CLUSTAL format seed alignment for MF_00597

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ADC1_RHILO      MHQDTVRGKAFAMPLISPAYPAGPYRFRNREYLIITYRTDPQKLRDLVPEPLQVCEPMVK
ADC2_RHILO      MHQDTVRATAFAMPLTSPAYPVGPYRFRNREYLIITYRTDPKKLRSLVPEPLELSEPLVK
ADC_RALSO       MDIDTVRKTAFAMPLTSPAYPPGPYRFINREFFIITYRTDPARLRAMVPEPLEVPEPLVS
ADC3_RHILO      ------MKRAYAMPLTNPSFPPGPYRFFDREYIIITYRTTREALEAVVPAPLEIDEPLVK
ADC_CLOAB       -MLKDEVIKQISTPLTSPAFPRGPYKFHNREYFNIVYRTDMDALRKVVPEPLEIDEPLVR
ADC_CLOBE       -MLESEVSKQITTPLAAPAFPRGPYRFHNREYLNIIYRTDLDALRKIVPEPLELDGAYVR
ADC_STRNO       -MRAEDVVRAPSTPLDAPAFPAGPYRFTDREYLNITYRTDPEALRRVVPEPLRVAEPLVR
                           : **  *::* ***:* :**:: * ***    *. :** **.:  . * 

ADC1_RHILO      FEFIRMPDSTGFGDYTEGGQVIPVSFYGRRGSYTHCMFLDDHPPIAGGRELWGFPKKLAS
ADC2_RHILO      FEFIRMPDSTGFGNYTESGQVIPVTFRGRKGSYTHCMFLNDHPPIAGGRELWGFPKKLAT
ADC_RALSO       YEFIRMADSTGFGDYTESGQVIPVTFEGKPGTYTLAMYLDDHPPLAGGREMWGFPKKLAT
ADC3_RHILO      YEFIRMPDSTGFGDYTETGQVIPVKYKGQHGGYVHSMYLDDDAPIAGGRELWGFPKKLAN
ADC_CLOAB       FEIMAMHDTSGLGCYTESGQAIPVSFNGVKGDYLHMMYLDNEPAIAVGRELSAYPKKLGY
ADC_CLOBE       FEMMAMPDTTGLGSYTECGQAIPVKYNEVKGDYLHMMYLDNEPAIAVGRESSAYPKKFGY
ADC_STRNO       FEVMRMPDVTGLGDYTEAGQLAVVEYEGEPGEYGISIHVDNFPAIASGREIGAFPKKAGR
                :*.: * * :*:* *** **   * :    * *   :.::: ..:* ***  .:*** . 

ADC1_RHILO      PTLRTETDTLVGTLDYGPVRVATGTMGYKHRAADLASVRASLAEPNFLLKIIPHVDG-TP
ADC2_RHILO      PTLRTETDTLVGTLDYGPVRVATATMGYKHEAADLSAVRSSLAEPNFLLKIIPHVDG-TP
ADC_RALSO       PRLQTSKDTLLGTLDYGPVRVATGTMGYKHKELDLAAQQQRLARPNFLLKIIPHVDGRTA
ADC3_RHILO      PKIVHEGEVIVGTLHYGSVLCATGTMGYKHREADHDSVLASLAAPNFLIKIIPHVDG-GP
ADC_CLOAB       PKLFVDSDTLVGTLDYGKLRVATATMGYKHKALDANEAKDQICRPNYMLKIIPNYDG-SP
ADC_CLOBE       PKLFVDSDALVGALKYGALPVVTATMGYKHEPLDLKEAYTQIARPNFMLKIIQGYDG-KP
ADC_STRNO       PRLYVDQDTLVGTLDHGTLPVARATMGYKHRPLNTEQAREELTRPTFMLKKLPHYDG-SP
                * :  . :.::*:*.:* :  . .******.  :       :  *.:::* :   **  .

ADC1_RHILO      RICELVEYHLEDVHLRGAWTGPAALNLWSHALAPVAELPVLEVVSAVHLVADLTLALGKV
ADC2_RHILO      RICELVEYHLEDVDLRGAWAGPASLNLWSHALAPVAELPVLEVVSAMHIVADLTLALGKV
ADC_RALSO       RICELSRNTMEDIVMKGAWTGPASLELAHHALAPVADLPVLEIVEARHLIADLTLGMGEV
ADC3_RHILO      RICELVRYYLTDITLKEAWTAPAALDLRPHVMADVAKLPVLDIISAVHFKADLTLGLGEV
ADC_CLOAB       RICELINAKITDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEV
ADC_CLOBE       RICELICAENTDITIHGAWTGSARLQLFSHALAPLADLPVLEIVSASHILTDLTLGTPKV
ADC_STRNO       RICELVRTQIADIVVKGAWSGPARLQLFAHALAPLADLPVLEVVSAAHVLTDLTLGRARV
                *****      *: :: **:..: *:*  *.:* : .*** :::.: *. :*: *   .*

ADC1_RHILO      VHDYLAKA---------------
ADC2_RHILO      VHDYLPKSEPRDLKGRSHAFAE-
ADC_RALSO       VFDYLAK----------------
ADC3_RHILO      VHDYLSDHNRLATSTTQPEKIRA
ADC_CLOAB       IYDYLK-----------------
ADC_CLOBE       VHDYLSVK---------------
ADC_STRNO       VHDYLA-----------------
                :.***