGFDI--LTAVHKHYTVEEWAAFINTA-------------------
GUAC_SALAR            NMDTVGTFEMAQALAGFDI--LTAVHKHYTVEEWAAFINTA-------------------
GUAC_CITK8            NMDTVGTFEMASALASFDI--LTAVHKHYSVEDWNAFTSTA-------------------
D2TGP0_CITRI          NMDTVGTFEMAKALAAFDI--LTAVHKHYSVEDWSAFIEGA-------------------
GUAC_ENT38            NMDTVGTFAMATALASFDI--LTAVHKHYSVEEWNAFAASA-------------------
GUAC_KLEP7            NMDTVGTFSMAKALATFGI--LTAVHKHYTAEEWLAFTQGA-------------------
I2BCR2_SHIBC          NMDSVGTFAMAQALAGFDI--LTAVHKHYSVSDWQGFVASA-------------------
A0A089R8G6_PLUGE      NMDTVGTFAMAKALAQFGI--LTAVHKHYSPQEWSAFVSDA-------------------
GUAC_SERP5            NMDSVGTFSMAEALASFDV--LTAVHKHYTLEQWAAFVQRV-------------------
GUAC_YERPE            NMDTVGTFRMAEVLASFDI--LTAVHKHYTLEQWAEFVKRS-------------------
H2IR16_RAHAC          NMDTVGTFRMAIVLASFGL--LTAVHKHYTVEQWQAFVTSS-------------------
Q6D0J7_PECAS          NMDTVGTFSMAEVLASFDV--LTAVHKHYSVEQWSQFVQRA-------------------
GUAC_EDWI9            NMDTVGTFSMARVLAGFDV--LTAVHKHYSVEQWQSFVSSV-------------------
E1SDA6_PANVC          NMDTVGTFSMAEALASFNI--LTAVHKHYSADDWRAFIQRV-------------------
D4GJT9_PANAM          NMDTVGTFMMAEALAGFHL--LTAVHKHYSVEEWRAFVQRV-------------------
E6W7N0_PANSA          NMDTVGTFTMAEALAGFGV--LTAVHKHYSVEDWQAFIQRV-------------------
D8MN59_ERWBE          NMDTVGTFTMAEALASFDM--LTAVHKHYSVEQWQQFVSRV-------------------
B2VD55_ERWT9          NMDTVGTFNMAEALSSFDI--LTAVHKHYSVEQWRAFVERV-------------------
E0SG62_DICD3          NMDTVGTFQMARVLASFEL--LTAVHKHYSVAEWRQFVDST-------------------
GUAC_AERHH            NMDTVGSFAMARTLASFEM--MTAVHKHYSLAQWQTFVSET-------------------
H2G0I1_OCESG          NMDTVATFEMARALARHEM--LTAVHKHYSVEQWQAFVNDA-------------------
GUAC_TOLAT            NMDTVGTFAMAKALASFDV--MTAIHKHYTEQEWQTFVQNS-------------------
GUAC_VIBPA            NMDSVGSFEMAKALAEHGV--MTAVHKHYTVNDWADFVKSA-------------------
A0A0Q2SHT9_VIBFU      NMDSVGSFAMAKALAEHGV--MTAVHKHYTVADWAEFAKTA-------------------
GUAC_VIBCH            NMDSVGSFAMAKALAEHGV--MTAVHKHYTVADWAEFVKSA-------------------
GUAC_VIBVY            NMDSVGSFEMAKALSQHGV--MTAIHKHYTVQDWADFVKDA-------------------
GUAC_ALIF1            NMDSVGSFAMAKALSEHGV--MTAVHKHYTVADWAEFIKEN-------------------
F7YSH0_VIBA7          NMDSVGSFAMAKSLAEHDV--MTAVHKHYSVADWAEFVKNA-------------------
GUAC_VIBA3            NMDSVASFEMAAALAEHGV--MTAVHKHYTVEQWAEFAKTA-------------------
GUAC_PHOPR            NMDSVGSFEMAASLSKHNV--MTAIHKHYTVDDWAGFVKNN-------------------
GUAC_SHEPA            NMDSVASFEMAASLAQHNV--MTAVHKHYSVEQWGEFVASQ-------------------
GUAC_BUCAI            NMDTIGTFEMVKSLSKFNI--LTAVHKYYSFEEWKNFVCLS-------------------
GUAC_BUCBP            NMDTVGTFKMAIALSSFGI--LTAIHKYYSYLDWKKFIHTI-------------------
B9M3C4_GEODF          NMDTIGTFEVAGVLAEHNM--LTAIHKHYTPADWQNFLKDC-------------------
B5E8E4_GEOBB          NMDTTGTFEVADRLASHEM--LTAIHKHYSIAEWDAYLASR-------------------
E1SUL4_FERBD          NMDTVGTFEMAEALAQHLM--LTAVHKHYTVEQWTAWLATQ-------------------
A5FEF2_FLAJ1          NMDTVGTFEMAQVLAKEKL--FTAIHKHYTLEQWNTFLKNV-------------------
D5BLL1_ZUNPS          NMDTVGTFEMAKKLAEKTL--FTAVHKHYSVAEWTTFLNET-------------------
C6X3I6_FLAB3          NMDTVGTFEMAEALAKEKV--VTAIHKHYTAEDWAHFLSTQ-------------------
GMPR2_HUMAN           NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLVQWQEFAGQN-------------------
A0A2J8TRA2_PONAB      NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLDQWQEFAGQN-------------------
A0A096NXA5_PAPAN      NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLDQWQEFAGQN-------------------
A0A0D9RTU7_CHLSB      NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLDQWQEFAGQN-------------------
I3M079_ICTTR          NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLHQWQEFAGQN-------------------
GMPR2_MOUSE           NMDTVGTFEMARVLCKFSL--FTAIHKHYSIHQWQEFASQN-------------------
G3HDD3_CRIGR          NMDTVGTFEMAKVLCKFSL--FTAVHKHYSIHQWQEFASQN-------------------
L9L2T7_TUPCH          NMDTVGTFEMAKVLCKFSL--FTAIHKHYSLDQWQEFASQN-------------------
G5B285_HETGA          NMDTVGTFEMAKVLCKFSL--FTAIHKHYSLDQWQEFASQN-------------------
G1Q1Z0_MYOLU          NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLEQWKEFAGQN-------------------
G1MCQ6_AILME          NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLQQWKEFASQN-------------------
M3Y310_MUSPF          NMDTVGTFEMAKVLCKFSL--FTAIHKHYSLQQWKEFASQN-------------------
GMPR2_BOVIN           NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLEQWKEFASQN-------------------
H0XFQ0_OTOGA          NMDTVGTFEMAKVLCKFSL--FTAVHKHYSLDQWQEFARQN-------------------
H3A6N7_LATCH          NMDTVGTFEMAKVLCKFSL--FTAIHKHYTAEEWKEFAAQN-------------------
GMPR1_MOUSE           NMDTVGTFEMAVVMSQHAM--FTAVHKHYSLDDWKCFAETH-------------------
GMPR1_RAT             NMDTVGTFEMAVVMSQHAM--FTAIHKHYSLDDWKHFAENH-------------------
Q5RCX6_PONAB          NMDTVGTFEMAAVMSQHSM--FTAIHKHYSLDDWKLFATNH-------------------
G1QJZ0_NOMLE          NMDTVGTFEMAAVMSQHSM--FTAIHKHYSLDDWKLFATNH-------------------
GMPR1_HUMAN           NMDTVGTFEMAAVMSQHSM--FTAIHKHYSLDDWKLFATNH-------------------
A0A0D9R5G2_CHLSB      NMDTVGTFEMAAVMSQHSM--FTAIHKHYSLDDWKLFATNH-------------------
A0A096NL36_PAPAN      NMDTVGTFEMAAVMSQHSM--FTAIHKHYSLDDWKLFATNH-------------------
H0WTF3_OTOGA          NMDTVGTFEMAAVMSQHSM--FTAIHKHYTLDDWKLFATNH-------------------
G5BT40_HETGA          NMDAVGTFEMAVVMSQHSM--FTAIHKHYTLDDWKRFAEYH-------------------
H0VKD1_CAVPO          NMDTVGTFEMAVVMSQHSM--FTAIHKHYTLDDWKCFATLH-------------------
L8YC64_TUPCH          NMDTVGTFEMAAVMARHSM--FTAIHKHYTLDDWKRFATDH-------------------
W5PRM0_SHEEP          NMDTVGTFEMAVVMSQHSM--FTAIHKHYTLDDWKLFAANH-------------------
M3Y216_MUSPF          NMDTVGTFEMAVVMSQHSM--FTAIHKHYTLDDWKLFAAHH-------------------
L5KVF4_PTEAL          NMDTVGTFEMAVVMSQHSM--FTAIHKHYTIDDWKLFAANH-------------------
G1NUB9_MYOLU          NMDTVGTFEMAAVMSQHSM--FTAIHKHYTLDDWKLFATDH-------------------
L5LV55_MYODS          NMDTVGTFEMAAVMSQHSM--FTAIHKHYTLDDWKLFATDH-------------------
H3CHM5_TETNG          NMDTTGTFEMARVLSKHTL--FTAIHKHYSVEDWKKFAVTH-------------------
M3ZN43_XIPMA          NMDTTGTFEMAKVLSKHTL--FTAIHKHYSVEDWKNFAADH-------------------
H3AAS2_LATCH          NMDTVGTFEMAQVLSKHAM--FTAIHKHYSVEDWKKFAANH-------------------
H3D8K8_TETNG          NMDTVGTFEMALALHQFTL--FTAIHKHYSVDDWAEFAAKH-------------------
H3D8L3_TETNG          NMDTVGTFEMALALHQFTL--FTAIHKHYSVDDWAEFAAKH-------------------
M3ZHJ2_XIPMA          NMDTVGTFEMAQALHEFTL--FTAIHKHYSIDDWSEFAAKH-------------------
A0A087XT47_POEFO      NMDTVGTFEMAQALHEFTL--FTAIHKHYSIDDWSEFAAKH-------------------
V3YXI2_LOTGI          NMDTVGTFEMAKVLSKHLM--FTAIHKHYSVDEWKEFAAQN-------------------
D6WQX7_TRICA          NMDTVGTFEMAQALSKHGL--FTCIHKYYNVEQWKKFASEN-------------------
A0A067RNR4_ZOONE      NMDTVGTFEMAKALAKHGL--FTTLHKYYSLAEWKDFAENS-------------------
E2B9Y1_HARSA          NMDIVGTFGMAKALSKHGL--FTTIHKYYTADEWKNFATLN-------------------
T1J263_STRMM          NMDTVGTFEMAAALDQHGL--FTTIHKHYTLEEWQVFARQY-------------------
E9GCV2_DAPPU          NMDTVGTFEMASALAKHGL--LTTIHKHYQVEEWVNFMQKN-------------------
T1L391_TETUR          NMDTIGTFDMAVALNKHNL--LTTIHKHYSVEEWKSFANQH-------------------
C3ZRF7_BRAFL          NMDTVGTFEMAKALSKHGC--FTTIHKHYSVEAWEDFGRNN-------------------
B3RVD3_TRIAD          NMDTTGTFEVAEALAMHKM--FTAIHKHYSLQQWQDFANDH-------------------
T1FNV9_HELRO          NMDTVGTFEVATVLSEFKA--FTAIHKYYSVEEWTEFAVNN-------------------
T1FGC2_HELRO          NMDTVGTFEVAKVLSKFKV--FTAVHKYYSVEEWKDFAAKN-------------------
E3LKR8_CAERE          NMDTVGTFEMASALNNHKM--FTTIHKHYSVDEWKTFAASAP------------------
E3LKS3_CAERE          NMDTVGTFEMASALNNHKM--FTTIHKHYSVEEWKAFAASVP------------------
A8WIY8_CAEBR          NMDTVGTFEMASALNNHKM--FTTIHKHYSVDEWKAFAASAA------------------
G0MTG7_CAEBE          NMDTVGTFEMAAALNNHKM--FTTIHKHYTPEEWKAYANSAA------------------
GMPR_CAEEL            NMDTVGTFEMAAALNNHKI--FTTIHKHYSVDEWKAFAASAS------------------
GMPR_ONCVO            NMDTVGTFEVAESLSKKRL--FTTIHKHYSVDQWMEFVNRIS------------------
A0A1I7V702_LOALO      NMDTVGTFEVAEVLSKEKL--FTFMHKHYSIEQWMEFVGRIG------------------
A0A0M3HZC0_ASCLU      NMDTVGTFEMAEVLAKFSL--FTTIHKHYHVDEWKAFVQRVD------------------
A0A0B2V3V8_TOXCA      NMDTVGTFEMAEVLAKSSL--FTTIHKHYSVDEWAEFVRRID------------------
X6NW02_RETFI          NMDTTGTFEMAKVFAQYGC--IVAIHKHYSLEQWKEFATEEK------------------
E4XTK9_OIKDI          NMDTTGTFEIAKAFHEHSL--FVCMHKHYTVEQWVQFAK---------------------
H3G8N5_PHYRM          NMDTVGTFEMAVELAQFQF--ITCVHKHYTPSEWAAFAN---------------------
G4ZSW0_PHYSP          NMDTVGTFEMAVELAKFQF--ITCVHKHYTPADWAAFAA---------------------
A0A067CE59_SAPPC      NMDTVGTFEMAVALAQHKC--ITCVHKHYSVDEWEAFGA---------------------
A9UWE3_MONBE          NMDTTGTFETAAVLAEQGL--ITAASKHYSSSAWVEQPA---------------------
F2UI21_SALR5          NMDTTGTFEAAQVMSKHKM--LVAASKHYEAADWQAQSD---------------------
C5K4T9_PERM5          NMDTVGTFAMAEALGKFKC--LVAIHKHYSLEQWRNWCSRV-------------------
Q6N148_RHOPA          NMDTIGTLEMAKAFKPFGA--LVALHKFHHPDRLAEYLAG-D------------------
G7ZI81_AZOL4          NMDVTGSMGMARALSRFGA--MTALHKHYKADELVAFFQK-E------------------
G2KQP8_MICAA          NMDGVGTMAMARAFHVQGDGLTVALHKHYALDQLVEFFGT-A------------------
A4G886_HERAR          NMDSTGTIEMAHALAPHQL--SAALHKHHSTDDLVAFFQSLQ------------------
H9UL20_SPIAZ          NMDTTGTFAIARKFMQYRM--ITTIHKHYTLDDWKAFLADI-------------------
B2KDI6_ELUMP          NMSTTGTFEIAKIMQKYKL--FTALHKHYTAEELIKFLKDNK------------------
GMPR_LEIMA            NMDTVCEDKTAVTMAREGG--IGILHRFCSIEEQCAMVRKVKRAQSFLIEDPRMILPSAT
A4HXF5_LEIIN          NMDTVCEDKTAVTMAREGG--IGILHRFCSIEEQCAMVRKVKRAQSFLIEDPRMILPSAT
A4H923_LEIBR          NMDTVCEDKTAVTMAREGG--IGILHRFCSIEEQCAMVRKVKRAQSFLIEDPRMILSSAT
V5BAV1_TRYCR          NMDTVCEHQTAIAMAREGG--IGILHRFCSIREQCEMLSKVKRAQSFLIENPRMIMAHQT
                      **.       .  :                                              

GUAC_ECOLI            ------------------------------------------------------------
GUAC_SHIDS            ------------------------------------------------------------
A0A077ZKL2_TRITR      ------------------------------------------------------------
GUAC_SALTY            ------------------------------------------------------------
GUAC_SALAR            ------------------------------------------------------------
GUAC_CITK8            ------------------------------------------------------------
D2TGP0_CITRI          ------------------------------------------------------------
GUAC_ENT38            ------------------------------------------------------------
GUAC_KLEP7            ------------------------------------------------------------
I2BCR2_SHIBC          ------------------------------------------------------------
A0A089R8G6_PLUGE      ------------------------------------------------------------
GUAC_SERP5            ------------------------------------------------------------
GUAC_YERPE            ------------------------------------------------------------
H2IR16_RAHAC          ------------------------------------------------------------
Q6D0J7_PECAS          ------------------------------------------------------------
GUAC_EDWI9            ------------------------------------------------------------
E1SDA6_PANVC          ------------------------------------------------------------
D4GJT9_PANAM          ------------------------------------------------------------
E6W7N0_PANSA          ------------------------------------------------------------
D8MN59_ERWBE          ------------------------------------------------------------
B2VD55_ERWT9          ------------------------------------------------------------
E0SG62_DICD3          ------------------------------------------------------------
GUAC_AERHH            ------------------------------------------------------------
H2G0I1_OCESG          ------------------------------------------------------------
GUAC_TOLAT            ------------------------------------------------------------
GUAC_VIBPA            ------------------------------------------------------------
A0A0Q2SHT9_VIBFU      ------------------------------------------------------------
GUAC_VIBCH            ------------------------------------------------------------
GUAC_VIBVY            ------------------------------------------------------------
GUAC_ALIF1            ------------------------------------------------------------
F7YSH0_VIBA7          ------------------------------------------------------------
GUAC_VIBA3            ------------------------------------------------------------
GUAC_PHOPR            ------------------------------------------------------------
GUAC_SHEPA            ------------------------------------------------------------
GUAC_BUCAI            ------------------------------------------------------------
GUAC_BUCBP            ------------------------------------------------------------
B9M3C4_GEODF          ------------------------------------------------------------
B5E8E4_GEOBB          ------------------------------------------------------------
E1SUL4_FERBD          ------------------------------------------------------------
A5FEF2_FLAJ1          ------------------------------------------------------------
D5BLL1_ZUNPS          ------------------------------------------------------------
C6X3I6_FLAB3          ------------------------------------------------------------
GMPR2_HUMAN           ------------------------------------------------------------
A0A2J8TRA2_PONAB      ------------------------------------------------------------
A0A096NXA5_PAPAN      ------------------------------------------------------------
A0A0D9RTU7_CHLSB      ------------------------------------------------------------
I3M079_ICTTR          ------------------------------------------------------------
GMPR2_MOUSE           ------------------------------------------------------------
G3HDD3_CRIGR          ------------------------------------------------------------
L9L2T7_TUPCH          ------------------------------------------------------------
G5B285_HETGA          ------------------------------------------------------------
G1Q1Z0_MYOLU          ------------------------------------------------------------
G1MCQ6_AILME          ------------------------------------------------------------
M3Y310_MUSPF          ------------------------------------------------------------
GMPR2_BOVIN           ------------------------------------------------------------
H0XFQ0_OTOGA          ------------------------------------------------------------
H3A6N7_LATCH          ------------------------------------------------------------
GMPR1_MOUSE           ------------------------------------------------------------
GMPR1_RAT             ------------------------------------------------------------
Q5RCX6_PONAB          ------------------------------------------------------------
G1QJZ0_NOMLE          ------------------------------------------------------------
GMPR1_HUMAN           ------------------------------------------------------------
A0A0D9R5G2_CHLSB      ------------------------------------------------------------
A0A096NL36_PAPAN      ------------------------------------------------------------
H0WTF3_OTOGA          ------------------------------------------------------------
G5BT40_HETGA          ------------------------------------------------------------
H0VKD1_CAVPO          ------------------------------------------------------------
L8YC64_TUPCH          ------------------------------------------------------------
W5PRM0_SHEEP          ------------------------------------------------------------
M3Y216_MUSPF          ------------------------------------------------------------
L5KVF4_PTEAL          ------------------------------------------------------------
G1NUB9_MYOLU          ------------------------------------------------------------
L5LV55_MYODS          ------------------------------------------------------------
H3CHM5_TETNG          ------------------------------------------------------------
M3ZN43_XIPMA          ------------------------------------------------------------
H3AAS2_LATCH          ------------------------------------------------------------
H3D8K8_TETNG          ------------------------------------------------------------
H3D8L3_TETNG          ------------------------------------------------------------
M3ZHJ2_XIPMA          ------------------------------------------------------------
A0A087XT47_POEFO      ------------------------------------------------------------
V3YXI2_LOTGI          ------------------------------------------------------------
D6WQX7_TRICA          ------------------------------------------------------------
A0A067RNR4_ZOONE      ------------------------------------------------------------
E2B9Y1_HARSA          ------------------------------------------------------------
T1J263_STRMM          ------------------------------------------------------------
E9GCV2_DAPPU          ------------------------------------------------------------
T1L391_TETUR          ------------------------------------------------------------
C3ZRF7_BRAFL          ------------------------------------------------------------
B3RVD3_TRIAD          ------------------------------------------------------------
T1FNV9_HELRO          ------------------------------------------------------------
T1FGC2_HELRO          ------------------------------------------------------------
E3LKR8_CAERE          ------------------------------------------------------------
E3LKS3_CAERE          ------------------------------------------------------------
A8WIY8_CAEBR          ------------------------------------------------------------
G0MTG7_CAEBE          ------------------------------------------------------------
GMPR_CAEEL            ------------------------------------------------------------
GMPR_ONCVO            ------------------------------------------------------------
A0A1I7V702_LOALO      ------------------------------------------------------------
A0A0M3HZC0_ASCLU      ------------------------------------------------------------
A0A0B2V3V8_TOXCA      ------------------------------------------------------------
X6NW02_RETFI          ------------------------------------------------------------
E4XTK9_OIKDI          ------------------------------------------------------------
H3G8N5_PHYRM          ------------------------------------------------------------
G4ZSW0_PHYSP          ------------------------------------------------------------
A0A067CE59_SAPPC      ------------------------------------------------------------
A9UWE3_MONBE          ------------------------------------------------------------
F2UI21_SALR5          ------------------------------------------------------------
C5K4T9_PERM5          ------------------------------------------------------------
Q6N148_RHOPA          ------------------------------------------------------------
G7ZI81_AZOL4          ------------------------------------------------------------
G2KQP8_MICAA          ------------------------------------------------------------
A4G886_HERAR          ------------------------------------------------------------
H9UL20_SPIAZ          ------------------------------------------------------------
B2KDI6_ELUMP          ------------------------------------------------------------
GMPR_LEIMA            KAEALEELNWSGRKGGVSCLMVVDDLTSRRLCGVLTKSDLTFATGSALVETLMTPVSRMV
A4HXF5_LEIIN          KAEALEELNWSGRKGGVSCLMVVDDFTSRRLCGVLSKSDLIFATDSALVETLMTPVSRTV
A4H923_LEIBR          KTEALEELNWSGRKGGVSCLMVVDDFTSRRLCGVLSKSDLVFASDSDLIGTLMTPVKRMV
V5BAV1_TRYCR          QEEALQGLQWKGRKGGVSCLMVVENFSTRKLLGIVSKNDLHFADANEPVSKLMTPLERLV
                                                                                  

GUAC_ECOLI            -----------------------------------------------------SADVLKH
GUAC_SHIDS            -----------------------------------------------------SADVLKH
A0A077ZKL2_TRITR      -----------------------------------------------------SADVLKH
GUAC_SALTY            -----------------------------------------------------SADVLKH
GUAC_SALAR            -----------------------------------------------------SADVLKH
GUAC_CITK8            -----------------------------------------------------SEDVLRH
D2TGP0_CITRI          -----------------------------------------------------SASVLRH
GUAC_ENT38            -----------------------------------------------------SADVLKH
GUAC_KLEP7            -----------------------------------------------------SADVLKH
I2BCR2_SHIBC          -----------------------------------------------------AADVLKH
A0A089R8G6_PLUGE      -----------------------------------------------------GRDVVRH
GUAC_SERP5            -----------------------------------------------------PASVLRH
GUAC_YERPE            -----------------------------------------------------PESVLRH
H2IR16_RAHAC          -----------------------------------------------------DESVLRN
Q6D0J7_PECAS          -----------------------------------------------------PESVLRH
GUAC_EDWI9            -----------------------------------------------------GEETLRH
E1SDA6_PANVC          -----------------------------------------------------PATVLNH
D4GJT9_PANAM          -----------------------------------------------------PGSVLNY
E6W7N0_PANSA          -----------------------------------------------------PASVLGH
D8MN59_ERWBE          -----------------------------------------------------PENVLKH
B2VD55_ERWT9          -----------------------------------------------------SPAVLRH
E0SG62_DICD3          -----------------------------------------------------PAAVLRH
GUAC_AERHH            -----------------------------------------------------DPALLGH
H2G0I1_OCESG          -----------------------------------------------------GADVLKH
GUAC_TOLAT            -----------------------------------------------------SDPLLQY
GUAC_VIBPA            -----------------------------------------------------DNATLKN
A0A0Q2SHT9_VIBFU      -----------------------------------------------------DKATLNN
GUAC_VIBCH            -----------------------------------------------------DKATLNN
GUAC_VIBVY            -----------------------------------------------------DSETLNK
GUAC_ALIF1            -----------------------------------------------------DASVLKN
F7YSH0_VIBA7          -----------------------------------------------------DTSTLKH
GUAC_VIBA3            -----------------------------------------------------DKKTLNN
GUAC_PHOPR            -----------------------------------------------------DAAVLNN
GUAC_SHEPA            -----------------------------------------------------TAEVLQH
GUAC_BUCAI            -----------------------------------------------------SKEILNH
GUAC_BUCBP            -----------------------------------------------------PGTVVKH
B9M3C4_GEODF          -----------------------------------------------------DSRIYSR
B5E8E4_GEOBB          -----------------------------------------------------NDDIYPR
E1SUL4_FERBD          -----------------------------------------------------PETIFDH
A5FEF2_FLAJ1          -----------------------------------------------------TPDFYDY
D5BLL1_ZUNPS          -----------------------------------------------------SAELKNS
C6X3I6_FLAB3          -----------------------------------------------------PDSIYDY
GMPR2_HUMAN           ------------------------------------------------------PDCLEH
A0A2J8TRA2_PONAB      ------------------------------------------------------PDCLEH
A0A096NXA5_PAPAN      ------------------------------------------------------PDCLEH
A0A0D9RTU7_CHLSB      ------------------------------------------------------PDCLEH
I3M079_ICTTR          ------------------------------------------------------PDCLQY
GMPR2_MOUSE           ------------------------------------------------------PDCLEC
G3HDD3_CRIGR          ------------------------------------------------------PDCLEH
L9L2T7_TUPCH          ------------------------------------------------------PDCLEH
G5B285_HETGA          ------------------------------------------------------PDCLEY
G1Q1Z0_MYOLU          ------------------------------------------------------PDCLEH
G1MCQ6_AILME          ------------------------------------------------------PECLEH
M3Y310_MUSPF          ------------------------------------------------------PECLEH
GMPR2_BOVIN           ------------------------------------------------------PDCLEH
H0XFQ0_OTOGA          ------------------------------------------------------PDCLEH
H3A6N7_LATCH          ------------------------------------------------------PDCLQH
GMPR1_MOUSE           ------------------------------------------------------PECLQH
GMPR1_RAT             ------------------------------------------------------PECLQH
Q5RCX6_PONAB          ------------------------------------------------------PECLQH
G1QJZ0_NOMLE          ------------------------------------------------------PECLQH
GMPR1_HUMAN           ------------------------------------------------------PECLQN
A0A0D9R5G2_CHLSB      ------------------------------------------------------PECLQH
A0A096NL36_PAPAN      ------------------------------------------------------PECLQH
H0WTF3_OTOGA          ------------------------------------------------------PECLQH
G5BT40_HETGA          ------------------------------------------------------PECLQH
H0VKD1_CAVPO          ------------------------------------------------------PECLQH
L8YC64_TUPCH          ------------------------------------------------------PECLQH
W5PRM0_SHEEP          ------------------------------------------------------PECLQH
M3Y216_MUSPF          ------------------------------------------------------PECLQH
L5KVF4_PTEAL          ------------------------------------------------------PECLQH
G1NUB9_MYOLU          ------------------------------------------------------PECLQH
L5LV55_MYODS          ------------------------------------------------------PECLQH
H3CHM5_TETNG          ------------------------------------------------------PECLEH
M3ZN43_XIPMA          ------------------------------------------------------PECLEH
H3AAS2_LATCH          ------------------------------------------------------PECLEH
H3D8K8_TETNG          ------------------------------------------------------PECVKS
H3D8L3_TETNG          ------------------------------------------------------PECVKS
M3ZHJ2_XIPMA          ------------------------------------------------------PKCLES
A0A087XT47_POEFO      ------------------------------------------------------PECLES
V3YXI2_LOTGI          ------------------------------------------------------KAALPH
D6WQX7_TRICA          ------------------------------------------------------PKSLPH
A0A067RNR4_ZOONE      ------------------------------------------------------PECLHY
E2B9Y1_HARSA          ------------------------------------------------------PECVKN
T1J263_STRMM          ------------------------------------------------------PQALKN
E9GCV2_DAPPU          ------------------------------------------------------KDVAGF
T1L391_TETUR          ------------------------------------------------------PDAIKN
C3ZRF7_BRAFL          ------------------------------------------------------PDVLQH
B3RVD3_TRIAD          ------------------------------------------------------KDVLQY
T1FNV9_HELRO          ------------------------------------------------------PSALPH
T1FGC2_HELRO          ------------------------------------------------------PSALPH
E3LKR8_CAERE          ----------------------------------------------------VET--FNN
E3LKS3_CAERE          ----------------------------------------------------VET--FNN
A8WIY8_CAEBR          ----------------------------------------------------PGT--FDN
G0MTG7_CAEBE          ----------------------------------------------------PES--FNN
GMPR_CAEEL            ----------------------------------------------------PDT--FNN
GMPR_ONCVO            ----------------------------------------------------SNQDILSQ
A0A1I7V702_LOALO      ----------------------------------------------------SDQDILSQ
A0A0M3HZC0_ASCLU      ----------------------------------------------------SNPQIMSQ
A0A0B2V3V8_TOXCA      ----------------------------------------------------ANSQVMSQ
X6NW02_RETFI          ----------------------------------------------------NNEMIQSC
E4XTK9_OIKDI          ----------------------------------------------------NNPEVIKN
H3G8N5_PHYRM          ----------------------------------------------------KHPDVLPT
G4ZSW0_PHYSP          ----------------------------------------------------KHPDVLPT
A0A067CE59_SAPPC      ----------------------------------------------------AHPDVLPF
A9UWE3_MONBE          -------------------------------------------------------EVVKH
F2UI21_SALR5          -------------------------------------------------------DVLEF
C5K4T9_PERM5          -----------------------------------------------------GRDVLDN
Q6N148_RHOPA          ----------------------------------------------------ED----AN
G7ZI81_AZOL4          ----------------------------------------------------AESAVQSN
G2KQP8_MICAA          ----------------------------------------------------ES----AN
A4G886_HERAR          ----------------------------------------------------HSAHAAST
H9UL20_SPIAZ          ----------------------------------------------------DTAQAAEY
B2KDI6_ELUMP          ----------------------------------------------------KNFKTNGY
GMPR_LEIMA            VSTNTAITLEEAREVMRTKRTKNIPLLGPKGELLYLITRSDILKLTGNLNATLDSRGRLI
A4HXF5_LEIIN          VSTNTAITLEEAREVMRTKRTSNIPLLGPKGELLYLITQSDILKLTGNRNATLDSRGRLI
A4H923_LEIBR          VSTNTSITLEEARELMHMKRTNNIPLLGPKGELLYLITQSDILKLTGNRNATLDSRGRLI
V5BAV1_TRYCR          VSTNTAITLEEAREMMREHRTSNIPILAKDNALIYLVTLSDVLKLTEKKYASLDARGRLL
                                                                                  

GUAC_ECOLI            VMVSTGTSDADFEKTKQILDLNPALNF--VCIDVANGYSEHFVQFVAKAREA--WPTKTI
GUAC_SHIDS            VMVSTGTSDADFEKTKQILDLNPALNF--VCIDVANGYSEHFVQFVAKAREA--WPTKTI
A0A077ZKL2_TRITR      VMVSTGTSDADFEKTKQILDLNPALNF--VCIDVANGYSEHFVQFVAKAREA--WPTKTI
GUAC_SALTY            VMVSTGTSDADFEKTVQILALNPALNF--VCIDVANGYSEHFVQFVAKAREA--WPTKTI
GUAC_SALAR            VMVSTGTSDADFAKTAQILALNPALNF--VCIDVANGYSEHFVQFVAKAREA--WPTKTI
GUAC_CITK8            VMVSTGTSDADFEKTKQILAQSPALNF--VCIDVANGYSEHFVQFVSKAREA--WPTKTI
D2TGP0_CITRI          VMVSTGTSDADFDKTKQILALNPELNF--VCIDVANGYSEHFVQFVSKAREA--WPNKTI
GUAC_ENT38            VMVSTGTSDTDFEKTKQILIANPALNF--LCIDVANGYSEHFVQFVSKAREA--WPDKTI
GUAC_KLEP7            VMVSTGTSDADFEKTQQILSQNPQLNF--VCIDVANGYSEHFVQFVAKAREA--WPQKTI
I2BCR2_SHIBC          VMVSTGTSDADFEKTRQILALSPALNF--VCIDVANGYSEHFVRFVSKAREA--WPDKVI
A0A089R8G6_PLUGE      VMVSTGTSDADFGKTQQILRDNPDLNF--ICIDVANGYSEHFVQFVAKARET--WPNKTI
GUAC_SERP5            VMVSTGTSEADFVKMQQILALSPGLKF--ICIDVANGYSEHFVAFLQKAREA--CPNHVI
GUAC_YERPE            VMVSTGTSSADFDKMKQILALSPSLKF--ICIDVANGYSEHFVSFLQRAREA--CPDKVI
H2IR16_RAHAC          VMVSTGTSEADFVKTLQILALSPLLKF--VCLDVANGYSEHFVSFLQRVREA--CPDKVI
Q6D0J7_PECAS          VMVSSGTSDADFIKLKQILALSSELKF--ICIDVANGYSEHFVTFLQKVREA--CPDKVI
GUAC_EDWI9            VMVSTGTSEADFIKLRQILALSPSLKF--ICIDVANGYSEHFVDFLRRARDV--CPDKVI
E1SDA6_PANVC          VMVSTGTSEADLTKLVAIMTLSDDLQF--ICIDVANGYSQHFVDFLQRAREM--FPAKTI
D4GJT9_PANAM          VMVSTGTSDADLNKLIAIMAISDALQF--ICIDVANGYSEHFVDFLKRARET--FPGKTI
E6W7N0_PANSA          VMVSTGTSEADFNKLNAVLALSPQLNF--ICIDVANGYSEHFVAFLQRARES--FPGKTI
D8MN59_ERWBE          VMVSTGTSDADFIKMKQILALSPLLNF--ICIDVANGYSEHFVEFLQRAREA--CPGKTI
B2VD55_ERWT9          VMVSTGTSEADFTRLQQILALSPMLNF--ICIDVANGYSEHFVTFLQRAREA--CPDKTI
E0SG62_DICD3          VMVSSGTSDGDFENMRQILALSPDLKF--ICIDVANGYSEHFVNFVQKAREA--FPDKVI
GUAC_AERHH            VMVSTGTSEDDFTKTRQILAMSSALRF--ICVDVANGYSQHFVEFLRKIREA--CPNHVI
H2G0I1_OCESG          VIVSTGTSERDFEKLHQILALSDELGF--ICIDVANGYSEHFASFVSRVREQ--CPRHTI
GUAC_TOLAT            CMVSTGTSNNDFLKLQRILALSPALRF--ICVDVANGYSEHFADFVKIVRET--FPQHVI
GUAC_VIBPA            VMVSTGTSDADFQKTKDIMALSDELIF--ICVDIANGYSEHLVEYVERVRAE--FPDKVI
A0A0Q2SHT9_VIBFU      VMVSTGTSDADFQKTQDIMALSDEFIF--ICIDIANGYSEHLVEYVERVRAA--FPDKVI
GUAC_VIBCH            VMVSTGTSEADFQKTKDVMALSDELIF--ICIDIANGYSEHLVEYVQRVRAA--FPDKVI
GUAC_VIBVY            VMVSTGTSEADFQKTKDVMALSDELIF--ICIDIANGYSEHLVQYVQQVRAA--FPDKVI
GUAC_ALIF1            AMVSTGTSEADFQKTKDIMALTDDLIF--ICIDIANGYSEHLVQYVEKVRAE--FPDKVI
F7YSH0_VIBA7          VMVSTGTSDADFQKTKDIMALSDDLIF--ICIDIANGYSEHLVDYVQRVRAQ--FPDKVI
GUAC_VIBA3            VFVSTGTSEAEFEKVKKIMALSEEFVF--ICIDIANGYSEHLVEFVQKVRAE--FPTKVI
GUAC_PHOPR            AMVSTGTSEADFQKTKDIMALTEDLIF--ICIDIANGYSEHLVEYVQKVRAE--FPTKVI
GUAC_SHEPA            VMVSSGTSDTDFIKLSEILAKSEDLNF--ICIDIANGYSEHLVDYVRKVRQA--HPQAVI
GUAC_BUCAI            VIVSIGTSNIDFLKIKKIFLLSSELKY--ICIDVANGYSEHIVSFLKLVRDY--FPDKII
GUAC_BUCBP            IMVSTGMLDEDFVKLKQILSLSSKLKY--ICIDVANGYSEKFVTFLKKVREC--YCDKII
B9M3C4_GEODF          IMVCTGTSDDDFGKLAKIAGNHPQLEF--ICIDVANGYSESFVAFLSRVREA--YPDKTI
B5E8E4_GEOBB          IMVSTGTSEADFEKVSAILGKHPKLEF--ICIDVANGYAESFVEFVAKMREA--YAEKTI
E1SUL4_FERBD          VMVSTGTSQADFEKLSAILKANPKLRF--ICIDVANGYQQSFVDFVRRVREA--QPTRVI
A5FEF2_FLAJ1          IAVSTGTGKEDFEKIEKIITANPLLKF--ICIDVANGYSEHFVQFLKKTRKQ--YPDKII
D5BLL1_ZUNPS          IAVSTGTGKEDSKKLKEIFDLSEDLKF--ICIDVANGYSEHFVKFVKKTREQ--YPDKVI
C6X3I6_FLAB3          IALSTGTGSEDEAKIKQIVDQHPKIEF--LCIDVANGYSEHFVEFVKKIRAS--FPTKTI
GMPR2_HUMAN           LAASSGTGSSDFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
A0A2J8TRA2_PONAB      LAASSGTGSSDFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
A0A096NXA5_PAPAN      LAASSGTGSSDFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
A0A0D9RTU7_CHLSB      LAASSGTGSSDFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
I3M079_ICTTR          LAASSGTGSSDFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
GMPR2_MOUSE           LAASSGSGSADFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
G3HDD3_CRIGR          LAVSSGTGSTDFEQLAQILDAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
L9L2T7_TUPCH          LAASSGTGTSDFEQLEQILDSIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
G5B285_HETGA          MAASSGTSSSDFKQLEQILETIPEVKY--ICLDVANGYSEHFVEFVKDVRKR--FPQHTI
G1Q1Z0_MYOLU          LAASSGTGSSDFEQLEQILEGIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPGHTI
G1MCQ6_AILME          LAASSGTGSSDFEQLEQILEAIPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPKHTI
M3Y310_MUSPF          LAASSGTGSSDFEQLEQILEALPQVKY--ICLDVANGYSEHFVEFVKDVRKR--FPEHTI
GMPR2_BOVIN           LAASSGTGSSDFEQLEQILNAIPQVKY--VCLDVANGYSEHFVEFVKDVRKR--FPEHTI
H0XFQ0_OTOGA          LAASSGTGSFDFERLEQILEAIPQVNY--ICLDVANGYSEHFVEFVKDLRTR--FPEHTI
H3A6N7_LATCH          VAASSGSGVTDFEKLCEILNAVPEVCY--ICLDVANGYSEHFVQFLKDVRAK--FPNHTI
GMPR1_MOUSE           VAVSSGSGQNDLERMSRILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRSK--FPEHTI
GMPR1_RAT             VAVSSGSGQNDLEKMSLILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRSK--FPEHTI
Q5RCX6_PONAB          VAVSSGSGQNDLEKMTSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
G1QJZ0_NOMLE          VAVSSGSGQNDLEKMTSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
GMPR1_HUMAN           VAVSSGSGQNDLEKMTSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
A0A0D9R5G2_CHLSB      VAVSSGSGQNDLEKMTSVLKAVPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
A0A096NL36_PAPAN      VAVSSGSGQNDLEKMTSVLKAVPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
H0WTF3_OTOGA          VAVSSGSGQNDLEKMTSILEAVPQIKF--ICLDVANGYSEHFVEFVKLVRAR--FPEHTI
G5BT40_HETGA          MAVSSGSGQNDLEKMSSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
H0VKD1_CAVPO          VAVSSGSGQADLDKMSSILEALPQVKF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
L8YC64_TUPCH          VAVSSGSGQNDLEKMSRILEAVPQVRF--ICLDVANGYSEHFVEFVKLVRAK--FPEHTI
W5PRM0_SHEEP          VAVSSGSGKNDLEKMSNILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRSR--FPEHTI
M3Y216_MUSPF          VAVSSGSGKSDLEKMSDILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAR--FPEHTI
L5KVF4_PTEAL          IAVSSGSGKNDLEKMSSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRTK--FPEHTI
G1NUB9_MYOLU          VAVSSGSGKHDLEKMSSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAR--FPEHTI
L5LV55_MYODS          VAVSSGSGKHDLEKMSSILEAVPQVKF--ICLDVANGYSEHFVEFVKLVRAR--FPEHTI
H3CHM5_TETNG          VAASSGSSAADLEKLCSVLEAVPALQY--ICLDVANGYSEHFVEFVKMVREK--FPKHTI
M3ZN43_XIPMA          VAASSGSGNADLEKLCAILQAVPTLQY--ICLDVANGYSEYFVEFVKTVREK--FPKHTI
H3AAS2_LATCH          VAASSGSGQADMENLSNILEAVPLIRY--ICLDVANGYSEHFVEFVKRVHDK--FPNHTI
H3D8K8_TETNG          VAVSTGTGETDFERISAILAAVPELQY--ICVDVANGYSEHFVHFVKDVREK--FPSHTI
H3D8L3_TETNG          VAVSTGTGETDFE-ISAILAAVPELQY--ICVDVANGYSEHFVHFVKDVREK--FPSHTI
M3ZHJ2_XIPMA          VAVSTGTGEGDFEKISAIVEAVPQLKY--ICVDVANGYSEHFVHFVKDVREK--FPSHTI
A0A087XT47_POEFO      VAVSTGTGEGDFEKISAIVESVPQLKY--ICVDVANGYSEHFVHFVKDVREK--FPSHTI
V3YXI2_LOTGI          VAVSAGIAEGDLKNLKNIIEAVPDLQF--ICLDVANGYSEHFVQFVRDVRKT--FPKHTI
D6WQX7_TRICA          VAASSGMTDADFEKLSQILTSIPGITF--ICLDVANGYSQHFVEYVRKVRAA--FPKHTI
A0A067RNR4_ZOONE      VAASSGTGQVDFERLAQILAEIPGVTY--ICLDVANGYSQQFVEYVRKVRAT--FPSHTI
E2B9Y1_HARSA          VAASSGTGNEDYERLSSILDVVPELSF--ICLDVANGYSQHFVEHVRKVRAR--YPNHTI
T1J263_STRMM          VAVSSGTGEDDFKKLGAILTELPQVSF--ICLDVANGYSEHFVAYVKQVHAA--FPHHTI
E9GCV2_DAPPU          VAASSGSGKGDFEKLSKILNAVPEVRF--VCLDVANGYSEHFVEFVRSVREA--FPQHVI
T1L391_TETUR          IAVSSGIGESDFTNLKAILTEVPTIPF--ICLDVANGYSEFFVDFVKQVRSN--FPDRTI
C3ZRF7_BRAFL          VAVSAGSLKGDFDKLTSILTSLPQLKF--ICLDVANGYSEAFVETVREVRKK--FPKHTI
B3RVD3_TRIAD          VAVSSGASKDDMDRLDAILSAVPALNT--ICLDVANGYSELFVECVRNVRKK--YPNHTV
T1FNV9_HELRO          VAVSSGMKESDLEKLKLILKAVPDLRY--ICLDDANAYSEHFVKSLSSIRKQ--FPHHTI
T1FGC2_HELRO          VAVSSGMKDSDLEKLKQIIKAVPELMY--ICLDVANGYSEHFVKFVRNVREQ--FPGHTI
E3LKR8_CAERE          LAISSGISENDWNKLNEVIKALPQLKY--ICLDVANGYSESFVDFIRRVREA--YPTHTI
E3LKS3_CAERE          LAISSGISENDWNKLNEVIKALPQLKY--ICLDVANGYSESFVDFIRRVREA--YPTHTI
A8WIY8_CAEBR          LAISSGISENDWNKLSEVIKALPQLKY--ICLDVANGYSESFVDFIRRVREA--YPKHTI
G0MTG7_CAEBE          LAISSGISDNDWNKLNKVIKDVPQLKY--ICLDVANGYSESFVDFIRRVREA--YPTHTI
GMPR_CAEEL            LAISSGISDNDWTKLNTVITELPQLKY--ICLDVANGYSESFVEFIRRVREA--YPKHTI
GMPR_ONCVO            IGISSGISDYDFTKLKKICGLIPELQY--ICLDVANGYSEVFVDFIRRVREE--FPRHTI
A0A1I7V702_LOALO      IGISSGVSDSDFTKLKKICGLIPELQY--ICLDVANGYTEVFVDFIRRVREE--FPRHTI
A0A0M3HZC0_ASCLU      IGISSGISTSDFDKLRTVCDMIPELEY--ICLDVANGYSEVFVDFIRRVREQ--FPTHTI
A0A0B2V3V8_TOXCA      IGISSGISESDFHKLRTICEMIPELEY--ICLDVANGYSEVFVDFIRRVREQ--FPMHTI
X6NW02_RETFI          VAVSSGTSDEDFEKMKAILGECKTVRM--ICLDVANGYSEHFADYVKKVRQT--FPTHII
E4XTK9_OIKDI          VAVSSGTSDNDFEKMSAILKAVPAVEF--ICIDVANGYSEHFVHYVRKVRQN--FEDRTI
H3G8N5_PHYRM          VAVSAGSSAADLEKITAILKSHADIRF--ICLDVANGYSEHFVQAVRSVRSA--FPEHTI
G4ZSW0_PHYSP          VAVSAGSSAADLERITAVLKSHPDIRF--ICLDVANGYSEFFVQAVRNVRAA--FPEHTI
A0A067CE59_SAPPC      VAVSAGTSAADLERVSSVLAKLDAISF--VCLDVANGYSEMFVEAVRRVREA--HPTHTI
A9UWE3_MONBE          MAVSSGISDSDFERLSETLKTRPDIPF--ICLDVANGYSEAFVQFVRRVRQA--FPNKTI
F2UI21_SALR5          MCASSGTGKHDFATLATVLETNPAISF--ICLDVANGYSEHFVDFVKKVREA--FPDKTI
C5K4T9_PERM5          VAVSTGIMKDDLIKLKSVME-ISKANF--ICLDVANGYAEAFVEAVRTLRKD--YPDKVI
Q6N148_RHOPA          VFVTVGTGSADWERLAA---VKAKVKVPMLNIDVANGYTEAFVRAVARLRDE--NPDAII
G7ZI81_AZOL4          VFYSMGIADADHDKFRA---VKAKAPVGKICLDVANGYTERFVEVIARLREE--NPDTVI
G2KQP8_MICAA          AWYSIGVSEKDQEKLEEFLKTPAGAKLDRLCIDVANGYSQPFVDFIKRMRDK--LPTTTI
A4G886_HERAR          AFYSMGISPSDYDKFTAVM-ARLDNAIEYVCIDVANGYTEGFINFVKKVRKE--FPHLTI
H9UL20_SPIAZ          VVPSMGTSDQDIQRIRELFALFPRFKF--LCIDVANGYSEFFSGFVRRIRQE--FPEIIL
B2KDI6_ELUMP          IFISSGVSEEDYKKIQKVMKTKLINNI---CIDVANGYSPYLINYVKKVRAA--YPKCLI
GMPR_LEIMA            VGAAIGVKKEDHERAAALVDAGADVLV----VDIAHGHSDLCIDMVKALKVNPLTNKVDI
A4HXF5_LEIIN          VGAAIGVKKEDHKRAAALVDAGADVLV----VDIAHGHSDLCIDMVKALKVNPLTNKVDI
A4H923_LEIBR          VGAAIGVKNEDHKRAAALVDAGVDVLV----VDIAHGHSDLCIDMVKALKANPRTNKVDI
V5BAV1_TRYCR          VGAAVGVKKEDITRAARLVEAGADVLV----VDIAHGHSSICIDMIKKLKTDPRTNKVDI
                           *    :                    :* *:.:       :   :         :

GUAC_ECOLI            CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_SHIDS            CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
A0A077ZKL2_TRITR      CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_SALTY            CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_SALAR            CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_CITK8            CAGNVVTGEMCEELVLSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
D2TGP0_CITRI          CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_ENT38            IAGNVVTGEMCEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_KLEP7            IAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
I2BCR2_SHIBC          CAGNVVTGEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
A0A089R8G6_PLUGE      CAGNVVTGEMCEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_SERP5            CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_YERPE            CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
H2IR16_RAHAC          CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
Q6D0J7_PECAS          CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_EDWI9            CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
E1SDA6_PANVC          CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLSG
D4GJT9_PANAM          CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLSG
E6W7N0_PANSA          CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
D8MN59_ERWBE          CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
B2VD55_ERWT9          CAGNVVTGEMVEELILSGADMVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
E0SG62_DICD3          CAGNVVTGEMVEELLLSGADIIKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
GUAC_AERHH            LAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
H2G0I1_OCESG          IAGNVVTGEMVEELILCGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
GUAC_TOLAT            CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
GUAC_VIBPA            SAGNVVTGDMCEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECGDAAHGLGG
A0A0Q2SHT9_VIBFU      SAGNVVTGDMCEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECGDAAHGLGG
GUAC_VIBCH            SAGNVVTGDMVEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
GUAC_VIBVY            SAGNVVTGDMVEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
GUAC_ALIF1            SAGNVVTGDMVEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
F7YSH0_VIBA7          SAGNVVTGDMCEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
GUAC_VIBA3            SAGNVVTGDMVEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECGDAAHGLGG
GUAC_PHOPR            SAGNVVTGDMVEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECSDAAHGLGG
GUAC_SHEPA            SAGNVVTGDMVEELIIAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
GUAC_BUCAI            CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLNG
GUAC_BUCBP            CAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRAKTAIGYPQLSAVIECSDAAHGLGG
B9M3C4_GEODF          VAGNVVTGEMVEELLLSGADVVKVGIGPGSACTTRTKAGVGYPQLSAVIECADAAHGLGG
B5E8E4_GEOBB          VAGNVVTGEMVEELLLSGADIVKVGIGPGSVCTTRVKAGVGYPQLSAVIECADAAHGLGG
E1SUL4_FERBD          VAGNVVTGEMVEELIISGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGG
A5FEF2_FLAJ1          IAGNVVTGEMTEELLLAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
D5BLL1_ZUNPS          IAGNVVTGEMVEELLIAGADIIKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGG
C6X3I6_FLAB3          IAGNVVTGEMVEELILAGADIIKVGIGPGSVCTTRIKTGVGYPQLSAIIDCADAAHGLGG
GMPR2_HUMAN           MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
A0A2J8TRA2_PONAB      MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
A0A096NXA5_PAPAN      MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
A0A0D9RTU7_CHLSB      MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
I3M079_ICTTR          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
GMPR2_MOUSE           MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
G3HDD3_CRIGR          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
L9L2T7_TUPCH          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
G5B285_HETGA          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
G1Q1Z0_MYOLU          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
G1MCQ6_AILME          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
M3Y310_MUSPF          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
GMPR2_BOVIN           MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKG
H0XFQ0_OTOGA          MAGNVVTGEMVEELILSGADIVKVGIGSGSVCTTRKKTGVGYPQLSAVMECADAAHGLNG
H3A6N7_LATCH          MAGNVVTCEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVIECADAAHGLNG
GMPR1_MOUSE           MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
GMPR1_RAT             MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
Q5RCX6_PONAB          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
G1QJZ0_NOMLE          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
GMPR1_HUMAN           MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
A0A0D9R5G2_CHLSB      MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLQG
A0A096NL36_PAPAN      MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLQG
H0WTF3_OTOGA          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
G5BT40_HETGA          MVGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
H0VKD1_CAVPO          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
L8YC64_TUPCH          MVGNVVTGEMVEELILSGADVIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
W5PRM0_SHEEP          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
M3Y216_MUSPF          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
L5KVF4_PTEAL          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
G1NUB9_MYOLU          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
L5LV55_MYODS          MAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
H3CHM5_TETNG          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRIKTGVGYPQLSAVIECADSAHGLKG
M3ZN43_XIPMA          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRIKTGVGYPQLSAVIECADSAHGLKG
H3AAS2_LATCH          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRIKTGVGYPQLSAVIECADSAHGLKG
H3D8K8_TETNG          MAGNVVTGEMVEELILAGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVIECADAAHGLGG
H3D8L3_TETNG          MAGNVVTGEMVEELILAGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVIECADAAHGLGG
M3ZHJ2_XIPMA          MAGNVVTGEMVEELILAGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVIECADAAHGLGG
A0A087XT47_POEFO      MAGNVVTGEMVEELILAGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVIECADAAHGLGG
V3YXI2_LOTGI          MAGNVVTGEMVEELVLSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVIECADAAHGLGG
D6WQX7_TRICA          IAGNVVTGEMVEELILSGADLIKVGIGPGSMCTTRLKTGVGYPQLSAVLECADAAHGLGG
A0A067RNR4_ZOONE      IAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRIKTGVGFPQLSAVLECADAAHGLQG
E2B9Y1_HARSA          IAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRMKTGVGYPQLSAVIECADAAHGLKG
T1J263_STRMM          IAGNVVTGEMVEELLLAGADIIKVGIGPGSVCTTRKKAGVGYPQLSAVIECGDAAHGLGG
E9GCV2_DAPPU          MAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQISAVIECADAAHGLGG
T1L391_TETUR          MAGNVVTDEMVEELILAGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVLECADAAHGLGG
C3ZRF7_BRAFL          MAGNVVTCEMTEELVLSGADIVKVGIGPGSVCTTRKKTGVGYPQLSAVLECADAAHGLGG
B3RVD3_TRIAD          IAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQISAVLECADAAHGLGG
T1FNV9_HELRO          IAGNVGTSSMVKELIFSGADIVKVGIGSGSACTTREKSGVGCPQLWAVLECAEAAHGLKG
T1FGC2_HELRO          MAGNVVTCEMVEELIISGADIIKIGIGPGSVCTTRKKTGVGYPQLSAVLECADAAHGLGG
E3LKR8_CAERE          MAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNG
E3LKS3_CAERE          MAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNG
A8WIY8_CAEBR          MAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNG
G0MTG7_CAEBE          MAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNG
GMPR_CAEEL            MAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNG
GMPR_ONCVO            FAGNVVTGEMTEELILSGADVVKVGIGSGSVCTTRKKAGVGYPQLSAVLECADASHGLNG
A0A1I7V702_LOALO      FAGNVVTGEMTEELILSGADVVKVGIGPGSVCTTRKKTGVGYPQLSAVLECADASHGLNG
A0A0M3HZC0_ASCLU      FAGNVVTGEMVEELILSGADVVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADASHGLNG
A0A0B2V3V8_TOXCA      FAGNVVTGEMVEELILSGADVVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADASHGLNG
X6NW02_RETFI          MAGNVVTGEMTEQLILSGADIVKVGIGPGSVCTTRKKTGVGYPQLSAVLECADAAHGLGG
E4XTK9_OIKDI          IAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVLECADAAHGLGG
H3G8N5_PHYRM          IAGNVVTGEMVEELLLSGADIIKVGIGPGSVCTTRKQTGVGYPQLSAVLECADAAHGLNG
G4ZSW0_PHYSP          IAGNVVTGEMAEELLLSGADIIKVGIGPGSVCTTRKQTGVGYPQLSAVLECADAAHGLNG
A0A067CE59_SAPPC      IAGNVVTGEMVEELLLSGADIIKIGIGPGSVCTTRKQTGVGYPQLSAVLECADAAHGLRG
A9UWE3_MONBE          MAGNVVTQEMVEELILSGADIVKVGIGPGSVCTTRKQTGVGYPQLSAVIECADAAHGLGG
F2UI21_SALR5          MAGNVVTQEMVEELILSGADIVKVGIGPGSVCTTRKQTGVGYPQLSAVIECADAAHGLGG
C5K4T9_PERM5          MAGNVVTGEMCEELLLSGADIVKVGIGPGSVCTTRKMTGVGYPQLSAVIECADAAHGIGG
Q6N148_RHOPA          MAGTVVTAEMTEALVLAGADIVRVGIGSGSVCTTRDLTGVGYPQLSAVIECADAAHGLKG
G7ZI81_AZOL4          MAGNVVTGDMTEALLLAGADIVKVGIGPGSVCTTRKMTGVGYPQLSAIIECADAAHGLKG
G2KQP8_MICAA          MAGNVVTGEMTEELILSGADVVKVGIGPGSVCTTRKMTGVGYPQLSAIIECADAAHGLGG
A4G886_HERAR          MAGNVVTGDITEELILAGADIVKVGIGPGSVCTTRKMTGVGYPQLSAVIECADAAHGLGG
H9UL20_SPIAZ          IAGNVVSGDMTQELILSGADIVKVGIGPGSACTTRIQTGVGMSQLSAIIDCANVAHGLDG
B2KDI6_ELUMP          MAGNVVTGDMTEDLLLNGADIVKVGIGPGSVCTTRKLTGVGRPQFSTVIECSDAAHGVGG
GMPR_LEIMA            IAGNIATAEAAQDLIDAGADGLKIGVGPGSICITRLVAGSGVPQLSSVMDCARVAKKHGV
A4HXF5_LEIIN          IAGNIATAEAAQDLIDAGADGLKIGVGPGSICITRLVAGSGVPQLSAVMDCARVAKKHGV
A4H923_LEIBR          IAGNIATAEAAQDLIDAGADGLKVGVGPGSICITRLVAGAGVPQLSAVMDCARVAKKHGV
V5BAV1_TRYCR          VAGNIATGEAAAELILAGADGLKIGVGPGSICTTRLVAGSGVPQLSAVMECTRVARKHGV
                       .*.: : .    *:  *** :::*:*.** * **  :. * .*: ::::*   ::    

GUAC_ECOLI            MIVSDGGCTTPGDVAKAF--GGGADFVMLGGMLAGHEESGGRIVE--ENGEKF-------
GUAC_SHIDS            MIVSDGGCTTPGDVAKAF--GGGADFVMLGGMLAGHEESGGRIVE--ENGEKF-------
A0A077ZKL2_TRITR      MIVSDGGCTTPGDVAKAF--GGGADFVMLGGMLAGHEESGGRIVE--ENGEKF-------
GUAC_SALTY            MIVSDGGCTMPGDVAKAF--GGGADFVMLGGMLAGHEESGGSVVE--ENGEKF-------
GUAC_SALAR            MIVSDGGCTMPGDVAKAF--GGGADFVMLGGMLAGHEESGGSVVE--ENGEKF-------
GUAC_CITK8            MIVSDGGCTMPGDVAKAF--GGGADFVMLGGMLAGHEESGGKIVE--ENGEKF-------
D2TGP0_CITRI          MIVSDGGCTTPGDVAKAF--GGGADFVMLGGMLAGHDESGGKIVD--ENGEKF-------
GUAC_ENT38            QIISDGGCTMPGDVAKAF--GGGADFVMLGGMLAGHEESGGTVVE--ENGEKF-------
GUAC_KLEP7            QIISDGGCTMPGDVAKAF--GGGADFVMLGGMLAGHEESGGTIVE--ENGEKF-------
I2BCR2_SHIBC          QIVSDGGCTVPGDVAKAF--GGGADFVMLGGMLAGHDESGGTIVE--QDGEKF-------
A0A089R8G6_PLUGE      QIVSDGGCTTPGDVAKAF--GGGADFVMLGGMLAGHEESGGTVVE--ENGEKF-------
GUAC_SERP5            QIVSDGGCSVPGDVAKAF--GGGADFVMLGGMLAGHDECEGTVVE--ENGEKF-------
GUAC_YERPE            QIVSDGGCSVPGDVAKAF--GGGADFVMLGGMLAGHDECEGRVVE--ENGEKF-------
H2IR16_RAHAC          QIVSDGGCAVPGDVAKAF--GGGADFVMLGGMLAAHEECEGTVVE--ENGEKF-------
Q6D0J7_PECAS          QIVSDGGCAMPGDVAKAF--GGGADFVMLGGMLAGHDECEGTIVE--ENGEKM-------
GUAC_EDWI9            QIVSDGGCTMPGDVAKAF--GGGADFVMLGGMLAAHAECEGRIVE--EQGRKM-------
E1SDA6_PANVC          QIVSDGGCSVPGDIAKAF--GGGADFVMLGGMLAAHDECEGQVVE--ENGESF-------
D4GJT9_PANAM          QIVSDGGCSVPGDIAKAF--GGGADFVMLGGMLAAHDECEGRITE--ENGERF-------
E6W7N0_PANSA          QIVSDGGCAVPGDIAKAF--GGGADFVMLGGMLAAHDECEGTIVE--EQGEQF-------
D8MN59_ERWBE          QIVSDGGCSMPGDVAKAF--GGGADFVMLGGMLAAHEECEGTLVE--EEGEAF-------
B2VD55_ERWT9          QIVSDGGCSVPGDVAKAF--GGGADFVMLGGMLAAHDECEGTLVE--ENGERF-------
E0SG62_DICD3          QIVSDGGCTVPGDVAKAF--GGGADFVMLGGLLAAHEECGGDIIE--EDGRKM-------
GUAC_AERHH            QIVGDGGCTCPGDVAKAF--GGGADFVMLGGMLAAHEECGGEIVD--VDGEPF-------
H2G0I1_OCESG          QIIGDGGCTCPGDVAKAF--GGGADFVMLGGMLAAHEECGGEIIE--RDGQQF-------
GUAC_TOLAT            QIVGDGGCTCPGDVAKAF--GGGADFVMLGGMLAAHEESGGNKFE--RDGKTF-------
GUAC_VIBPA            MIIGDGGCSCAGDVSKAF--GGGADFVMLGGMLAGHEESGGEIIE--KDGETF-------
A0A0Q2SHT9_VIBFU      VIIGDGGCSCAGDVSKAF--GGGADFVMLGGMLAGHEESGGEIID--KDGEKF-------
GUAC_VIBCH            RIIGDGGCTCPGDVAKAF--GGGADFVMLGGMLAGHEEAGGELIV--KDGETF-------
GUAC_VIBVY            RIIGDGGCACAGDVAKAF--GGGADFVMLGGMLAGHEESGGEIVL--KDGESY-------
GUAC_ALIF1            RIIGDGGCSCAGDVSKAF--GGGADFVMLGGMLAGHEESGGEVIE--QDGKTF-------
F7YSH0_VIBA7          CIIGDGGCTCAGDVSKAF--GGGADFVMLGGMLAGHEESGGEVFE--KDGVSY-------
GUAC_VIBA3            MIIGDGGCSCAGDVSKAF--GGGADFVMLGGMLAGHSESGGEVVE--QDGKQY-------
GUAC_PHOPR            RIIGDGGCSCAGDVSKAF--GGGADFVMLGGMLAGHEESNGEVIE--KDGEMF-------
GUAC_SHEPA            QIIGDGGCSCAGDVAKAF--GGGADFVMLGGMLAGHEQSGGEVVE--QDGKMM-------
GUAC_BUCAI            QIISDGGCTVSGDIAKAF--GGGADFVMLGGMLSGHKECSGDIIE--EKSKKY-------
GUAC_BUCBP            QIISDGGCVVSGDIAKAF--GGGADFVMLGGMLAGHKECEGLIFK--ENKKRY-------
B9M3C4_GEODF          RIISDGGCTCPGDIAKAF--GGGADFTMLGGMLAGHDESGGQLVE--RGGQQY-------
B5E8E4_GEOBB          RIISDGGCTCPGDVAKAF--GGGADFVMLGGMFAGHDECGGQLLE--RGGRQF-------
E1SUL4_FERBD          QIVSDGGCTCPGDVAKAF--GGGSDFVMIGGMFAGHEEAGGELVE--KDGKPM-------
A5FEF2_FLAJ1          HIISDGGCTTPGDVAKAF--GAGADFVMLGGMLAGHTESGGELIE--VKGEKF-------
D5BLL1_ZUNPS          QIISDGGCAIPGDVAKAF--GAGADFVMLGGMLAGHDESGGDVIE--VKGEKF-------
C6X3I6_FLAB3          HIISDGGCKIPGDVAKAF--GGGADFVMLGGMFAGHDESGGDIVE--ENGKKY-------
GMPR2_HUMAN           HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
A0A2J8TRA2_PONAB      HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
A0A096NXA5_PAPAN      HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
A0A0D9RTU7_CHLSB      HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
I3M079_ICTTR          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
GMPR2_MOUSE           HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
G3HDD3_CRIGR          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
L9L2T7_TUPCH          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGKKY-------
G5B285_HETGA          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGDLIE--RDGKKY-------
G1Q1Z0_MYOLU          HIISDGGCSSPGDVAKAFVIGAGADFVMLGGMLAGHSESGGELVE--RDGKKY-------
G1MCQ6_AILME          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGRKY-------
M3Y310_MUSPF          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RDGRKY-------
GMPR2_BOVIN           HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELIE--RNGRKY-------
H0XFQ0_OTOGA          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMLAGHSESGGELTE--KNGKKY-------
H3A6N7_LATCH          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMLAGHTECGGETVE--KNGKKY-------
GMPR1_MOUSE           HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
GMPR1_RAT             HIISDGSCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
Q5RCX6_PONAB          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGRKL-------
G1QJZ0_NOMLE          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGRKL-------
GMPR1_HUMAN           HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVFE--RNGRKL-------
A0A0D9R5G2_CHLSB      HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGRKL-------
A0A096NL36_PAPAN      HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGRKL-------
H0WTF3_OTOGA          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGELIE--RNGRKL-------
G5BT40_HETGA          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
H0VKD1_CAVPO          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
L8YC64_TUPCH          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
W5PRM0_SHEEP          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
M3Y216_MUSPF          HIISDGGCMCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--KNGQKL-------
L5KVF4_PTEAL          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RNGQKL-------
G1NUB9_MYOLU          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RDGQKL-------
L5LV55_MYODS          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFSGHTECAGEVIE--RDGQKL-------
H3CHM5_TETNG          HIISDGGCSCPGDVAKAF--GAGADFVMMGGMLAGHDQCSGEVIE--RNGKKY-------
M3ZN43_XIPMA          HIISDGGCSCPGDVAKAF--GAGADFVMMGGMLAGHDQCTGEIIE--KNGKKY-------
H3AAS2_LATCH          HIISDGGCSCPGDVAKAF--GAGADFVMLGGMFAGHDQCAGEMIE--KNGKKV-------
H3D8K8_TETNG          HIISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHSESGGDIIE--KSGKKY-------
H3D8L3_TETNG          HIISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHSESGGDIIE--KSGKKY-------
M3ZHJ2_XIPMA          HIISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHSESGGETIE--KNGKKY-------
A0A087XT47_POEFO      HIISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHSESGGEIIE--KSGKKY-------
V3YXI2_LOTGI          HIISDGGCTCPGDVAKAF--GAGADYVMMGGMLAGHTESGGELIE--RNGKKF-------
D6WQX7_TRICA          HIISDGGCTCAGDVAKAF--GAGADFVMAGGMFSGHDQCEGEVIE--RNGKKF-------
A0A067RNR4_ZOONE      HIIADGGCTCPGDVAKAF--GAGADFVMAGGMFAGHDQCGGDVIQ--RNGRKF-------
E2B9Y1_HARSA          HIIADGGCTCPGDLAKAF--GAGADFVMAGGMFAGHDECEGEIIE--KDGKKF-------
T1J263_STRMM          HIISDGGCTCPGDIAKAF--GAGADFVMLGGMLAGHDQSGGEIIF--HDGKQF-------
E9GCV2_DAPPU          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMLSGHDQSGGDVIE--RDGKKY-------
T1L391_TETUR          HIISDGGCTCPGDICKAF--GAGADFVMLGGMLSGHTECGGETIE--KNGKKY-------
C3ZRF7_BRAFL          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMLAGHDQSGGETIE--KNGKKM-------
B3RVD3_TRIAD          HIISDGGCTCPGDVAKAF--GAGADFVMLGGMFAGHDQSGGELIE--TNGKKV-------
T1FNV9_HELRO          HVISDGGCTCPGDVAKAF--GAGADFVMLGGMLAGHEESGGEVVI--RGDKKY-------
T1FGC2_HELRO          HIISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHDESGGELVT--KGKKKF-------
E3LKR8_CAERE          HVMSDGGCSNPGDVAKAF--GAGADFVMIGGLFAGHDQSGGDLIE--HNGKKF-------
E3LKS3_CAERE          HVMSDGGCSNPGDVAKAF--GAGADFVMIGGLFAGHDQSGGDLIE--HNGKKF-------
A8WIY8_CAEBR          HVMSDGGCSNPGDVAKAF--GAGADFVMIGGLFAGHDQSGGDLIE--SNGKKY-------
G0MTG7_CAEBE          HVMSDGGCSNPGDVAKAF--GAGADFAMIGGLFAGHDQSGGDLIE--HNGKKF-------
GMPR_CAEEL            HVMSDGGCSNPGDVAKAF--GAGADFVMIGGLFAGHDQSGGDLIE--HNGKKF-------
GMPR_ONCVO            HVMSDGGCTNPGDVAKAL--GAGADFVMIGGLFAGHDQCGGDTVE--KDGQKY-------
A0A1I7V702_LOALO      HVMSDGGCTNPGDVAKAF--GAGADFVMIGGLFAGHDQCSGGTVV--KNGQKY-------
A0A0M3HZC0_ASCLU      HVMSDGGCTNPGDVAKAF--GGGADFVMIGGLLAGHDQCGGEVVE--KDGKKY-------
A0A0B2V3V8_TOXCA      HVMSDGGCTNPGDVAKAF--GAGADFVMIGGLLAGHDQCGGEVIE--KGGKKY-------
X6NW02_RETFI          HIISDGGCTMPGDFSKAF--GAGADFVMAGGMFSGHDESGGETKE--IGGKKF-------
E4XTK9_OIKDI          HIISDGGCTCPGDFSKAF--GAGADFVMAGGMFAGHDQSGGDVVE--ENGKKF-------
H3G8N5_PHYRM          HVISDGGCTCPGDVAKAF--GAGADFVMLGGMLAGHDESGGDKIE--MNGKWF-------
G4ZSW0_PHYSP          HVISDGGCTCPGDVAKAF--GAGADFVMLGGMLAGHDESGGDKIE--INGQLF-------
A0A067CE59_SAPPC      HVISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHDESGGDVLE--LGGQMF-------
A9UWE3_MONBE          LVISDGGCTCPGDVSKAF--GAGADFVMLGGMLAGHDESAGELIE--RDGKFY-------
F2UI21_SALR5          HIVADGGCTCPGDIAKAF--GAGADFVMLGGMLAGHDESAGELVE--KDKKFF-------
C5K4T9_PERM5          MIISDGGCTCSGDVCKAF--GGGADFVMLGGMLAGHDESGGQLVHDVRSEKWY-------
Q6N148_RHOPA          HVCSDGGCVVPGDLAKAY--GGGADFVMLGGMLAGHDECGGELRYAEQNGHKTPTS----
G7ZI81_AZOL4          QVCGDGGCTVPGDISKAY--GAGADFVMLGGMLAGHDECEGEIRYEDRDGNRVPVA----
G2KQP8_MICAA          LVCGDGGCTVPGDLAKAF--GAGSDFVMLGGMLAGHDQCEGDVVDED--GHKF-------
A4G886_HERAR          QICADGGCAVPGDLAKAF--GGGADFIMLGGMLAGHDECAGEVVERE--GKKY-------
H9UL20_SPIAZ          QVIGDGGCTCPGDVAKAF--GGGADFVMIGGMFAGHDESGGEMIEEVHQTSQMETDDNGT
B2KDI6_ELUMP          MICADGGCTVAGDVCKSF--CAGADFIMLGGMLAGHEESAGDVIKRVYITTEVEDTGDEQ
GMPR_LEIMA            PCIADGGIKTAGDICKAI--AAGADTVMLGNMLAGTDEAPGRVLVK--DGKKV-------
A4HXF5_LEIIN          PCIADGGVKTAGDICKAI--AAGADTVMLGNMLAGTDEAPGRVLVK--DGKKV-------
A4H923_LEIBR          PCIADGGVKTAGDICKAI--AAGADTVMLGNMLAGTDEAPGRALVK--DGKKV-------
V5BAV1_TRYCR          PCIADGGIKMAGDICKAI--AAGADTVMVGNILAGTEEAPGRVLVK--DGKKV-------
                         .**.   .**..*:    .*:*  * *.:::.  :. *                   

GUAC_ECOLI            -----------MLFYGMSSESAMKRHVGG-----VAEYR--AAEGKTVKLPLRGPVENTA
GUAC_SHIDS            -----------MLFYGMSSESAMKRHVGG-----VAEYR--AAEGKTVKLPLRGPVENTA
A0A077ZKL2_TRITR      -----------MLFYGMSSESAMKRHVGG-----VAEYR--AAEGKTVKLPLRGPVENTA
GUAC_SALTY            -----------MLFYGMSSESAMNRHVGG-----VAKYR--AAEGKTVKLPLRGPVGNTA
GUAC_SALAR            -----------MLFYGMSSESAMNRHVGG-----VAKYR--AAEGKTVKLPLRGPVGNTA
GUAC_CITK8            -----------MLFYGMSSESAMTRHVGG-----VAQYR--AAEGKTVKLPLRGPVEYTA
D2TGP0_CITRI          -----------MLFYGMSSESAMTRHVGG-----VAQYR--AAEGKTVKLPLRGPVENTA
GUAC_ENT38            -----------MLFYGMSSESAMNRHVGG-----VAQYR--AAEGKTVKLPLRGPVENTA
GUAC_KLEP7            -----------MLFYGMSSESAMTRHVGG-----VAKYR--AAEGKTVKLPLRGPVENTA
I2BCR2_SHIBC          -----------MLFYGMSSESAMTRHVGG-----VAEYR--AAEGKTVKLPLRGPVENTA
A0A089R8G6_PLUGE      -----------MLFYGMSSESAMNRHVGG-----VAKYR--AAEGKTVKLPLRGPVDNTA
GUAC_SERP5            -----------MLFYGMSSESAMKRHVGG-----VAQYR--AAEGKTVKLPLRGEVEFTV
GUAC_YERPE            -----------MLFYGMSSESAMKRHVGG-----VAQYR--AAEGKTVKLPLRGSVDNTV
H2IR16_RAHAC          -----------MLFYGMSSESAMKRHVGG-----VAEYR--AAEGKTVKLPLRGPVENTV
Q6D0J7_PECAS          -----------MLFYGMSSASAMERHVGG-----VAEYR--AAEGKTVKLPLRGPVDNTV
GUAC_EDWI9            -----------MLFYGMSSASAMNRHVGG-----VADYR--AAEGKTVSLPLRGPVENTV
E1SDA6_PANVC          -----------MLFYGMSSESAMKRHVGG-----VAQYR--AAEGKTVKLPLRGPVADTA
D4GJT9_PANAM          -----------MLFYGMSSESAMKRHAGS-----VAEYR--AAEGKTVKLPLRGPVEETL
E6W7N0_PANSA          -----------MLFYGMSSESAMKRHVGG-----VAQYR--AAEGKTVRLPLRGPVDDTI
D8MN59_ERWBE          -----------MLFYGMSSESAMKRHVGG-----VAGYR--AAEGKTVKIPFRGPVDNTV
B2VD55_ERWT9          -----------MLFYGMSSESAMKRHVGG-----IAQYR--AAEGKTVRLPVRGPVEPTA
E0SG62_DICD3          -----------MLFYGMSSTSAMERHVGG-----VAEYR--AAEGKTVRLPLRGPVEQTV
GUAC_AERHH            -----------MKFYGMSSSSAMDKHAGG-----VAEYR--ASEGKTVLLPYRGPVENTV
H2G0I1_OCESG          -----------MKFYGMSSASAMDKHAGG-----VAKYR--AAEGKTVELAYRGPVENTV
GUAC_TOLAT            -----------MRFYGMSSSTAMEQHAGG-----IAHYR--ASEGKTVELPFRGPVSATI
GUAC_VIBPA            -----------MKFYGMSSQSAMDKHSGG-----VAKYR--AAEGKTVLLPFRGSVHGTI
A0A0Q2SHT9_VIBFU      -----------MKFYGMSSKSAMDKHSGG-----VAGYR--AAEGKTVLLPYRGSVHGTI
GUAC_VIBCH            -----------MKFYGMSSKSAMDKHSGG-----VAGYR--AAEGKTVLLPYRGSVHGTI
GUAC_VIBVY            -----------MKFYGMSSKSAMDKHSGG-----VAGYR--AAEGKTVLLPYRGSVHGTI
GUAC_ALIF1            -----------MKFYGMSSQSAMDKHSGG-----VAKYR--AAEGKTVLLPFRGSVHNTI
F7YSH0_VIBA7          -----------MKFYGMSSQSAMAKHSGG-----VAKYR--AAEGKTVLLPFRGSVHDTI
GUAC_VIBA3            -----------MKFYGMSSQSAMDKHSGG-----VAKYR--AAEGKTVLLPYRGSVHNTI
GUAC_PHOPR            -----------MKFYGMSSQSAMDKHSGG-----VANYR--AAEGKTVLLPFRGPVENTI
GUAC_SHEPA            -----------VKFYGMSSQSAMDKHSGG-----VAKYR--AAEGKTVLLPFKGSVDNTI
GUAC_BUCAI            -----------MIFYGMSSVSAMQRYEGK-----IAGYR--ASEGKTVKIPFRGGVDSTI
GUAC_BUCBP            -----------MIFYGMSSKFAMDRHIGG-----VARYK--TPEGKTVKVLFRGAVSETI
B9M3C4_GEODF          -----------KLFYGMSSKTAMARHAGG-----VAAYR--ASEGKTVEVPYRGPIAETV
B5E8E4_GEOBB          -----------KLFYGMSSTTAMDKHAGG-----VASYR--ASEGKTVEVPYRGPIDETV
E1SUL4_FERBD          -----------MQFYGMSSDTAMNKHSGG-----VATYR--ASEGKTVLVPFRGPVENTV
A5FEF2_FLAJ1          -----------KQFYGMSSKTAMDKHSGG-----VAEYR--ASEGKTVQVTFKGDVIHTV
D5BLL1_ZUNPS          -----------KRFYGMSSSTAMDKHAGG-----VAEYR--ASEGKTVQVPYRGPVENTL
C6X3I6_FLAB3          -----------RLFYGMSSQTAMDKHAGG-----VAEYR--ASEGKTVKVQYKGAVAETL
GMPR2_HUMAN           -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
A0A2J8TRA2_PONAB      -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
A0A096NXA5_PAPAN      -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
A0A0D9RTU7_CHLSB      -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
I3M079_ICTTR          -----------KLFYGMSSEMAMKK----------------ASEGKTVEVPFKGDVEHTI
GMPR2_MOUSE           -----------KLFYGMSSEMAMKKYSGG-----VAEYR--ASEGKIVEVPFKGDVEHTI
G3HDD3_CRIGR          -----------KLFYGMSSEMAMKKYSGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
L9L2T7_TUPCH          -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEYTI
G5B285_HETGA          -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKIVEVPFKGDVEHTI
G1Q1Z0_MYOLU          -----------KLFYGMSSETAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
G1MCQ6_AILME          -----------KLFYGMSSEMAMKKYAGG-----VAEYRR-ASEGKTVEVPFKGDVEHTI
M3Y310_MUSPF          -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVAVPFKGDVEHTV
GMPR2_BOVIN           -----------KLFYGMSSEMAMKKYAGG-----VAEYR--ASEGKTVEVPFKGDVEHTI
H0XFQ0_OTOGA          -----------KLFYGMSSEMAMKKYYQS-----MAEYSLRASEGKTVEIPFKGDVEHTI
H3A6N7_LATCH          -----------KLFYGMSSETAMKKHTGG-----VADYR--ASEGKTVEVECKGDVEHTL
GMPR1_MOUSE           -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
GMPR1_RAT             -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
Q5RCX6_PONAB          -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
G1QJZ0_NOMLE          -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
GMPR1_HUMAN           -----------KLFYGMSSDTAMNKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
A0A0D9R5G2_CHLSB      -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
A0A096NL36_PAPAN      -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
H0WTF3_OTOGA          -----------MLFYGMSSETAMKKHAGG-----VAEYR--ASEGKTVEVPYRGDVENTI
G5BT40_HETGA          -----------KLFYGMSSETAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVEHTI
H0VKD1_CAVPO          -----------KLFYGMSSETAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVEHTI
L8YC64_TUPCH          -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYRGDVENTI
W5PRM0_SHEEP          -----------KLFYGMSSETAMKKHSGG-----VAEYR--APEGKTVEVPYKGDVENTI
M3Y216_MUSPF          -----------KLFYGMSSDTAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
L5KVF4_PTEAL          -----------KLFYGMSSETAMKKHAGG-----VAEYR--ASEGKTVEVPYKGDVENTI
G1NUB9_MYOLU          -----------KLFYGMSSETAMKKHAGG-----VAEYS--VQQLFPFEILGKGDVENTI
L5LV55_MYODS          -----------KLFYGMSSETAMKKHAGG-----VAEYR--ASEGKTVEVPYRGDVENTI
H3CHM5_TETNG          -----------KLFYGMSSDTAMKKYVGG-----VAEYR--ASEGKTVEVPYRGDVEDTL
M3ZN43_XIPMA          -----------KLFYGMSSDTAMKKYVGG-----VAEYR--ASEGRTVEVPYRGDVENTV
H3AAS2_LATCH          -----------KLFYGMSSDTAMKRYAGG-----VAEYR--ASEGRTVEVPYKGDVENTI
H3D8K8_TETNG          -----------KLFYGMSSDTAMRKHAGG-----VAEYR--ASEGKTVEVPYKGPVEVTI
H3D8L3_TETNG          -----------KLFYGMSSDTAMRKHAGG-----VAEYR--ASEGKTVEVPYKGPVEVTI
M3ZHJ2_XIPMA          -----------KLFYGMSSDTAMKKHSGG-----VADYR--ASEGKTVEVPYKGPVDETI
A0A087XT47_POEFO      -----------KLFYGMSSDTAMKRHAGG-----VADYR--ASEGKTVEVPYKGPVDETI
V3YXI2_LOTGI          -----------KLFYGMSSATAMQKHAGG-----VAEYR--ASEGKTVQIEYRGDVEKTI
D6WQX7_TRICA          -----------KLFYGMSSETAMQKHAGG-----VADYR--TSEGKTVEVPYRGDVEPTV
A0A067RNR4_ZOONE      -----------KMFYGMSSATAMEKHAGR-----VAEYR--SSEGKTVEVPYRGDVEVTV
E2B9Y1_HARSA          -----------KLFYGMASSTAMKKHAGG-----VADYR--SSEGKTVEVPYRGLVENTV
T1J263_STRMM          -----------KLFYGMSSDTAMKKHSGK-----VADYR--ASEGKTVEVEYKGNVEVTI
E9GCV2_DAPPU          -----------KLFYGMSSATAMNKHVGG-----VSEYR--ASEGKTVEVPYRGNVDATI
T1L391_TETUR          -----------KKFYGMSSATAMNKHHGG-----VAEYR--ASEGKTVEVPFRGDVDQTI
C3ZRF7_BRAFL          -----------KSFYGMASATAMKKYAGG-----VAEYR--ASEGKTVEVEYRGDVENTV
B3RVD3_TRIAD          -----------KLFYGMSSAVAMHKYVGK-----VAEYR--ASEGKCVEIPYRGDINDTV
T1FNV9_HELRO          -----------KQFYGMASKVVMEKYNQNM--ADLLDYR--ASEGKVMEVEYRGPIGKTV
T1FGC2_HELRO          -----------KQFYGMASKVAMNKYSEN---KDLLDYR--ASEGKVVEIEYRGPIEKTL
E3LKR8_CAERE          -----------KLFYGMSSDTAMKKHHGS-----VAEYR--ASEGKTVTIPYRGDVNCTV
E3LKS3_CAERE          -----------KLFYGMSSDTAMKKHHGS-----VAEYR--ASEGKTVTIPYRGDVNCTV
A8WIY8_CAEBR          -----------KLFYGMSSDTAMKKHHGS-----VAEYR--ASEGKTVTIPYRGDVNGTV
G0MTG7_CAEBE          -----------KLFYGMSSDTAMKKHHGS-----VAEYR--ASEGKTVTIPYRGDVNGTV
GMPR_CAEEL            -----------KLFYGMSSDTAMKKHHGS-----VAEYR--ASEGKTVTIPYRGDVNGTV
GMPR_ONCVO            -----------KLFYGMSSDTAMEKHEGS-----VAEYR--ASEGKTITVPYRGDISKTV
A0A1I7V702_LOALO      -----------KLFYGMASDTAMKKHKGN-----VPEYR--ASEGKTVILPCRGDISNTV
A0A0M3HZC0_ASCLU      -----------KLFYGMSSDTAMKKYQGS-----VAEYR--ASEGKTIYMPYRGDVSRTI
A0A0B2V3V8_TOXCA      -----------KLFYGMSSDTAMKKYHGS-----VAEYR--ASEGKTIYMPYRGDVSDTV
X6NW02_RETFI          -----------KEFYGMSSAVAMDKYSKG-----VADYR--ASEGKYVLVPYRGPAAETL
E4XTK9_OIKDI          -----------KLFYGMSSSTAMDKHSGG-----VANYR--ASEGKTVKIPYRGDLNNTI
H3G8N5_PHYRM          -----------KRFYGMSSSEAMKKHNGG-----VAEYR--ASEGKSVTVPYRGAVASTC
G4ZSW0_PHYSP          -----------KKFYGMSSSEAMKKHNGG-----VAEYR--ASEGKSVTVPYRGAVASTC
A0A067CE59_SAPPC      -----------KRFYGMSSSVAMNKHAGG-----VAEYR--SSEGKAVTVPYRGPVDGTI
A9UWE3_MONBE          -----------KQFYGMSSDTAMKKYHGS-----VAEYR--SSEGKTIELPYRGPIKATI
F2UI21_SALR5          -----------KMFYGMSSDTAMKKHHGS-----VADYR--ASEGKTITLPYRGPLEPTL
C5K4T9_PERM5          -----------KEFYGMSSDTAMNKYAGG-----VANYR--ASEGKSVKVPYRGPVSHTI
Q6N148_RHOPA          -----------MVFYGMSSETAMNKYHGG-----VADYR--AAEGKTVEVPYRGEVHATV
G7ZI81_AZOL4          -----------MTFYGMSSDTAMHKYSGG-----VASYR--ASEGKTVDVPYRGPVENTM
G2KQP8_MICAA          -----------VTFYGMSSDTAMKKHVGG-----VAKYR--ASEGKTVRVPYRGDVTESL
A4G886_HERAR          -----------KCFYGMSSRAAMEKYAGG-----VADYR--AAEGKEVLVEYRGPVVNTL
H9UL20_SPIAZ          VIGPMYETRRYKMFYGMSSKKANEKYAGG-----LKDYR--SSEGREVKIPYRGPIEATI
B2KDI6_ELUMP          -LKYVLKEKYFKKFYGMSSEYAQDLFYGG-----LKKYR--ASEGKLVEIPYRGEIEKTI
GMPR_LEIMA            -----------KIIRGMAGFGANISKAEREQRLDEDVFHDLVPEGVEGSVPCKGPLAPIL
A4HXF5_LEIIN          -----------KIIRGMAGFGANISKAEREKRLDEDVFNDLVPEGVEGSVPCKGPLAPIL
A4H923_LEIBR          -----------KIIRGMAGFGANISKAEREKRLDEDVFNDLVPEGVEGSVPCKGPLAPIL
V5BAV1_TRYCR          -----------KVIRGMAGFGANLSKAEREQSLDEDVFAEMVPEGVEGSVPCKGPLAPIV
                                   : **:.  .                     :     :  :*      

GUAC_ECOLI            RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRIFNNL----------------
GUAC_SHIDS            RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRIFNNL----------------
A0A077ZKL2_TRITR      RDILGGLRSACTYVGASRLKELTKRTTFIRVL--EQENRIFNNL----------------
GUAC_SALTY            RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRIFNSL----------------
GUAC_SALAR            RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRIFNNL----------------
GUAC_CITK8            RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRVFNSL----------------
D2TGP0_CITRI          RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRIFNSL----------------
GUAC_ENT38            RDVMGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRIFNSL----------------
GUAC_KLEP7            RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRVFNSL----------------
I2BCR2_SHIBC          RDILGGLRSACTYVGASRLKELTKRTTFIRVQ--EQENRVFNSL----------------
A0A089R8G6_PLUGE      RDILGGLRSACTYVGAARLKELTKRTTFIRVQ--EQENRVFNSL----------------
GUAC_SERP5            RDILGGLRSACTYVGAERLKELTKRTTFIRVA--EQENRVFGSN----------------
GUAC_YERPE            RDIMGGLRSACTYVGASHLKELTKRTTFIRVA--EQENRVFGTD----------------
H2IR16_RAHAC          RDILGGLRSACTYVGAERLKELTKRTTFIRVA--EQENRLFGK-----------------
Q6D0J7_PECAS          RDILGGLRSACTYVGASRLKELTKRTTFIRVA--EQENRIFNG-----------------
GUAC_EDWI9            RDILGGLRSACTYVGASRLKELTKRTTFIRVA--EQENRVFGRAD---------------
E1SDA6_PANVC          RDILGGLRSACTYVGAERLKELTKRTTFIRVN--EQENRVFNR-----------------
D4GJT9_PANAM          RDILGGLRSACTYVGAERLKELTKRTTFIRVA--EQENRTFNR-----------------
E6W7N0_PANSA          KDILGGLRSACTYVGAERLKELTKRTTFIRVA--EQENRVFTR-----------------
D8MN59_ERWBE          RDILGGLRSACTYVGAEHLKELTKRTTFIRVN--EQENRVFNR-----------------
B2VD55_ERWT9          LDILGGLRSACTYVGAERLKELTKRTTFIRVN--EQENRVFNR-----------------
E0SG62_DICD3          RDILGGLRSACTYVGASRLKELTKRTTFIRVV--EQENRVFND-----------------
GUAC_AERHH            RDILGGVRSTCTYVGASQLKELTKRTTFIRVR--EQENNVYGKE----------------
H2G0I1_OCESG          QDVLGGVRSTCTYVGAQRLKELTKRTTFIRVR--EQENNVYGKE----------------
GUAC_TOLAT            QDILGGVRSTCTYVGAAKLKELTKRTTFIRVS--EQENPVYGQE----------------
GUAC_VIBPA            SDILGGVRSTCTYVGAAKLKELTKRTTFIRVQ--EQENNVFGKEK---------------
A0A0Q2SHT9_VIBFU      QDILGGVRSTCTYVGAAKLKELTKRTTFIRVQ--EQENNVFGKE----------------
GUAC_VIBCH            QDILGGVRSTCTYVGAAELRELTKRTTFIRVQ--EQENNVYGRE----------------
GUAC_VIBVY            QDILGGVRSTCTYVGAAELRELTKRTTFIRVL--EQENNVFGKEK---------------
GUAC_ALIF1            SDILGGVRSTCTYVGAAKLKELTKRTTFIRVQ--EQENNVFGKE----------------
F7YSH0_VIBA7          SDILGGVRSTCTYVGAAKLKELTKRTTFIRVQ--EQENNVFGRE----------------
GUAC_VIBA3            SDILGGVRSTCTYVGAAKLKELTKRTTFIRVQ--EQENNVFGKE----------------
GUAC_PHOPR            QDIMGGIRSTCTYVGAAQLKELTKRATFIRVQ--EQENNVYGKE----------------
GUAC_SHEPA            NDIMGGVRSTCTYVGAASLKELTKRTTFIRVQ--EQENNVYGKE----------------
GUAC_BUCAI            RDILGGLRSSCTYVGAEKLKELTKRTTFIRVT--EQENCIFNAFKE--------------
GUAC_BUCBP            NNILGGLRSTCTYVGAFTLKELTKRTTFIKVS--EQENIIFNNQEVSN------------
B9M3C4_GEODF          KDILGGVRSACTYVGAEALRELTKRTTFIRVQ--EQENRLFS------------------
B5E8E4_GEOBB          RDVLGGVRSACTYVGASALKELTKRTTFIRVQ--EQENRIFG------------------
E1SUL4_FERBD          QDILGGVRSTCTYVGASKLKELTKRTTFIRVQ--EQENRIFN------------------
A5FEF2_FLAJ1          LDILGGIRSTCTYVGASRLKELTKRTTFIRVS--EQENQVFKK-----------------
D5BLL1_ZUNPS          QDILGGIRSTCTYVGAGRLKELTKRTTFIRVA--EQENTVYSK-----------------
C6X3I6_FLAB3          KDILGGLRSTCTYVGASELRELSKRTTFIRVL--EQENQVFSS-----------------
GMPR2_HUMAN           RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFSEAC---------------
A0A2J8TRA2_PONAB      RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFSEAC---------------
A0A096NXA5_PAPAN      RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQ------------------------
A0A0D9RTU7_CHLSB      RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQTLTGEEARKKTA------------
I3M079_ICTTR          RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNLIFSDAH---------------
GMPR2_MOUSE           RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFSNSQ---------------
G3HDD3_CRIGR          RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFSDSR---------------
L9L2T7_TUPCH          RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFSDGR---------------
G5B285_HETGA          RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFGDAC---------------
G1Q1Z0_MYOLU          RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPSFSVVS---------------
G1MCQ6_AILME          RDILGGIRSTCTYVGAAKLKELSRRTTFIRV--TQQVNPIFSDES---------------
M3Y310_MUSPF          RDILGGLRSTCTYVGAAKLKELSRRTTFIRV--TQQVHSRGRCMSTAL------------
GMPR2_BOVIN           RDIIGGIRSTCTYVGAAKQKELSRRTTFIRV--TQQVKPIFSDES---------------
H0XFQ0_OTOGA          RDILGGIRSTCTYVGAAQLKELSRRTTFIRV--TQQLNPMFSDEH---------------
H3A6N7_LATCH          RDILGGVRSTCTYVGAAKLKELSRRTTFIRV--TQQLNPIFGASSSI-------------
GMPR1_MOUSE           LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFG------------------
GMPR1_RAT             LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFG------------------
Q5RCX6_PONAB          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
G1QJZ0_NOMLE          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
GMPR1_HUMAN           LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
A0A0D9R5G2_CHLSB      LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
A0A096NL36_PAPAN      LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
H0WTF3_OTOGA          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTLFS------------------
G5BT40_HETGA          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
H0VKD1_CAVPO          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
L8YC64_TUPCH          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTAFS------------------
W5PRM0_SHEEP          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQYNTVFS------------------
M3Y216_MUSPF          LDILGGLRSTCTYVGAAKLKELSRRATFIRV--TQQHNTVFS------------------
L5KVF4_PTEAL          LDILGGLRSTCTYVGAAKLKELSKRTTFIRV--TQQHNTVFS------------------
G1NUB9_MYOLU          LDILG-LRSTCTYVGAAKLKELSKRTTFIRV--TQQHNTVFG------------------
L5LV55_MYODS          LDILGGLRSTCTYVGAAKLKELSKRTTFIRV--TQQHNTVFS------------------
H3CHM5_TETNG          RDVLGGLRSTCTYVGAAKLKELSKRTTFIRV--TQQASQMFI------------------
M3ZN43_XIPMA          RDVLGGLRSTCTYVGAAKLKELSRRTTFIRV--TQQSSQMFT------------------
H3AAS2_LATCH          RDILGGLRSTCTYVGAAKLKELSRRTTFIRV--TQQFNQMFS------------------
H3D8K8_TETNG          RDVLGGVRSTCTYVGAGKLKELSRRTTFIRV--TQQLNTVYGNDG---------------
H3D8L3_TETNG          RDVLGGVRSTCTYVGAGKLKELSRRTTFIRV--TQQLNTVYGNDG---------------
M3ZHJ2_XIPMA          RDVLGGVRSTCTYVGAAKLKELSRRTTFIRV--TQQLNTVFGNS----------------
A0A087XT47_POEFO      RDVLGGVRSTCTYVGAAKLKELSRRTTFIRV--TQQLNTVFGNS----------------
V3YXI2_LOTGI          QDVLGGIRSTCTYVGASKLKELSRRTTFIRV--TQQLNEVYSSVTTQH------------
D6WQX7_TRICA          LDILGGLRSACTYTGAAKLKELPKRATFIRC--TQQLNTIFG------------------
A0A067RNR4_ZOONE      LDILGGLRSACTYTGAGKLKELPRRATFIRC--TQQVNQVYDNIGQGE------------
E2B9Y1_HARSA          LDILGGLRSACTYTGAERLRELPRRATFIRC--TQQLNPMYGPPPEM-------------
T1J263_STRMM          QDILGGVRSACTYIGAAKLKEMPKRTTFIRV--MQQTNEIFCG-----------------
E9GCV2_DAPPU          SDILGGLRSACTYTGAARLKELPKRTTFIRV--TQQTNEIFSAFSSGD------------
T1L391_TETUR          LDILGGLRSACTYTGSAKLKELPRRTTFIRV--TQQTNEIFHQLEVN-------------
C3ZRF7_BRAFL          RDILGGLRSACTYVGAGKLKEMKKRTTFIQV--TQQINTIFN------------------
B3RVD3_TRIAD          LDVLGGVRSTCTYVGASKLKELSKRTTFIRV--TQQLNEIFKQNEK--------------
T1FNV9_HELRO          GDILEGVRSACTYVGALTLKKIKKHTTFIRV-----------------------------
T1FGC2_HELRO          IDILGGVRSTCTYVGASKLKELSKRTTFIRV--TQQLNEVFTPFNKPEDQ----------
E3LKR8_CAERE          QDILGGIRSACTYTGSKQLKELAKRATFIRV--TQQTNDMYVPFEVPTLPSQSK------
E3LKS3_CAERE          QDILGGIRSACTYTGSKQLKELAKRATFIRV--TQQTNDMYVPFEVPTLPSQSK------
A8WIY8_CAEBR          QDILGGIRSACTYTGSKQLKELAKRATFIRV--TQQTNDMYVPFEVPTIPSQSK------
G0MTG7_CAEBE          QDILGGIRSACTYTGSKQLKELAKRATFIRV--TQQTNDMYVPFEVPTLPSQSK------
GMPR_CAEEL            QDILGGIRSACTYTGAKHLKELAKRATFIRV--TQQTNDMYVPFEVPTVPAPSK------
GMPR_ONCVO            QDLLGGLRSACTYTGAKKLKELSKRATFVRV--TQQTNEQYATFEISPSELQNLNIAV--
A0A1I7V702_LOALO      QDLLGGLRSACTYIGAKKLKELSKRATFVRV--AHQTNEQYTTFEISAAELQGLNIGI--
A0A0M3HZC0_ASCLU      HDLLGGLRSACTYIGATKLKELSKRATFVRV--TQQTNDQYSAYEVPRID----------
A0A0B2V3V8_TOXCA      HDLLGGLRSACTYTGATKLKELSKRATFIRV--TQQTNDQYSAYEVPVIN----------
X6NW02_RETFI          KTILGGVRSTCTYVGASHLKELSKRTTFIRIQPSSHHNTVFGDEKKD-------------
E4XTK9_OIKDI          RDILGGVRSTCTYVGAGKLKELSKRTTFIRV--TQQLNTIFGNEG---------------
H3G8N5_PHYRM          KEILGGVRSTCTYVGASKLKEISKRTTFIRV--SQQLNEVFGRAPNEQ-------EEQVS
G4ZSW0_PHYSP          KEILGGVRSTCTYVGASKLKEISKRTTFIRV--SQQLNEVFGRAPNEQ-------EEQVS
A0A067CE59_SAPPC      KDILGGVRSTCTYVGASQLKELSKRTTFIRV--TQQLNEVFGKAPNEQELAQRAQDHQLT
A9UWE3_MONBE          LDVLGGLRSSCTYVGASTLKEISKRTTFIRV--TQQ--VCPAVHVLCSCLFSHTCLR---
F2UI21_SALR5          KEIMGSLRSACTYVGAAKLKEISKRTTFIRV--TQQRNLVFEEHDVKSFPVPERQAKTPG
C5K4T9_PERM5          QDVLGGLRSCCTYVGARALKELSKRTTFVRVT--QQLNPVFDHAPAAPQPPKAPPQPTVA
Q6N148_RHOPA          EKIAGGLRSAMTYIGAENLKEIPKRTTFILVN--AQRNTVFDR-----------------
G7ZI81_AZOL4          QEIMGGVRSMMTYIGATRLKEVPKRTTFVRVG--AQLNTVFGG-----------------
G2KQP8_MICAA          QDILGGIRSACTYVGATKLKELSKRTTFVRVG--QQINNIFGQS----------------
A4G886_HERAR          QEILGGVRSACTYVGAHKLKELTKRTTFIRVT--QQLNEVFGKS----------------
H9UL20_SPIAZ          IDLTGGLRSACTYVGARTIKDLPKCTTFVRVT--TQYNTMYEK-----------------
B2KDI6_ELUMP          LAILGGVRSAMTYVGAKRIKDMPKCATFYRVN--RQLNTVFGNE----------------
GMPR_LEIMA            KQLVGGLRSGISYCGSHSIADMQQRARFVRMSGAGLRESGSHDISKL-------------
A4HXF5_LEIIN          KQLVGGLRSGISYCGSHSIADMQQRARFVRMSGAGLRESGSHDISKL-------------
A4H923_LEIBR          QQLVGGLRSGISYCGAHSIAEMQQHAKFVRMSGAGLRESGSHDISKL-------------
V5BAV1_TRYCR          RQLVGGLRSGMSYCGATCINEMQQNARFVRMTGSGLRESGSHSISKL-------------
                        :   :**  :* *:    .: : : *                                

GUAC_ECOLI            -----------------------------------------
GUAC_SHIDS            -----------------------------------------
A0A077ZKL2_TRITR      -----------------------------------------
GUAC_SALTY            -----------------------------------------
GUAC_SALAR            -----------------------------------------
GUAC_CITK8            -----------------------------------------
D2TGP0_CITRI          -----------------------------------------
GUAC_ENT38            -----------------------------------------
GUAC_KLEP7            -----------------------------------------
I2BCR2_SHIBC          -----------------------------------------
A0A089R8G6_PLUGE      -----------------------------------------
GUAC_SERP5            -----------------------------------------
GUAC_YERPE            -----------------------------------------
H2IR16_RAHAC          -----------------------------------------
Q6D0J7_PECAS          -----------------------------------------
GUAC_EDWI9            -----------------------------------------
E1SDA6_PANVC          -----------------------------------------
D4GJT9_PANAM          -----------------------------------------
E6W7N0_PANSA          -----------------------------------------
D8MN59_ERWBE          -----------------------------------------
B2VD55_ERWT9          -----------------------------------------
E0SG62_DICD3          -----------------------------------------
GUAC_AERHH            -----------------------------------------
H2G0I1_OCESG          -----------------------------------------
GUAC_TOLAT            -----------------------------------------
GUAC_VIBPA            -----------------------------------------
A0A0Q2SHT9_VIBFU      -----------------------------------------
GUAC_VIBCH            -----------------------------------------
GUAC_VIBVY            -----------------------------------------
GUAC_ALIF1            -----------------------------------------
F7YSH0_VIBA7          -----------------------------------------
GUAC_VIBA3            -----------------------------------------
GUAC_PHOPR            -----------------------------------------
GUAC_SHEPA            -----------------------------------------
GUAC_BUCAI            -----------------------------------------
GUAC_BUCBP            -----------------------------------------
B9M3C4_GEODF          -----------------------------------------
B5E8E4_GEOBB          -----------------------------------------
E1SUL4_FERBD          -----------------------------------------
A5FEF2_FLAJ1          -----------------------------------------
D5BLL1_ZUNPS          -----------------------------------------
C6X3I6_FLAB3          -----------------------------------------
GMPR2_HUMAN           -----------------------------------------
A0A2J8TRA2_PONAB      -----------------------------------------
A0A096NXA5_PAPAN      -----------------------------------------
A0A0D9RTU7_CHLSB      -----------------------------------------
I3M079_ICTTR          -----------------------------------------
GMPR2_MOUSE           -----------------------------------------
G3HDD3_CRIGR          -----------------------------------------
L9L2T7_TUPCH          -----------------------------------------
G5B285_HETGA          -----------------------------------------
G1Q1Z0_MYOLU          -----------------------------------------
G1MCQ6_AILME          -----------------------------------------
M3Y310_MUSPF          -----------------------------------------
GMPR2_BOVIN           -----------------------------------------
H0XFQ0_OTOGA          -----------------------------------------
H3A6N7_LATCH          -----------------------------------------
GMPR1_MOUSE           -----------------------------------------
GMPR1_RAT             -----------------------------------------
Q5RCX6_PONAB          -----------------------------------------
G1QJZ0_NOMLE          -----------------------------------------
GMPR1_HUMAN           -----------------------------------------
A0A0D9R5G2_CHLSB      -----------------------------------------
A0A096NL36_PAPAN      -----------------------------------------
H0WTF3_OTOGA          -----------------------------------------
G5BT40_HETGA          -----------------------------------------
H0VKD1_CAVPO          -----------------------------------------
L8YC64_TUPCH          -----------------------------------------
W5PRM0_SHEEP          -----------------------------------------
M3Y216_MUSPF          -----------------------------------------
L5KVF4_PTEAL          -----------------------------------------
G1NUB9_MYOLU          -----------------------------------------
L5LV55_MYODS          -----------------------------------------
H3CHM5_TETNG          -----------------------------------------
M3ZN43_XIPMA          -----------------------------------------
H3AAS2_LATCH          -----------------------------------------
H3D8K8_TETNG          -----------------------------------------
H3D8L3_TETNG          -----------------------------------------
M3ZHJ2_XIPMA          -----------------------------------------
A0A087XT47_POEFO      -----------------------------------------
V3YXI2_LOTGI          -----------------------------------------
D6WQX7_TRICA          -----------------------------------------
A0A067RNR4_ZOONE      -----------------------------------------
E2B9Y1_HARSA          -----------------------------------------
T1J263_STRMM          -----------------------------------------
E9GCV2_DAPPU          -----------------------------------------
T1L391_TETUR          -----------------------------------------
C3ZRF7_BRAFL          -----------------------------------------
B3RVD3_TRIAD          -----------------------------------------
T1FNV9_HELRO          -----------------------------------------
T1FGC2_HELRO          -----------------------------------------
E3LKR8_CAERE          -----------------------------------------
E3LKS3_CAERE          -----------------------------------------
A8WIY8_CAEBR          -----------------------------------------
G0MTG7_CAEBE          -----------------------------------------
GMPR_CAEEL            -----------------------------------------
GMPR_ONCVO            -----------------------------------------
A0A1I7V702_LOALO      -----------------------------------------
A0A0M3HZC0_ASCLU      -----------------------------------------
A0A0B2V3V8_TOXCA      -----------------------------------------
X6NW02_RETFI          -----------------------------------------
E4XTK9_OIKDI          -----------------------------------------
H3G8N5_PHYRM          KKQKTG-----------------------------------
G4ZSW0_PHYSP          KKQKTG-----------------------------------
A0A067CE59_SAPPC      MKPSLEA----------------------------------
A9UWE3_MONBE          -----------------------------------------
F2UI21_SALR5          EHAPADPVDDDDGDGDGDDPAAK------------------
C5K4T9_PERM5          AAKEAHETESEGAPSPKRARSGSLGSPRHHRHESNSPRHRH
Q6N148_RHOPA          -----------------------------------------
G7ZI81_AZOL4          -----------------------------------------
G2KQP8_MICAA          -----------------------------------------
A4G886_HERAR          -----------------------------------------
H9UL20_SPIAZ          -----------------------------------------
B2KDI6_ELUMP          -----------------------------------------
GMPR_LEIMA            -----------------------------------------
A4HXF5_LEIIN          -----------------------------------------
A4H923_LEIBR          -----------------------------------------
V5BAV1_TRYCR          -----------------------------------------