CLUSTAL format seed alignment for MF_00599

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FTSB_SHIFL      MG--------KLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAALQATNAKLKARNDQ
FTSB_SHIF8      MG--------KLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAALQATNAKLKARNDQ
FTSB_ECOLI      MG--------KLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQ
FTSB_ECO27      MG--------KLTLLLLAILVWLQYSLWFGKNGIHDYTRVNNDVAAQQATNAKLKARNDQ
FTSB_SHIB3      MG--------KLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQ
FTSB_ESCF3      MG--------KLTLLLLAILVWLQYSLWFGKNGIHDYSRVNDDVAAQQATNAKLKARNDQ
FTSB_SALTI      MG--------KLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQ
FTSB_SALTY      MG--------KLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQ
FTSB_SALAR      MG--------KLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQ
FTSB_CITK8      MG--------KLTLLLLTLLVWLQYSLWFGKNGIHDYSRVNDDVAAQQATNAKLKARNDQ
FTSB_CROS8      MG--------KLTLLLLALLVWLQYSLWFGKNGIHDYSRVADDVAVQQATNAKLKARNDQ
FTSB_KLEAE      MG--------KLTLLLLALLVWLQYSLWFGKNGLHDYTRVNDDVTAQQATNAKLKARNDQ
FTSB_KLEP3      MG--------KLTLLLLALLVWLQYSLWFGKNGLHDYTRVNDDVTAQQATNAKLKARNDQ
FTSB_KLEP7      MG--------KLTLLLLALLVWLQYSLWFGKNGLHDYTRVNDDVTAQQATNAKLKARNDQ
FTSB_ENT38      MG--------KLTLLLLALLVWLQYSLWFGKNGLHDYGRVNDDVTAQQATNAKLKARNDQ
FTSB_SERP5      MG--------KLTLLLLALLGWLQYSLWLGKNGVHDYVRVNDDVAVQQGSNAKLKARNDQ
FTSB_PECAS      MG--------KLTLLLLILLGWLQYSLWLGKNGIHDYVRVKDDVVVQQGNNAKLKDRNEQ
FTSB_PECCP      MG--------KLTLLLLILLGWLQYSLWLGKNGIHDYVRVKDDVVVQQGNNAKLKDRNEQ
FTSB_EDWI9      MG--------KLTLLLVVLLGWLQYSLWVGKNGVHDYMRVKQDVATQQANNAKLKSRNDQ
FTSB_ERWT9      MG--------KLTLLLLVLLGWLQYSLWLGKNGIHDYTRVDEDVASQQGNNAKLKARNDR
FTSB_YERE8      MG--------KLTLLLLILLGWLQYSLWLGKNGVHDFVRVKDDVALQEVNNGKLKARNDQ
FTSB_YERPE      MG--------KLTLLLLVLLGWLQYSLWLGKNGIHDFVRVKEDVAAQEANNSTLKARNDQ
FTSB_PHOLL      MG--------KLTLLLLVLLGWLQYSLWLGKNGIHDYVRVKNDVAMQERNNSKLKARNDQ
FTSB_SODGM      MG--------KLTLLLLVLLGWLQYSLWLGKNGVHDLVRVESDVAAQQSNNAQLKARNDQ
FTSB_TOLAT      MR--------LFTLILMVVLALVQRQLWFGKNGLVEYRQVSENLLRRQADNQKLQERNML
FTSB_COXBU      MR--------PIIAILIALFILLQYQLWFAAGGIVSVHHLNENINHQIMENQKLKDRNTA
FTSB_SHESA      MK--------FFVIALIVLLGLLQYRLWSGDNSLPEYFVLQKQIAAQQEGNAKLNERNQV
FTSB_SHESR      MK--------FFVIALIVLLGLLQYRLWSGDNSLPEYFVLQKQIAAQQEGNAKLNERNQV
FTSB_SHESM      MK--------FFVIALIVLLGLLQYRLWSGDNSLPEYFVLQKQIAAQQDGNAKLNERNQV
FTSB_SHEON      MK--------FFVITLIVLLGLLQYRLWSGDNSLPEYFVLQKQIAAQQDGNAKLNERNQV
FTSB_SHESW      MK--------FFVIALIVLLGLLQYRLWSGSNSLPEYFVLQKHIAVQQEGNDKLNERNQV
FTSB_SHEFN      MK--------QLIFLLICLLSLLQYRLWLGDNNLSEYVLLQTQIAGQEQSNGKLVARNQI
FTSB_SHEHH      MK--------RLLIVLIALLAMLEYRLWFGDKSLAESFHLQEQIKLQQQSNAQLVARNQI
FTSB_SHEPA      MK--------RLLFVLIALLAMLQYRLWLGDKSLADSFHLQEQIKLQQQSNAQLVARNQV
FTSB_SHEAM      MK--------PFVLVLFALLALLQYRLWFGENSLTEYFTLKDRISHQQSGNAELLERNEV
FTSB_PSEA6      MK--------VVPILLFVLLAALQYRLWFGKNSIPEYVAMEKSVAEQAEQNTELLQRNNL
FTSB_NITOC      MK--------FIVGLLLVLLLALQYQLWISKDGLGELRQLSRSIKQQRHENATLIERNQV
FTSB_THISH      MK--------WVTGLLVVLLLGLQYKLWIGEGSVAEVWQLRQTLEAQRAENEELRYRNAA
FTSB_ALKEH      MR--------WVLAGLTALLLWLQGLLWFGEGGLNDVRGLSRSVEAQREEVDRLRQRNQA
FTSB_AZOSB      MR--------WPVIILAVLVVVLQYPLWLGKGGWLRVWEVDRKLHEQREENTRLEERNAG
FTSB_AROAE      MR--------WPLIVLAVLVIVLQYPLWLGKGGWLRVWDVDRQLQAQRETNQRLEQRNAG
FTSB_DECAR      MR--------WLTVGLLAAIGLLQYPLWVGKGGWLKVWEYDRQLQQQKEVTRKLEIRNAG
FTSB_CHRVO      MR--------WLTVTLVTVILALQWPLWFGKGSWLRVWQLDKQLQEQRATTQKLVARNAA
FTSB_METFK      MR--------LLTLIFVALIALLQYPLWLGKGSWLRVWDLNQKIVAQKAVNAELKLRNDT
FTSB_BORPA      MR--------LLFLVLLVLLGLIQYPLWLGKGGWFKVWDLQRQVAEQRETNDGLRARNTA
FTSB_BORPE      MR--------LLFLVLLVLLGLIQYPLWLGKGGWFKVWDLQRQVAEQRETNDGLRARNTA
FTSB_BORPD      MR--------LLFLVLLVLLGLIQYPLWLGKGGWFKVWDLQRQVAAQHETNDGLRARNAA
FTSB_HERAR      MR--------LIILCLAALVLLIQFPLWLGKGGWLRVWDLDQQVIAAQKKNDELRARNAK
FTSB_JANMA      MR--------LIILCLAALVVLIQFPLWLGKGGWLRVWDLDHQVVAAQKKNDELKARNAK
FTSB_CUPNH      MR--------LISLLLFVLLLAIQYPLWLGKGGWLRVWDLNRQLTEQGTRNQTLKLRNAK
FTSB_CUPMC      MR--------LISLLLFVLLLAIQYPLWLGKGGWLRVWDLNRQVNEQTVHNQALKLRNAK
FTSB_CUPPJ      MR--------LISLLLFVLLLAIQYPLWLGKGGWLRVWELNHQVQEQATRNQMLKLRNAK
FTSB_RALPJ      MR--------LITLFLLLLLLAIQYPLWLGKGGWLRVWDMQKQVTAQNQRNAELKQRNTK
FTSB_RALSO      MR--------LITLFLLLLLLAIQYPLWLGKGGWLRVWDMQKQVASQNQRNAELKQRNLK
FTSB_POLNS      MR--------IVIYSMLVLLIAIQYPLWLGKGGWLKVYEMERQVELQEAKNSLLALRNAK
FTSB_POLAQ      MR--------IVIYSMLVLLIAIQYPLWLGKGGWLKVYEMEKQVELQEAKNSLLALRNAK
FTSB_NEIG1      MK--------WVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAVQEEKNQTLALRNHS
FTSB_NEIMB      MK--------WVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAVQEEKNQTLALRNHS
FTSB_SACD2      MK--------WLAIILVVALLALQYRLWMGEGSIASVVSLNREIAKQKEENARLRERNRL
FTSB_TERTT      MK--------WLVAVLVVFVAMFQYRLWVGEGSIADVVRLEREIARQEADNERLRERNKQ
FTSB_PSEAE      MRLRSP---YWLFVVLILALAGLQYRLWVGDGSLAQVRDLQKQIADQHGENERLLERNRI
FTSB_STRMK      MRDWR-----WMLLVLALLLGWLQYRFWFGPGNSGEVMMLEAQVANQERDNEGLQQRNDA
FTSB_STRM5      MRDWR-----WMLLVLALLLGWLQYRFWFGPGNSGEVMMLEAQVTNQERDNEGLQQRNDA
FTSB_XANAC      MRNWR-----WLLLVLAVLLAWLQYRFWFGPGNSGEVMMLEAQVAHQTQDNEGLRQRNQA
FTSB_XANC5      MRNWR-----WLLLVLAVLLAWLQYRFWFGPGNSGEVMMLEAQVAHQTQDNEGLRQRNQA
FTSB_XANOR      MRNWR-----WLLLVLAVLLAWLQYRFWFGPGNSGEVMMLEAQVAHQTQDNEGLRQRNQA
FTSB_XANCP      MRNWR-----WLLLVLAVLLAWLQYRFWFGPGNSGEVMMLEAQVAHQTRDNEGLRQRNQA
FTSB_XANC8      MRNWR-----WLLLVLAVLLAWLQYRFWFGPGNSGEVMMLEAQVAHQTRDNEGLRQRNQA
FTSB_XANCB      MRNWR-----WLLLVLAVLLAWLQYRFWFGPGNSGEVMMLEAQVAHQTRDNEGLRQRNQA
FTSB_XYLF2      MRNWR-----WLLLVLAALLAWLQHRFWFGPGNSGEVRMLQVQIVQQHQENERLRQRNAS
FTSB_XYLFT      MRNWR-----WLLLVLAALLAWLQHRFWFGPGNSGEVRMLQVQIVQQHQENERLRQRNAS
FTSB_XYLFM      MRNWR-----WLLLVLAALLAWLQHRFWFGPGNSGEVRMLQVQIVQQHQENERLRQRNAS
FTSB_XYLFA      MRNWR-----WLLLVLAALLSWLQHRFWFGPGNSGEVRMLQVQIVQQHQENERLRQRNAS
FTSB_FRATT      MDIKSNSFFYIFISVVLLLIAILQYDLWFSNTGFIKYQALKKSVISQQKEVKHKSQTNVQ
FTSB_COLP3      MR--------VFTAILLILLVLLQYRLWFGKNSVPDYLVLKENVVRQQSANEKLQQRNKL
FTSB_PSEHT      MR--------FFQVGLLCLALFVQYRLWFGHNGVQDYTRLKSAVASHLQTNEKLIKRNKV
FTSB_IDILO      MR--------VTLVVLLALFLALQYRLWFGKNSLPDYWRLQQEVSNQKNTNENLERRNQL
FTSB_ALIF1      MR--------TFAIFLLIALGWLQYTLWFGKNGMSDYAQVSNDVALQEEVNQGLRNRNEQ
FTSB_ALIFM      MR--------TFAIFLLIALGWLQYTLWFGKNGMSDYAQVSNDVALQEEVNQGLRNRNEQ
FTSB_ALISL      MR--------AFAVLLIIALGWLQYTLWFGKNGMEDYAQVSNDVQLQEEVNQGLRNRNGQ
FTSB_VIBCH      MR--------VFALTLSLLLVWLLYTLMWGKNGVMDFRAVQAEIEVQQQVNANLHLRNQE
FTSB_VIBTL      MR--------IFALVLLIVFGWLQHTLWLGKNGISDYYGVNNEIQVQQQVNEKLHLRNAE
FTSB_VIBCB      MR--------IFVIALTLLFGWLQYTLWFGKNGVSDYYTVEDEIEVQQQVNSKLQARNNE
FTSB_VIBPA      MR--------IFVIALTLLFGWLQYTLWFGKNGVSDYYTVKDEIEVQQQVNSKLQARNNE
FTSB_VIBVU      MR--------LFILVLTLLFGWLQYTLWFGKNGVSDYYTIESDIEAQQLVNTKLQARNSE
FTSB_VIBVY      MR--------LFILVLTLLFGWLQYTLWFGKNGVSDYYTIESDIEAQQLVNTKLQARNSE
FTSB_PSYIN      MR--------LFVFFMLCLLVLLQYHLWFGKNGLGDRHNLQEEVTLILENNSELRQRNQM
FTSB_ACTPJ      MR--------VLIVFFAFLLAFFQYSFWFGKNGWSDYQEAQTAVERLKDENTKLEARNNL
FTSB_HAEDU      MR--------LMIVFFGLLLFFFQYSFWLGKNGWQDYKNAKLEVQRLTAENIKLNARNEL
FTSB_HAEPS      MR--------VLVVVLALLLGGFQYAFWFGQNGWNEYQQAKQEVSQLKETNQKLTARNQL
FTSB_ACTSZ      MR--------LLIIILAFVLMLFQYDLWFGKNGYLDYQETQQEIAVHKEENTKLSQRNQV
FTSB_MANSM      MR--------LFILILSAILLLFQYDLWFGKNGYLDYKETAEEIAMHKAENTKLSQRNQV
FTSB_PASMU      MR--------LFIFLLVAVLLLFQYDFWFGKNGYLDYKRTAQQIAQHKQENEKLSQRNQV
FTSB_HAEIN      MR--------LLILILLSVLVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQR
FTSB_HAEIE      MR--------LLILILLSVLVLFQHDFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQR
FTSB_HAES1      MR--------LFILSLFALLVMFQYDFWFGKNGYLDYQDIKAEIIQRKQENKKLSQRNQT
FTSB_HISS2      MR--------LFILSLFALLVMFQYDFWFGKNGYLDYQDIKAEIIQRKQENKKLSQRNQT
FTSB_BUCAI      MK--------ILKIFLLSLLFWLQYSLWFGKNGVLDFIKIYRRVTIEKKNNEYLDMRNNQ
FTSB_BUCAP      MK--------MLKIFLLFLLFWLQCSLWIGKNGILDYIKIYKKIIVQKKKNEDFQIRNNQ
                *              .          :  .  .          :             *  

FTSB_SHIFL      LFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKR-AQSAGQ-----NNR---
FTSB_SHIF8      LFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKR-AQSAGQ-----NNR---
FTSB_ECOLI      LFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKR-AQSAGQ-----NNR---
FTSB_ECO27      LFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKR-AQSAGQ-----NNR---
FTSB_SHIB3      LFAEIDDLNGGQEALEERARNELSMTKPGETFYRLVPDASKR-AQSAGQ-----NNR---
FTSB_ESCF3      LFAEIDDLNGGQEALEERARNELSMTKPGETFYRLVPDASKR-AQTAGQ-----NNR---
FTSB_SALTI      LFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKR-AATAGQ-----THR---
FTSB_SALTY      LFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKR-AATAGQ-----THR---
FTSB_SALAR      LFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKR-AQTAGQ-----NNR---
FTSB_CITK8      LFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKR-AQAAGQ-----TNR---
FTSB_CROS8      LFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDATKR-AGGPAQ-----NNR---
FTSB_KLEAE      LFAEIDDLNGGQEAIEERARNELSMTRPGETFYRLVPDASKR-NQASGQQQ---NNR---
FTSB_KLEP3      LFAEIDDLNGGQEAIEERARNELSMTRPGETFYRLVPDASKR-NQASGQQQ---NNR---
FTSB_KLEP7      LFAEIDDLNGGQEAIEERARNELSMTRPGETFYRLVPDASKR-NQASGQQQ---NNR---
FTSB_ENT38      LFAEIDDLNGGQEAIEERARNELSMTKPDETFYRLVPDASKR-NQGSAQ-----NNR---
FTSB_SERP5      LFAEIDDLNGGQEAIEERARNELSMIKPGETFYRLVPDQSRRNAASSSQ-----NNLQK-
FTSB_PECAS      LFAEIDDLNGGQEAIEERARNELGMIKPGESFYRLVPESNHRNANTPSSTNTSSNNTQR-
FTSB_PECCP      LFAEIDDLNGGQEAIEERARNELGMIKPGESFYRLVPESNHRNANTAPSTNTPSNNIQR-
FTSB_EDWI9      LFAEIDDLNGGQEAIEERARNELGMIKPGETFYRLVPDQNKRRTVGTASQ----SVASYP
FTSB_ERWT9      LFAEIDDLNGGSEAIEERARNELGMIKPGETFYRLVPDQNRR----NAQQ----GRP---
FTSB_YERE8      LFAEIDDLNGGQEAIEERARNELGMIKPGESFYRLVPDQSRRNASIPSTQ----NNAQQ-
FTSB_YERPE      LFAEIDDLNGGQEAIEERARNELGMIKPGESFYRLVPDQSRRNAGTPSTQ----NNAQ--
FTSB_PHOLL      LSAEIDDLTGGQEAIEERSRSELGMIKPGETFYRLIIDKSKENTSRPSTP----NNTQ--
FTSB_SODGM      LFAEIDDLNGGQGAIEERSRNELGMIKPGETFYRLVPEQSKRQPAAPATQ----DNQ---
FTSB_TOLAT      LKEDIEDLKSGLEAIEELARNDLGFIKSGETFYRVLPRDSAGQN-------KQSSLPKSD
FTSB_COXBU      LLADIDDLKHGAEAIEEHARNDLGMIKKNEVFYQIVK-----------------------
FTSB_SHESA      LKEEIIDLKSGTEAIEERARNELGMVKEGETFYRVVGGD------------RSVSSPSQ-
FTSB_SHESR      LKEEIIDLKSGTEAIEERARNELGMVKEGETFYRVVGGD------------RSVSSPSQ-
FTSB_SHESM      LKEEIIDLKSGTEAIEERARNELGMVKEGETFYRVVGGD------------RSVSSPSQ-
FTSB_SHEON      LKEEIIDLKSGTEAIEERARNELGMVKEGETFYRVVGGD------------RAVSSPSQ-
FTSB_SHESW      LKEEIIDLKSGTEAIEERARNELGMVKEGETFYRVVGGE------------RSVSSPSQ-
FTSB_SHEFN      LKEEIIDLKRGTEAIEERARNELGMVKEGETFYRVVGSE------------LRERNPFNR
FTSB_SHEHH      LREEISDLRSGTEALEERARNELGMVKEGETFFRVVGGE------------RDKPSND--
FTSB_SHEPA      LREEISDLRSGTEALEERARNELGMVKEGETFFRVVGGE------------RGGVPEN--
FTSB_SHEAM      LKEEIQDLKSGTEALEERARNELGLIEQGETFFRVVGNDS-----------RSIRSSEQS
FTSB_PSEA6      LKADIQDLKVGLEAVEERARNELGLIKQGETFYRILPSE------------------E--
FTSB_NITOC      LKAEVQDLKSGLDALEERARSGLGMIKQGETFFQVVEE--------------P-------
FTSB_THISH      LDAEVTDLKTGLDAIEERARRELGMIRRDETFFQVVGR--------------PGETP---
FTSB_ALKEH      LEAEVNDLKTGLEALEERARSELGMIREGETFYQIIER--------------EDDAR---
FTSB_AZOSB      LDAEVRDLKSGNEAIEERARLELGLTKPNEIFVQV-----------------PQKH----
FTSB_AROAE      LEAEVRDLKSGNEAVEERARFELGLTKPDEIFVHT-----------------PRKP----
FTSB_DECAR      LDAEVRDLKQGYDAIEERARFELGMVKQDETFVQI-----------------PEKVPGK-
FTSB_CHRVO      LDAEVRDLKQGSDAIEERARNELGMIRNGEVFFQLLD---------------PSKNPSRA
FTSB_METFK      LDAEVRDLKQGNAAIEERARSELGMIKQDEVFYQVIDQMPGQ----------PASPPAAL
FTSB_BORPA      LEAEVRDLATGVGAVEERARSELGMMREGEVFVHILPPGTPLPSGNSTPQASALSKPRPP
FTSB_BORPE      LEAEVRDLATGVGAVEERARSELGMMREGEVFVHILPPGTPLPSDNSTPQASALSKPRPP
FTSB_BORPD      LEAEVRDLATGVGAIEERARSELGMMREGEVFVQIVPPGTPVPQ-------PAPGAPGQT
FTSB_HERAR      LNSEVQDLKEGTGAVEERARYELGMIKENEIFVQVLDPNKKSSF-------VSIPPPKIE
FTSB_JANMA      LNSEVQDLKEGTGAVEERARYELGMIKENEVFVQILDPNKKSTF-------VSIPPPVVE
FTSB_CUPNH      LEGEVADLQDGTGAIEERARYELGMVREGEVFVQFVAPAPKVSA-------TPPLPPPAN
FTSB_CUPMC      LEGEVKDLQDGTGAIEERARYELGMVKDGEVFVQFVAPAPKVSA-------TPPLPPPPN
FTSB_CUPPJ      LEGEVKDLQDGTGAIEERARYELGMVKDGEVFVQFVAPAPKVSA-------TPPLPPPPN
FTSB_RALPJ      LEGEVKDLKEGTGAIEERARYELGMVKDDEGFVQFVAPAPKTSE-------TPLPPPPP-
FTSB_RALSO      LEGEVKDLKEGTGAIEERARYELGMVKDDEGFVQFVAPAPKTSE-------TPLPPPAA-
FTSB_POLNS      LSGDVKDLKDGTRAIEERACVEHGLIKEGEFFVQIL-PADKS-----------SDTQVTK
FTSB_POLAQ      LEGDVKDLKDGTRAIEERARVEHGLIKEGEFFVQIL-PADQSSA-------DTAKASTVK
FTSB_NEIG1      LAAEVYDLENGQEAISEIARVELGYIQDGETFYRLIRHNR--------------------
FTSB_NEIMB      LAAEVYDLENGQEAISEIARVELGYIQDGETFYRLIRHNR--------------------
FTSB_SACD2      LAAEVDALKQGKDAIEERARNDMGMIKEGETFFMIVDETDKDTKKNKK------------
FTSB_TERTT      LAAEVDALKTGDDAIEERARSDMGMIKEGETFFMIIDDQ---------------------
FTSB_PSEAE      LEAEVAELKKGTETVEERARHELGMVKDGETLYQLAK-----------------------
FTSB_STRMK      LAAEVKDLKEGQSAIEERARSELGMIKPGEKFYRVVEDAPV-HPAQPAAGVSAQ---VGD
FTSB_STRM5      LAAEVKDLKEGQSAIEERARSELGMIKPGEKFYRVVEDAPV-HPVQPAAGVSAQ---VGE
FTSB_XANAC      LAAEVKDLKDGEAAIEERARSELGMIKPGETFYRVVEDAPLPAPASAEASAPAQQAPEPV
FTSB_XANC5      LAAEVKDLKDGEAAIEERARSELGMIKPGETFYRVVEDAPLPAPASPEAPAPPQQAPEPI
FTSB_XANOR      LAAEVKDLKDGEAAIEERARSELGMIKPGETFYRVVEDAPLPAPASPETAAPAQQAPAST
FTSB_XANCP      LAAEVKDLKDGEAAIEERARSELGMIKPGETFYRVVEDAPLLPPAAQEAAPPAQPPAASA
FTSB_XANC8      LAAEVKDLKDGEAAIEERARSELGMIKPGETFYRVVEDAPLLPPAAQEAAPPAQPPAASA
FTSB_XANCB      LAAEVKDLKDGEAAIEERARSELGMIKPGETFYRVVEDAPLLPPAAQEAAPPAQPPAASA
FTSB_XYLF2      LAAEVKNLKDGDAAIEERARSELGMIKPGEIFYRVVEDIPVPLPNDTSADHGVDLSQPRR
FTSB_XYLFT      LAAEVKNLKDGDAAIEERARSELGMIKPGEIFYRVVEDIPVPLPNDTSADHGVDLSQPRR
FTSB_XYLFM      LAAEVKNLKDGDAAIEERARSELGMIKPGEIFYRVVEDIPAPLPNDTSADHGVDLSQPRR
FTSB_XYLFA      LAAEVKNLKDGDAAIEERARSELGMIKPGEIFYRVVEDIPTPLPNDTSADHGVDLAQPRR
FTSB_FRATT      LYSEVVSLRQNSEVLESLARENMGLIKQGEVFYSVK------------------------
FTSB_COLP3      LFADTDDLKLGLEAIEERARNELGMIKENETFFRLIPKENSTRNVNN-------------
FTSB_PSEHT      LTADIEDLKLGHEGIEERARNELGMIKAGETFIRVLPAQQ--------------------
FTSB_IDILO      IYADIEDLREGEDALEERARNELGMVKKDEVFFRLVPDRNP-------------------
FTSB_ALIF1      MFAEIDDLKKGSEAIEERARHELGMIKKGETFYRIIDENSEG------------------
FTSB_ALIFM      MFAEIDDLKKGSEAIEERARHELGMIKKGETFYRIIDENSEG------------------
FTSB_ALISL      MFAEIDDLRKGSAAIEERARHELGMIKKGETFYRIIDENSEE------------------
FTSB_VIBCH      MFAEIDDLRQGLDAIEERARNELGMVKDGETFYRIIGEESRQ------------------
FTSB_VIBTL      MFAEIDDLRQGLDAIEERARHELGMVKEGETFFRIIGEESH-------------------
FTSB_VIBCB      MFAEIDDLRQGLDAIEERARHELGLVKDGETFYRIVDEEEH-------------------
FTSB_VIBPA      MFAEIDDLKQGLDAIEERARHELGLVKEGETFYRIVGEENP-------------------
FTSB_VIBVU      MYAEIDDLKQGLDAIEERARHELGMLKEGETFYRIVGEENQ-------------------
FTSB_VIBVY      MYAEIDDLKQGLDAIEERARHELGMLKEGETFYRIVGEENQ-------------------
FTSB_PSYIN      MFSEIKDLKEGTDAIEERARNELGLVKEGETFFRIVPKED--------------------
FTSB_ACTPJ      IAAEINDLKTGVNALEERARFEREMVKSDETFYRIVPRNQ--------------------
FTSB_HAEDU      IAAEIDDLKNGVDALEERARLDREMVKSDEYFYRIVPRN---------------------
FTSB_HAEPS      IQAEIEDLKTGINALEERARLDREMVKPDETFYRIVPREQR-------------------
FTSB_ACTSZ      IAAEIKDLKDGVNAIQERARLQYEMVKPNETFYRITKEHK--------------------
FTSB_MANSM      VAAEIRDLKDGVEAIQERARLQYELVKPNETFYRIAKENKDNR-----------------
FTSB_PASMU      VAAEIKDLKQGVEAIEERARFQHDMVKPDEIFYHIVKEQK--------------------
FTSB_HAEIN      INAEIQGLTKGFEAIEERARMQHGLVKENEVFYHIVKESK--------------------
FTSB_HAEIE      INAEIQGLTKGFEAIEERARMQHGLVKENEVFYHIVKESK--------------------
FTSB_HAES1      IFAEIQDLKNGIEAIEERARMEHEMIKQNEVFYRIVKNKNR-------------------
FTSB_HISS2      IFAEIQDLKNGIEAIEERARMEHEMIKQNEVFYRIVKNKNR-------------------
FTSB_BUCAI      IILEIENFNNHINKDKKKT-----------------------------------------
FTSB_BUCAP      LILEIERLNNAIKN----------------------------------------------
                :  :   :                                                    

FTSB_SHIFL      --------
FTSB_SHIF8      --------
FTSB_ECOLI      --------
FTSB_ECO27      --------
FTSB_SHIB3      --------
FTSB_ESCF3      --------
FTSB_SALTI      --------
FTSB_SALTY      --------
FTSB_SALAR      --------
FTSB_CITK8      --------
FTSB_CROS8      --------
FTSB_KLEAE      --------
FTSB_KLEP3      --------
FTSB_KLEP7      --------
FTSB_ENT38      --------
FTSB_SERP5      --------
FTSB_PECAS      --------
FTSB_PECCP      --------
FTSB_EDWI9      SVTASH--
FTSB_ERWT9      ---ASQ--
FTSB_YERE8      --------
FTSB_YERPE      --------
FTSB_PHOLL      --------
FTSB_SODGM      --------
FTSB_TOLAT      --------
FTSB_COXBU      --------
FTSB_SHESA      --------
FTSB_SHESR      --------
FTSB_SHESM      --------
FTSB_SHEON      --------
FTSB_SHESW      --------
FTSB_SHEFN      --------
FTSB_SHEHH      --------
FTSB_SHEPA      --------
FTSB_SHEAM      QDNQ----
FTSB_PSEA6      --------
FTSB_NITOC      --------
FTSB_THISH      --------
FTSB_ALKEH      --------
FTSB_AZOSB      --------
FTSB_AROAE      --------
FTSB_DECAR      --------
FTSB_CHRVO      SHR-----
FTSB_METFK      TGAQ----
FTSB_BORPA      ATPPRR--
FTSB_BORPE      ATPPRR--
FTSB_BORPD      ASAPRR--
FTSB_HERAR      PKEKR---
FTSB_JANMA      PKEKR---
FTSB_CUPNH      SVAGRGGH
FTSB_CUPMC      SVAGRGGH
FTSB_CUPPJ      SPAATGRH
FTSB_RALPJ      -AGQQAHH
FTSB_RALSO      -LQPNHRH
FTSB_POLNS      Q-------
FTSB_POLAQ      Q-------
FTSB_NEIG1      --------
FTSB_NEIMB      --------
FTSB_SACD2      --------
FTSB_TERTT      --------
FTSB_PSEAE      --------
FTSB_STRMK      HPADVP--
FTSB_STRM5      HPADVP--
FTSB_XANAC      DPVDHP--
FTSB_XANC5      DPVDHP--
FTSB_XANOR      DPVDHP--
FTSB_XANCP      DPVDHP--
FTSB_XANC8      DPVDHP--
FTSB_XANCB      DPVDHP--
FTSB_XYLF2      EKR-----
FTSB_XYLFT      EKR-----
FTSB_XYLFM      EKR-----
FTSB_XYLFA      EKR-----
FTSB_FRATT      --------
FTSB_COLP3      --------
FTSB_PSEHT      --------
FTSB_IDILO      --------
FTSB_ALIF1      --------
FTSB_ALIFM      --------
FTSB_ALISL      --------
FTSB_VIBCH      --------
FTSB_VIBTL      --------
FTSB_VIBCB      --------
FTSB_VIBPA      --------
FTSB_VIBVU      --------
FTSB_VIBVY      --------
FTSB_PSYIN      --------
FTSB_ACTPJ      --------
FTSB_HAEDU      --------
FTSB_HAEPS      --------
FTSB_ACTSZ      --------
FTSB_MANSM      --------
FTSB_PASMU      --------
FTSB_HAEIN      --------
FTSB_HAEIE      --------
FTSB_HAES1      --------
FTSB_HISS2      --------
FTSB_BUCAI      --------
FTSB_BUCAP      --------