CLUSTAL format seed alignment for MF_00600

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CH60_BACHD       -MAKDIKFSEDARRSMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_BACSU       -MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_GEOSE       -MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_PARTM       -MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_BACP3       -MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_LISIN       -MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_LISMO       -MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEI
CH60_STAAM       -MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEI
CH60_STAES       -MAKDLKFSEDARQAMLRGVDKLANAVKVTIGPKGRNVVLDKDYTTPLITNDGVTIAKEI
CH60_BRECH       -MAKQVKFSEDAPRSMLRGVETLPNAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIPKEI
CH60_STRAG       -MAKDIKFSADARSAMVRGVDILADTVFVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEI
CH60_STRP1       -MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEI
CH60_STRAP       -MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEI
CH60_STRCV       -MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEI
CH60_STRSA       -MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEI
CH60_STRPN       -MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEI
CH60_LACLA       -MSKDIKFSSDARTAMMRGIDILADTVKTTLGPKGRNVVLEKSYGSPLITNDGVTIAKEI
CH60_ENTFA       -MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEI
CH60_LACAC       -MAKDIKFAENARRSLLKGVDKLADTVKTTIGPKGRNVVLEQSYGNPDITNDGVTIAKSI
CH60_LACHE       -MAKDIKFSENARRSLLKGVDKLADTVKTTIGPKGRNVVLEQSYGNPDITNDGVTIAKSI
CH60_LACZE       -MAKEIKFSEDARAAMLRGVDQLANTVKTTLGPKGRNVVLDKSYGSPEITNDGVTIAKSI
CH60_CLOAB       -MAKQILYGEEARRSMQKGVDKLADTVKVTLGPKGRNVVLDKKFGAPLITNDGVSIAKEI
CH60_CLOPE       -MAKTLLFGEEARRSMQAGVDKLANTVKVTLGPKGRNVILDKKFGSPLITNDGVTIAREI
CH60_CLOBO       -MAKSILFGEESRRAMQAGVDKLANAVKVTLGPKGRNVVLDKKFGSPLITNDGVTIAKEI
CH60_CLODI       -MAKEIKFSEETRRALEAGVNKLADTVKVTLGPKGRNVILDKKFGSPLITNDGVTIAKEI
CH60_THEBR       -MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREI
CH60_CALS4       -MAKQIKYGEEARKALERGVNAVANTVKVTLGPRGRNVVLDKKYGTPTVTNDGVTIAREI
CH60_HUNT2       -MAKQIKFGEEARRALERGVNQLADTVKVTLGPKGRNVVLDKKFGSPMITNDGVTIAKEI
CH601_NOSS1      -MAKRIIYNENARRALERGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEI
CH60_SYNE7       -MAKRIIYNENARRALEKGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEI
CH601_THEVL      -MAKRIIYNENARRALEKGMDILAESVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEI
CH601_SYNY3      -MAKSIIYNDEARRALERGMDILAEAVAVTLGPKGRNVVLEKKFGSPQIINDGITIAKEI
CH60_CYAPA       -MAKQILYHESARRALEKGMDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEI
CH60_GUITH       -MSKIILYQEDARRALERGMDILAEAVSVTLGPKGRNVVLERKYGAPQIVNDGVTIAKEI
CH60_PORPU       -MSKQILYQDDARKALEKGMDILTEAVSVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEI
CH60_GALSU       -MTKQILYQENARKALEKGIDILAEAVSVTLGPKGRNVVIEKKYGPPQIINDGVTIAKEI
CH60_TRICV       -MAKKILYQDNARRALERGMEIMVEAVSVTLGPKGRNVVLEKPYGSPQIVNDGVTIAKEI
CH60_CYACA       -MSKRILYKDQARKALERGIDVLAKAVSITLGPKGRNVVIDKKYGAPQIINDGIAIAKEI
CH602_NOSS1      -MAKIISFDEESRRALERGVNALADAVKITLGPKGRNVLLEKKYGTPQIVNDGITVAKEI
CH602_SYNY3      -MSKLISFKDESRRSLEAGINALADAVRITLGPKGRNVLLEKQYGAPQIVNDGITVAKEI
CH602_THEEB      -MAKLVAFHEESRRSLERGINALADAVKITLGPKGRNVVLEKKYGAPQIVNDGVTIAKEI
CH60_AGGAC       MAAKDVKFGNDARVKMLNGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_PASMU       MAAKDVKFGNDARVKMLAGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_HAEIN       MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRHVILDKSFGAPTITKDGVSVAREI
CH60_ACTPL       MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI
CH60_HAEDU       MAIKDVKFGNDARVKMLKGVNILADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREI
CH60_AERSA       MAAKEVKFGNEARIKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH601_VIBPA      MAAKDVKFGNDARVKMLEGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH601_VIBVU      MAAKDVKFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH601_VIBCH      MAAKDVRFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_BUCAI       MAAKDVKFGNEARIKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPSITKDGVSVAREI
CH60_BUCAP       MGAKDVKFGNEARIKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPSITKDGVSVAREI
CH60_BUCCM       MAAKDVKFGSEARAKMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPSITKDGVSVAREI
CH60_ECOLI       MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_SALTY       MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_STEMA       MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_KLEPN       MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
CH60_BUCTS       MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPAITKDGVTVAREI
CH60_YERPE       MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREI
CH60_SODGL       MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPVITKDGVSVAREI
CH60_WIGBR       MAAKDVKFGNDARSKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGSPMITKDGVSVAREV
CH60_COLMA       MAAKDVLFGNDARVKMLRGVNILADAVKVTLGPKGRNVVIDKSFGGPIITKDGVTVAKEI
CH60_PSEHT       MAAKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAKEI
CH602_VIBCH      MAAKHVLFSTDARQKMLSGVNLLANAVKVTLGPKGRHVVLNKSYGAPTITKDGVSVAKEI
CH60_PSEAE       MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
CH60_PSEPU       MAAKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEI
CH60_OLEAN       MAAKDVLFGDSARAKMLVGVNILADAVRVTLGPKGRNVVIEKSFGAPIITKDGVSVAREI
CH60_LEGJE       -MAKELRFGDDARQQMLAGVNALADRVKATMGPSGRNVVLERSFGAPTVTKDGVSVAKEI
CH60_TATMI       -MAKELRFGDDARQQMLAGVNALADAVKATMGPSGRNVVLERSFGAPTVTKDGVSVAKEI
CH60_LEGPH       -MAKELRFGDDARLQMLAGVNALADAVQVTMGPRGRNVVLEKSYGAPTVTKDGVSVAKEI
CH60_COXBU       MAAKVLKFSHEVLHAMSRGVEVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
CH60_XANAC       MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
CH60_XANCP       MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEI
CH60_XYLFA       MAAKEIIFSEKARSRMVHGVNLLANAVKATLGPKGRHVVLDKSFGSPIITKDGVSVAKEI
CH60_ALLVI       MSAKDVKFGGDARVRMMEGVNILANAVKVTLGPKGRNVVLEKSFGAPTVTKDGVSVAKEI
CH60_FRATH       MAAKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEI
CH601_BURPS      MAAKDVVFGDSARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI
CH60_BURTH       MAAKDVVFGDSARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI
CH60_BURCE       MAAKDVVFGDSARSKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI
CH60_RALSO       MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEI
CH60_BORPE       MAAKQVLFADEARVRIVRGVNVLANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
CH60_NEIMA       MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI
CH60_NEIMB       MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEI
CH60_TREPR       MPAKDVIFGDCARLRLMEGVNTLTDAVKVTLGPKGRNVVLERSYGSPAVTKDGVTVAKDI
CH60_METSS       MAAKEVKFHDHARTRIVQGVNVLADAVKVTLAPRAVMCLIERSFGAPVITKDGVSVAKEI
CH601_RHIME      MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH604_RHIME      MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
CH60_AGRFC       MAAKEVKFGRSAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH60_RHILV       MASKEIKFGRTGREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEI
CH60_BRUAB       MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV
CH60_BRUME       MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEV
CH603_RHILO      MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
CH605_RHILO      MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
CH604_RHILO      MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
CH60_BARHE       MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH60_BARQU       MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH60_BARBA       MAAKEVKFGRDARERLLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH602_BRADU      MSAKEVKFGVDARDRMLRGVDILHNAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEI
CH603_BRADU      MSAKEVKFGVNARDRMLRGVDILANAVQVTLGPKGRNVVLDKSFGAPRITKDGVAVAKEI
CH601_BRADU      MAAKEVKFSTDARDRVLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEI
CH602_RHIME      MAAKEVKFTSDARDRMLRGVDIMANAVRVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH605_RHIME      MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH602_RHILO      MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEI
CH601_RHILO      MSAKEIKFATDARDRMLRGVEILTNAVKVTLGPKGRNVIIDKAYGAPRITKDGVTVAKEI
CH603_RHIME      MSAKQIVFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEI
CH60_CAUVC       MAAKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEI
CH60_RHOPL       MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH601_RHOSH      MAAKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH60_PARDE       MAAKEVKFNSDARDRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
CH60_RHOCA       MAAKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI
CH602_RHOSH      MSAKEVRFGTDARGRMLKGINTLADTVKITLGPKGRNVILDTSYGAPRITKDGVTVAREI
CH60_EHRRW       -MANMVVTGEQLDKSIREVVRILEDAVGCTAGPKGLTVAISKPYGAPEVTKDGYKVMKSI
CH60_EHRCH       -MANVVVTGEQLDKSIREVVRILEDAVGCTAGPKGLTVAIGKSYGAPEVTKDGYKVIKSI
CH60_ORITS       -MSKQIVHGDQCRKKIIEGINVVANAVGITLGPKGRCVAIEQSYGPPKITKDGVSVAKAI
CH60_RICCN       MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI
CH60_RICPR       MTTKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSI
CH60_CAMJE       -MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEV
CH60_CAMRE       -MAKEIFFSDEARNRLYEGVRKLNDAVKVTMGPRGRNVLVQKSFGAPAITKDGVSVAKEI
CH60_HELPY       -MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEI
CH60_HELPJ       -MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEI
CH60_CHLMU       MVAKNIKYNEEARKKIQKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEV
CH60_CHLTR       MVAKNIKYNEEARKKIQKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEV
CH60_CHLPN       MAAKNIKYNEEARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEI
CH601_CHLCV      MAAKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEI
CH60_AQUAE       MAAKAIIYNEEARAKLKAGVDKLANAVKVTLGPKGREVILGKNWGTPVVTKDGVTVAKEI
CH60_TANFO       -MAKEIKFDMNARDLLKKGVDELANAVKVTLGPKGRNVILEKKFGAPQITKDGVTVAKEI
CH60_CHLTE       MTAKDILFDAEARTKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEI
CH60_RHOMR       MAAKQITFNADARMALKRGVDKLADAVKVTLGPKGRNVIIEKKFGAPTVTKDGVTVAKEI
CH60_BORBU       -MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREI
CH60_TREPA       -MAKQLLFNEEARKKLLSGVEQISSAVKVTLGPKGRNVLLEKGYGAPTVTKDGVSVAKEV
CH60_LEPIN       -MAKDIEYNETARRKLLEGVNKLANAVKVTLGPKGRNVVIDKKFGAPTITKDGVTVAKEI
CH60_DEIRA       -MAKQLVFDESARRSLERGVNAVANAVKVTLGPRGRNVVIEKKFGSPTITKDGVTVAKEV
CH60_THET8       -MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEV
CH60_THEMA       -MPKILKFNEEARRALERGVDKVANAVKVTLGPKGRNVVIEKSWGSPTITNDGVSIAKEI
CH60_THENE       -MPKLLKFNEEARRALERGVDKVANAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEI
CH601_MYCLE      -MSKLIEYDETARHAMEVGMNKLADTVRVTLGPRGRHVVLAKAFGGPTITNDGVTVAREI
CH601_MYCTU      -MSKLIEYDETARRAMEVGMDKLADTVRVTLGPRGRHVVLAKAFGGPTVTNDGVTVAREI
CH601_CORGL      -MAKLIAFDQDAREGILRGVDALANAVKVTLGPRGRNVVLDKAFGGPLVTNDGVTIARDI
CH601_STRCO      -MAKILKFDEDARRALERGVNKLADTVKVTIGPKGRNVVIDKKFGAPTITNDGVTIAREV
CH601_STRLI      -MAKILKFDEDARRALERGVNKLADTVKVTIGPKA-NVVIDKKFGPPTITNDGVTIAREV
CH601_STRAL      -MAKILKFDEDARRALERGVNQLADTVKVTIGPKGRNVVIDKKFGAPTITNDGVTIAREV
CH602_MYCLE      -MAKTIAYDEEARRGLERGLNSLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI
CH602_MYCTU      -MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI
CH602_MYCPA      -MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI
CH602_STRAL      -MAKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI
CH602_STRCO      -MAKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEI
CH601_CUTAK      -MAKLIEFNIEARRGLEAGMNTLADAVKVTLGPKGRNVVLEKSWGAPTITNDGVSIAKEI
CH60_TROWT       -MAKKITFNEDARRGLERGLNTLADTVKVTLGPRGRNVVLEKKWGAPVITNDGVTIAKEI
CH60_FUSNN       -MAKIINFNDEARKKLEIGVNTLADAVKVTLGPRGRNVVLEKSYGAPLITNDGVTIAKEI
CH60_MYCGE       -MAKELIFGKDARTRLLQGINKIANAVKVTVGPKGQNVILERKFANPLITNDGVTIAKEI
CH60_MYCPN       -MAKELVFGKNARNKLLAGINKLADAVKVTVGPKGQNVILGRKFSNPLITNDGVTIAKEI
                    : :         :   :  : . *  * .* .    :   :  *   :**  : : :

CH60_BACHD       ELEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMVIRKGI
CH60_BACSU       ELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGM
CH60_GEOSE       ELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGI
CH60_PARTM       ELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGI
CH60_BACP3       ELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGI
CH60_LISIN       ELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGI
CH60_LISMO       ELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGI
CH60_STAAM       ELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGI
CH60_STAES       ELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQSMIQEGLKNVTSGANPVGLRQGI
CH60_BRECH       ELEDAYENMGAQLVKEVATKTNGIAGDGTTTATVLAAAMIREGLKNVAAGANPMVIRRGM
CH60_STRAG       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLPQAIVREGLKNVTAGANPIGIRRGI
CH60_STRP1       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGI
CH60_STRAP       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGI
CH60_STRCV       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGI
CH60_STRSA       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGI
CH60_STRPN       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGI
CH60_LACLA       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPVGIRRGI
CH60_ENTFA       ELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGI
CH60_LACAC       ELKDHYENMGAKLVAEAAQKTNDIAGDGTTTATVLTQAIAREGMKNVTAGANPVGIRRGI
CH60_LACHE       ELKDRYENMGAKLVAEAAQKTNDIAGDGTTTATVLTQAIAREGMKNVTAGANPVGIRRGI
CH60_LACZE       DLEDHYENMGAKLVAEVASKTNDIAGDGTTTATVLAQSIIREGMKNVTAGANPVGIRTGI
CH60_CLOAB       ELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPMLIRNGI
CH60_CLOPE       ELEDAYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPILIRNGI
CH60_CLOBO       ELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPMLIRKGI
CH60_CLODI       ELEDRFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVTAGANPILLRKGI
CH60_THEBR       ELEDPFENQGAQLLKEAATKTNDIAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGI
CH60_CALS4       ELEDPFENQGAQLLKEAATKTNDVAGDGTTTATLLAQVMVLEGLKNLAAGANPMLLRRGM
CH60_HUNT2       ELEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVAAGANPMLLKKGI
CH601_NOSS1      ELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAIVKEGLRNVAAGANAILLKRGI
CH60_SYNE7       ELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAVVKEGLRNVAAGANAILLKRGI
CH601_THEVL      ELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKEGLRNVAAGANPIALKRGI
CH601_SYNY3      ELEDHVENTGVSLIRQAASKTNDVAGDGTTTATVLAHAIVKEGLRNVAAGANPISLKRGI
CH60_CYAPA       ELEDHIENTGVALIRQAASKTNDVAGDGTTTATVLAYAMVKEGMRNVAAGANPMAIKRGI
CH60_GUITH       ELEDHIENTGVALIRQAASKTNDVAGDGTTTATVLAHAMVKQGMKNVAAGANAIALKRGI
CH60_PORPU       SLEDHIENTGVALIRQAASKTNDVAGDGTTTATVLASAIVKQGMRNVAAGSNPMAIKKGI
CH60_GALSU       ELEDHIENTGVALIRQAASKTNDVAGDGTTTSTVLAHAIVKQGMRNVAAGANPIALKRGI
CH60_TRICV       NLEDHIENTGVALIRQAASKTNDVAGDGTTTATVLAYAMVKEGLKNVTAGANPISIKLGM
CH60_CYACA       ELKNHMENTGVSLIRQAAAKTNDVAGDGTTTATVLAHAIIKQGLKYVSTGSNPISLKKGI
CH602_NOSS1      ELEDPLENTGARLIQEVASKTKDVAGDGTTTATVLVQALIREGLKNVAAGTNPVSLKRGI
CH602_SYNY3      ELSNPEENAGAKLIQEVASKTKEIAGDGTTTATIIAQALVREGLRNVAAGANPVALRRGI
CH602_THEEB      ELEDAYENTGAQLMREVAAKTNDVVGDGTTTATVLAQALIREGLKNVAAGTNPIALKRGM
CH60_AGGAC       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_PASMU       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_HAEIN       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_ACTPL       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_HAEDU       ELEDKFENMGAQMVKEVASKANDVAGDGTTTATVLAQSIVSEGLRAVAAGMNPMDLKRGI
CH60_AERSA       ELEDKFQNMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH601_VIBPA      ELEDKFQNMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH601_VIBVU      ELEDKFQNMGAQMVKQVASQANDVAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH601_VIBCH      ELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_BUCAI       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATLLAQSIVNEGLKAVAAGMNPMDLKRGI
CH60_BUCAP       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATLLAQSIVNEGLKAVAAGMNPMDLKRGI
CH60_BUCCM       ELEDKFENMGAQMVKEVASKANDVAGDGTTTATLLAQSIVNEGLKAVAAGMNPMDLKRGI
CH60_ECOLI       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGI
CH60_SALTY       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGI
CH60_STEMA       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIILKVMKAVAAGMNPMDLKRGI
CH60_KLEPN       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_BUCTS       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVTEGLKAVAAGMNPMDLKRGV
CH60_YERPE       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGI
CH60_SODGL       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI
CH60_WIGBR       ELEDKFENMGAQMLKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI
CH60_COLMA       ELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGLKSIAAGMNPMDLKRGI
CH60_PSEHT       ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI
CH602_VIBCH      ELADKFENMGAQMLKQVASKANDEAGDGTTTATVLAQALINEGMKAVAAGMNPMDLKRGI
CH60_PSEAE       ELKDKFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
CH60_PSEPU       ELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGI
CH60_OLEAN       ELKDKFENMGAQMVKEVASQANDQAGDGTTTATVLAQAIISEGLKSVAAGMNPMDLKRGI
CH60_LEGJE       EFENRFKNMGAQMVKEVAAKTSDTAGDGTTTATVLARSIVVEGHKAVAAGMNPMDLKRGI
CH60_TATMI       EFENRFKNMGAQMVKEVAAKTSDTAGDGTTTATVLARAIVVEGHKAVAAGMNPMDLKRGI
CH60_LEGPH       EFEHRFMNMGAQMVKEVASKTSDTAGDGTTTATVLARSILVEGHKAVAAGMNPMDLKRGI
CH60_COXBU       ELEDKFENMGAQMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGI
CH60_XANAC       ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI
CH60_XANCP       ELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGAKAVAAGMNPMDLKRGI
CH60_XYLFA       ELADKFENMGAQMLKEVASKTNDHAGDGTTTATVLAQALIREGCKAVAAGMNPMDLKRGI
CH60_ALLVI       ELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAMVREGLKAVAAGMNPMDLKRGM
CH60_FRATH       ELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVTAGMNPMDLKRGI
CH601_BURPS      ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVASGMNPMDLKRGI
CH60_BURTH       ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVASGMNPMDLKRGI
CH60_BURCE       ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVASGMNPMDLKRGI
CH60_RALSO       ELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVAAGMNPMDLKRGI
CH60_BORPE       ELKDKFENIGAQLVKDVASKTSDNAGDGTTTATVLAQAVVQEGLKYVAAGFNPIDLKRGI
CH60_NEIMA       ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGI
CH60_NEIMB       ELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGI
CH60_TREPR       ELRDRLQNMGAQMVKEVAAKTSDNAGDGTTTATVLAQSIVREGMRYVASGVNPMDIKRGI
CH60_METSS       ELQDKFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVVAGVNPMDLKRGI
CH601_RHIME      ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI
CH604_RHIME      ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI
CH60_AGRFC       ELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGI
CH60_RHILV       ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGI
CH60_BRUAB       ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI
CH60_BRUME       ELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGI
CH603_RHILO      ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI
CH605_RHILO      ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI
CH604_RHILO      ELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGHKAVAAGMNPMDLKRGI
CH60_BARHE       ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI
CH60_BARQU       ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI
CH60_BARBA       ELENKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAASMNPMDLKRGI
CH602_BRADU      ELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGI
CH603_BRADU      ELDDKFENMGAQMVREVASKAADAAGDGTTTATVLAAAIVREGAKSVAAGMNPMDLKRGI
CH601_BRADU      ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGI
CH602_RHIME      ELEDKFENMGAQMLREVASRTSDIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI
CH605_RHIME      ELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGI
CH602_RHILO      ELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGI
CH601_RHILO      ELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASILREGAKLVAAGMNPMDLKRGI
CH603_RHIME      ELEDKFENMGAQMVRAVASKTNDLAGDGTTTATVLAASIFREGAKLVSVGMNPMDLKRGI
CH60_CAUVC       ELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGI
CH60_RHOPL       ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI
CH601_RHOSH      ELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGI
CH60_PARDE       ELSDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGLKAVAAGMNPMDLKRGI
CH60_RHOCA       ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI
CH602_RHOSH      ELSDRFENVGAQMVKEVASRTNEEAGDGTTTATVLAQAIAKEGMKAVAAGMNPMDLKRGI
CH60_EHRRW       KPEDPLALAIANIIAQSASQCNDKVGDGTTTCSILTAKVIEEVSKVKAAGADIICVREGV
CH60_EHRCH       KPEDPLALAIANIITQSASQCNDKVGDGTTTCSILTAKVIEEVSKAKAAGADIVCIKEGV
CH60_ORITS       QLKDKSLNVGAQFVISVASKTADVAGDGTTTATVIADAAVRELNKAEVAGIDIQEVRKGA
CH60_RICCN       ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM
CH60_RICPR       ELKDKIKNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM
CH60_CAMJE       ELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGM
CH60_CAMRE       ELKDALENMGAGLVKEVASKTNDEAGDGTTTATVLAHSIFKEGLRNITAGANPVEVKRGM
CH60_HELPY       ELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGM
CH60_HELPJ       ELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGM
CH60_CHLMU       ELADKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYTEGLRNVTAGANPMDLKRGI
CH60_CHLTR       ELADKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYTEGLRNVTAGANPMDLKRGI
CH60_CHLPN       ELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGI
CH601_CHLCV      ELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGI
CH60_AQUAE       ELKDKFENIGAQLVKEVASKTADVAGDGTTTATVLAQAIFHEGLRVAASGANVMEVKRGI
CH60_TANFO       ELACPYENMGAQLVKEVASKTNDKAGDGTTTATVLAQAIIGVGLKNVTAGANPMDLKRGI
CH60_CHLTE       ELVDPVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVTAGARPIDLKRGI
CH60_RHOMR       ELEDKLENVGAQMVKEVASKTSDVAGDGTTTATVLAQAILTAGLKSVTAGANPMDLKRGI
CH60_BORBU       ELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGI
CH60_TREPA       ELEDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSMVREGLKAVAAGMTPLELKRGM
CH60_LEPIN       ELEDPLENMGAQMVKEVSTKTNDVAGDGTTTATILAQSIINEGLKNVTAGANPMSLKRGI
CH60_DEIRA       ELEDKLENIGAQLLKEVASKTNDITGDGTTTATVLGQAIVKEGLRNVAAGANPLALKRGI
CH60_THET8       ELEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGI
CH60_THEMA       ELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGI
CH60_THENE       ELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGI
CH601_MYCLE      DLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQALVKGGLRMVAAGANPVALGAGI
CH601_MYCTU      ELEDPFEDLGAQLVKSVATKTNDVAGDGTTTATILAQALIKGGLRLVAAGVNPIALGVGI
CH601_CORGL      DLEDPFENLGAQLVKSVAVKTNDIAGDGTTTATLLAQALIAEGLRNVAAGANPMELNKGI
CH601_STRCO      EVEDPYENLGAQLVKEVATKTNDIAGDGTTTATVLAQALVREGLKNVAAGASPALLKKGI
CH601_STRLI      EVEDPYENLGAQLVKEVATKTNDIAGDGTTTATVLAQALVREGLKNVAAGASPALLKKGI
CH601_STRAL      ECDDPYENLGAQLVKEVATKTNDIAGDGTTTATVLAQALVREGLRNVAAGASPAALKKGI
CH602_MYCLE      ELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGANPLGLKRGI
CH602_MYCTU      ELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGI
CH602_MYCPA      ELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGI
CH602_STRAL      ELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPMALKRGI
CH602_STRCO      ELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGANPMALKRGI
CH601_CUTAK      ELDDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQAMVREGLRNVTAGANPMGLKKGI
CH60_TROWT       ELDDPYEKIGAELVKEVAKKTDDVAGDGTTTSVVLAQAMVREGLKNVAAGADPISLRRGI
CH60_FUSNN       ELEDPFENMGAALVKEVAIKSNDVAGDGTTTATILAQAIVKEGLKMLSAGANPIFLKKGI
CH60_MYCGE       ELSDPVENIGAKVISVAAVSTNDIAGDGTTTATILAQEMTNRGIEIINKGANPVNIRRGI
CH60_MYCPN       ELTDPLENIGAKVISVAAVSTNDIAGDGTTTATILAQEMTNRGVEAVNNGANPVNVRRGI
                 .         . .:   :      .******. ::         .    .     :  * 

CH60_BACHD       EKATQVAVEELSKISKPIEGK-DSIAQVAAISSA-DDEVGKIIAEAMERVGND-GVITIE
CH60_BACSU       EQAVAVAIENLKEISKPIEGK-ESIAQVAAISAA-DEEVGSLIAEAMERVGND-GVITIE
CH60_GEOSE       EKAVAVAVEELKAISKPIQGK-ESIAQVAAISAA-DEEVGQLIAEAMERVGND-GVITLE
CH60_PARTM       EKAVAVAVEELKAISKPIQGK-ESIAQVAAISAA-DEEVGQLIAEAMERVGND-GVITLE
CH60_BACP3       EKAVAVAVEELKAISKPIKGK-ESIAQVAAISAA-DEEVGQLIAEAMERVGND-GVITLE
CH60_LISIN       EKAVATAIEELKAISKPIESK-ESIAQVAAISSG-DEEVGKLIAEAMERVGND-GVITIE
CH60_LISMO       EKAVATAIEELKAISKPIESK-ESIAQVAAISSG-DEEVGKLIAEAMERVGND-GVITIE
CH60_STAAM       DKAVKVAVEALHENSQKVENK-NEIAQVGAISAA-DEEIGRYISEAMEKVGND-GVITIE
CH60_STAES       DKAVQVAIEALHEISQKVENK-NEIAQVGAISAA-DEEIGRYISEAMDKVGND-GVITIE
CH60_BRECH       EKAVGAAVEEIKSIAKPVENK-SSIAQVAAISAD-DQEVGNLIAEAMEKVGKD-GVITVE
CH60_STRAG       ETAVSAAVEELKEIAQPVSGK-EAIAQVAAVSSR-SEKVGEYISEAMERVGND-GVITIE
CH60_STRP1       ETATATAVEALKAIAQPVSGK-EAIAQVAAVSSR-SEKVGEYISEAMERVGND-GVITIE
CH60_STRAP       ETAVATAVEALKANSVPVSNK-EAIAQVAAVSSR-SEKVGEYISEAMEKVGND-GVITIE
CH60_STRCV       ETAVATAVEALKANSVPVSNK-EAIAQVAAVSSR-SEKVGEYISEAMEKVGND-GVITIE
CH60_STRSA       EAAVATAVEALKSNSVPVSNK-EAIAQVAAVSSR-SEKVGEYISEAMEKVGND-GVITIE
CH60_STRPN       ETAVAAAVEALKNNAIPVANK-EAIAQVAAVSSR-SEKVGEYISEAMEKVGKD-GVITIE
CH60_LACLA       ELAAETAVASIKEMAIPVHDK-SAIAQVATVSSR-SEKVGEYISDAMERVGSD-GVITIE
CH60_ENTFA       ELATKTAVEELHNISSVVDSK-EAIAQVAAVSSG-SEKVGQLIADAMEKVGND-GVITIE
CH60_LACAC       EKATKAAVDELHKISHKVESK-EQIANVAAVSSA-SKEVGELIADAMEKVGHD-GVITIE
CH60_LACHE       EKATKAAVDELHKISHKVESK-DQIANVAAVSSA-SKEIGALIADAMEKVGHD-GVITIE
CH60_LACZE       EKATKAAVDELHKISHKVNGK-KEIAQVASVSSS-NTEVGSLIADAMEKVGHD-GVITIE
CH60_CLOAB       RLAVDKTVEGLKKVSKNVNGK-EDIARVASISAA-DPEIGKLIADAMEKVGNE-GVITVE
CH60_CLOPE       KTAVEKAVEEIQKISKPVNGK-EDIARVAAISAA-DEKIGKLIADAMEKVGNE-GVITVE
CH60_CLOBO       KLAVDTAVEQIKKSSKQVDGK-EDIARVAAISAA-DPEIGKLIADAMERVGNE-GVITVE
CH60_CLODI       QKAVTVAVEELKNQSRIVETQ-EAISQVASISAG-DEEVGKLIAEAMEIVGKD-GVITVE
CH60_THEBR       AKAVDAAVEGLKRISKPIDNK-ESIAHVASISAA-DEEIGKLIAEAMDKVGKD-GVITVE
CH60_CALS4       AKAVEAAVEGLRRISKPIDNK-ESIAHVAAISAA-DEEIGQLIAEAMEKVGKD-GVITVE
CH60_HUNT2       AKAVDAAVEGIKEISQKVKGK-EDIARVASISAN-DEVIGELIADAMEKVTND-GVITVE
CH601_NOSS1      DKATGFLVDRIKEHARPVEDS-KSIAQVGSISAGNDDEVGQMIAEAMDKVGKE-GVISLE
CH60_SYNE7       DKATNFLVEQIKSHARPVEDS-KSIAQVGAISAGNDFEVGQMIADAMDKVGKE-GVISLE
CH601_THEVL      DKATQFLVEKIAEHARPVEDS-KAIAQVAAISAGNDEEVGRMIADAMDKVGKE-GVISLE
CH601_SYNY3      DKATDFLVARIKEHAQPVGDS-KAIAQVGAISAGNDEEVGQMIANAMDKVGQE-GVISLE
CH60_CYAPA       DRATQKVVETIAAHAKPVEDS-RAITQVASISAGNDDEVGKMIADAIEKVGKE-GVISLE
CH60_GUITH       EKATQFIVTQIAEYARPVEDT-RAISQVASISAGNDIETGKMIADAIDKVGRE-GVISLE
CH60_PORPU       EKATNFVVSKIAEYAKPVEDT-TAIVQVASISSGNDAEVGKMIADAIDRVGRE-GVISLE
CH60_GALSU       DKATQFIINKISEYSRPVEDN-KAITQVATISSGNDENIGKMIADAIEKVGRE-GVISIE
CH60_TRICV       EKATQYLVTQINEFAQPVEDI-QSIEQVASISAGNDNLIGSLIADALSKVGKE-GVISLE
CH60_CYACA       EKASQFIIQKISENSRPIEDV-KSIIQVSSISAGNDEEIGSMIANAIQKVGKD-GVISLE
CH602_NOSS1      DKTTEALVAEIAKVAKPVEGS--AIAQVATVSSGNDEEVGAMIAQAVEKVTKD-GVITVE
CH602_SYNY3      EKVTTFLVQEIEAVAKPVEGS--AIAQVATVSSGNDPEVGAMIADAMDKVTKD-GVITVE
CH602_THEEB      EKAIKTIVDGIAEVAKPVEGD--MIAQVATVSAGNDPEVGAMISEAMAKVGKD-GVITIE
CH60_AGGAC       DKAVNSVVAELKNLSKPCETS-KEIEQVGTISANSDSIVGQLIAQAMEKVGKE-GVITVE
CH60_PASMU       DKAVTAVVTELKALSKPCETS-KEIEQVGTISANSDSIVGQIIAQAMDKVGKE-GVITVE
CH60_HAEIN       DKAVSAVVSELKNLSKPCETA-KEIEQVGTISANSDSIVGQLISQAMEKVGKE-GVITVE
CH60_ACTPL       DKAVVAVVEELKAISKPCETS-KEIEQVGTISANSDETVGKLIAQAMEKVGKE-GVITVE
CH60_HAEDU       DKAVAAVVEELKAISKPCETS-KEIEQVGTISANSDETVGKLIAQAMEKVGKE-GVITVE
CH60_AERSA       DKAVIAAVAELQVLSQPCADN-NAIAQVGTISANSDEKVGRLIAEAMDKVGRD-GVITVE
CH601_VIBPA      DKAVAAAVEQLKELSVECNDT-KAIAQVGTISANSDASVGNIIAEAMERVGRD-GVITVE
CH601_VIBVU      DKAVAAAVEELKALSKDCSTS-TEIEQVGTISANSDSSVGKIIAEAMEKVGRD-GVITVE
CH601_VIBCH      DKAVIAAVEELKALSVPCADT-KAIAQVGTISANSDSSVGNIIAEAMEKVGRD-GVITVE
CH60_BUCAI       DKAVISAVEELKHLSVPCSDS-KAITQVGTISANADEKVGSLIAEAMEKVGND-GVITVE
CH60_BUCAP       DKAVISAVEELKNLSVPCSDS-KAITQVGTISANADEKVGALIAEAMEKVGND-GVITVE
CH60_BUCCM       DQAVIKAVKELKKLSVPCSDS-KAITQVGTISANADETVGSLISEAMDKVGND-GVITVE
CH60_ECOLI       DKAVTAAVEELKALSVPCSDS-KAIAQVGTISANSDETVGKLIAEAMDKVGKE-GVITVE
CH60_SALTY       DKAVAAAVEELKALSVPCSDS-KAIAQVGTISANSDETVGKLIAEAMDKVGKE-GVITVE
CH60_STEMA       DKAVTVAVEELKALSVPCSDS-KAIAQVGTISANSDETVGKLIAEAMDKVGKE-GVITVE
CH60_KLEPN       DKAVLAAVEELKALSVPCSDS-KAIAQVGTISANSDETVGKLIAE-VDKVGKE-GVITVE
CH60_BUCTS       DKAVIAAVEELKCLSVPCSDF-KAIAQVGTISANSDETVGKLIAEAMEKVGKE-GVITVE
CH60_YERPE       DKAVIAAVEELKKLSVPCSDS-KAIAQVGTISANSDSTVGELIAQAMEKVGKE-GVITVE
CH60_SODGL       DKAVIAAVEELKKLSVPCSDS-KAIAQVGTISANADETVGTLIAEAMAKVGKE-GVITVE
CH60_WIGBR       DKAVIGAVAELKKLSVPCSDS-KSIAQVGTISANADKTVGTLIAEAMEKVGKE-GVITVE
CH60_COLMA       DKAVIAAVEALKESSTPVTDN-KAIEQVGTISANSDETVGKIIATAMEKVGTE-GVITVE
CH60_PSEHT       DKAVIAAVAELKALSVPCSDT-KAIAQVGTISANSDKEIGDIIAQAMEKVGRNSGVITVE
CH602_VIBCH      DKAVSAAVEKLHQLAKPCSDT-QSITQVGAISANSDHAIGEIIAQAMEKVGRN-GVITVE
CH60_PSEAE       DKATVAIVAQLKELAKPCADT-KAIAQVGTISANSDESIGQIIAEAMEKVGKE-GVITVE
CH60_PSEPU       DKATAAVVAELKNLSKPCADS-KAIAQVGTISANSDSSIGEIIAEAMEKVGKE-GVITVE
CH60_OLEAN       DKATAAVVAAIKEQAQPCLDT-KAIAQVGTISANADETVGRLIAEAMEKVGKE-GVITVE
CH60_LEGJE       DKAVTAITKELQKMSKPCKDG-KAIAQVGTISANSDQAIGSIIAEAMEKVGKE-GVITVE
CH60_TATMI       DKAVAAVTKKLQEMSKPCKDG-KAIAQVGTISANSDQAIGSIIAEAMEKVGKE-GVITVE
CH60_LEGPH       DKAVLAVTKKLQAMSKPCKDS-KAIAQVGTISANSDEAIGAIIAEAMEKVGKE-GVITVE
CH60_COXBU       DKAVTAAVAELKKISKPCKDQ-KAIAQVGTISANSDKSIGDIIAEAMEKVGKE-GVITVE
CH60_XANAC       DQAVKAAVVELKNISKPTTDD-KAIAQVGTISANSDESIGNIIAEAMKKVGKE-GVITVE
CH60_XANCP       DQAVKAAVIELKNISKPTTDD-KAIAQVGTISANSDESIGNIIAEAMQKVGKE-GVITVE
CH60_XYLFA       DKAVIAAVTELKKISKPTSDD-KAIAQVATISANSDESIGNIIAEAMKKVGKE-GVITIE
CH60_ALLVI       DKAVEAATEELKKLSKPCPRP-MAIAQVGTISANSDDSIGTIIAEAMEKVGKE-GVITVE
CH60_FRATH       DKATARLVEELKALSKPCSDP-KSIEQVGTISANSDATVGKLIADAMAKVGKE-GVITVE
CH601_BURPS      DKAVAAAVEELKKISKPCTTN-KEIAQVGAISANSDSSIGDRIAEAMDKVGKE-GVITVE
CH60_BURTH       DKAVAAAVEELKKISKPCTTN-KEIAQVGSISANSDSSIGDRIAEAMDKVGKE-GVITVE
CH60_BURCE       DKAVAAAVEELKKISKPCTTN-KEIAQVGSISANSDSSIGDRIAEAMDKVGKE-GVITVE
CH60_RALSO       DKAVAAAVEELKKISKPTTTS-KEIAQVGAISANSDESIGARIAEAMDKVGKE-GVITVE
CH60_BORPE       DKAVAAAVEELKKLSKPVTTS-KEIAQVGSISANSDASIGQIIADAMDKVGKE-GVITVE
CH60_NEIMA       DKAVAALVEELKNIAKPCDTS-KEIAQVGSISANSDEQVGAIIAEAMEKVGKE-GVITVE
CH60_NEIMB       DKAVAALVDELKNIAKPCDTS-KEIAQVGSISANSDEQVGAIIAEAMEKVGKE-GVITVE
CH60_TREPR       DQAVSSAVMELKKISRPCTTG-KEIAQVGSVSANNDRTVGEMIAEAMNKVGKE-GVITVE
CH60_METSS       DKAVATVVDELHKLSKPITTN-KEIAQVGSISANSDHPIGKIIADAMDKVGKE-GVITVE
CH601_RHIME      DLAVAEVVKDLLAKAKKINTS-DEVAQVGTISANGEKQIGLDIAEAMQKVGNE-GVITVE
CH604_RHIME      DLAVAEVVKDLLAKAKKINTS-DEVAQVGTISANGEKQIGLDIAEAMQKVGNE-GVITVE
CH60_AGRFC       DLAVAEVVKDLQAKAKKINTS-EEVAQVGTISANGERQIGLDIAEAMQRVGNE-GVITVE
CH60_RHILV       DLAVADVVKDLQAKAKKISTS-EEVAQVGTISANGDKQVGLDIAEAMQKVGNE-GVITVE
CH60_BRUAB       DLAVNEVVAELLKKAKKINTS-EEVAQVGTISANGEAEIGKMIAEAMQKVGNE-GVITVE
CH60_BRUME       DLAVNEVVAELLKKAKKINTS-EEVAQVGTISANGEAEIGKMIAEAMQKVGNE-GVITVE
CH603_RHILO      DLAVSDVVWTLIKNATKIKTS-EEVAQVGTIAGNGDESVGKMIAEAMQKVGNE-GVITVE
CH605_RHILO      DLAVADVVATLIKNAKKIKTS-EEVAQVGTIAGNGDSSVGSMIAEAMQKVGNE-GVITVE
CH604_RHILO      DLAVSEVVAALGKAAKKIKTS-EEVAQVGTISANGDESVGKMIAEAMQKVGNE-GVITVE
CH60_BARHE       DAAVDEVVANLFKKAKKIQTS-AEIAQVGTISANGAAEIGKMIADAMEKVGNE-GVITVE
CH60_BARQU       DAAVEEVVGNLFKKAKKIQTS-AEIAQVGTISANGAAEIGKMIADAMEKVGNE-GVITVE
CH60_BARBA       DAAVEAVVADLFKKAKKIQTS-EEIAQVATISANGAEDIGKMIADAMEKVGNE-GVITVE
CH602_BRADU      DMAVEAVVADLVKNSKKVTSN-EEIAQVGTISANGDAEIGKFISDAMKKVGNE-GVITVE
CH603_BRADU      DLAVEAVVADLQKNSKKVTSN-DEIAQVGAISANGDQEIGKFLADAVKKVGNE-GVITVE
CH601_BRADU      DLAVEAIVNDLKAHAKKVTTN-EEIAQIATISANGDIEIGRFLADAMQKVGND-GVITVE
CH602_RHIME      DLAVEAIVKELRNNARKVSKN-AEIAQVATISANGDAEIGRYLAEAMEKVGNE-GVITVE
CH605_RHIME      DLAVDAVVKELKNNARKISKN-SEIAQVGTISANGDTEIGRYLAEAMEKVGNE-GVITVE
CH602_RHILO      DKAVEAIVQELKTNARKVTRN-DEIAQVGTISANGDAEIGRFLAEAMQKVGNE-GVITVE
CH601_RHILO      DQAVAAVVVEIKAKAKKVKSS-AEIAQVGTIAANGDATVGAMIAKAMDKVGND-GVITVE
CH603_RHIME      DLGVAAVLAEIKARATKVISS-SEIAQVGTIAANGDAGVGEMIARAMEKVGNE-GVITVE
CH60_CAUVC       DKAVAIAIEDIKTSSKKVTTN-AEIAQVGTISANGDKEVGEMIAKAMDKVGNE-GVITVE
CH60_RHOPL       DLATAKVVESIKAASRPVNDQ-HEVAQVGTISANGEAQIGRFIADAMQKVGNE-GVITVE
CH601_RHOSH      DLATSKVVEAIKAAARPVNDS-HEVAQVGTISANGEAQIGRFIADAMQKVGNE-GVITVE
CH60_PARDE       DVATAKVVEAIKSAARPVNDS-SEVAQVGTISANGESFIGQQIAEAMQRVGNE-GVITVE
CH60_RHOCA       DLATTTVVEAIKAAARPVKDS-DEVAQVGTISANGEAQIGRFIADASQKVGNE-GVITVE
CH602_RHOSH      DRAVAIVIAEIRSMSRPVGDS-AEIAKVGALSANGEAAIGRQIADAMAKVGTA-GVIKVE
CH60_EHRRW       LKAKEAVLEALKCMKREVLSE-EEIAQVATISANGDKNIGTKIAQCVKEVGKD-GVITVE
CH60_EHRCH       LKAKEAVLEALMSMKREVLSE-EEIAQVATISANGDKNIGSKIAQCVQEVGKD-GVITVE
CH60_ORITS       EKAVEAVIADVRKNSSPVKNE-EEIAQVATVSSNGDREIGEKIANAMKQVGQE-GVITVE
CH60_RICCN       DLAVNAVVEEIKKSSKKINSQ-EEIAQVGTISSNGDKEIGEKIAKAMEEVGKE-GVITVE
CH60_RICPR       DLAVNAVVEEIKRSSKKINSQ-EEIAQVGTISSNGDKEIGEKIAKAMEEVGKE-GVITVE
CH60_CAMJE       DKACEAIVAELKKLSREVKDK-KEIAQVATISANSDEKIGNLIADAMEKVGKD-GVITVE
CH60_CAMRE       DKQAAAIIAELKNLSRKVTDK-KEIAQVATISANSDSAIGGLIADAMEKVGKD-GVITVE
CH60_HELPY       DKAAEAIINELKKASKKVGGK-EEITQVATISANSDHNIGKLIADAMEKVGKD-GVITVE
CH60_HELPJ       DKAAEAIINELKKASKKVGGK-EEITQVATISANSDHNIGKLIADAMEKVGKD-GVITVE
CH60_CHLMU       DKAVKVVVDQIKKISKPVQHH-KEIAQVATISANNDAEIGNLIAEAMEKVGKN-GSITVE
CH60_CHLTR       DKAVKVVVDQIRKISKPVQHH-KEIAQVATISANNDAEIGNLIAEAMEKVGKN-GSITVE
CH60_CHLPN       DKAVKVVVDELKKISKPVQHH-KEIAQVATISANNDSEIGNLIAEAMEKVGKN-GSITVE
CH601_CHLCV      DKAVKVVVDEIKKISKPVQHH-KEIAQVATISANNDAEIGNLIAEAMEKVGKN-GSITVE
CH60_AQUAE       DKAVKKIVEELKKLSKDVKER-KEIEQVATISANNDPEIGKIIADAMEEVGKD-GVITVE
CH60_TANFO       DKAVSKVVESIASQSEAVGTNMDRIEHVAKISANGDEGIGKLIAEAMQKVKKE-GVITVE
CH60_CHLTE       DRAVKEVVAELRNISRSISGK-KEIAQVGTISANNDPEIGELIAEAMDKVGKD-GVITVE
CH60_RHOMR       DKAVEVVVAELRKMSQEVQDK-NRIAQVATISANGDKAIGQLIADAFEKVGKD-GVITVE
CH60_BORBU       DHAVNLAAEKIRQSAKKITTK-EEIAQVASISANNDSYIGEKIAEAMDKVGKD-GVITVE
CH60_TREPA       DKAVAIAVDDIKQNSKGIKSN-EEVAHVASVSANNDKEIGRILASAIEKVGND-GVIDVD
CH60_LEPIN       DKAVTAAVESIQKRAVKIENK-KDIANVASISANNDNTIGNLIADAMDKVGKD-GVITVE
CH60_DEIRA       DKAVAVAIEEIKKLAVSVEDS-EAIKKVAGISAN-DETVGQEIASAMDKVGKE-GVITIE
CH60_THET8       EKAVEAAVEKIKALAIPVEDR-KAIEEVATISAN-DPEVGKLIADAMEKVGKE-GIITVE
CH60_THEMA       DKAVEKAVEEIKKVSKKLSGR-EDIAHVAAISAN-SAEIGELIAEAMDKVGED-GVITVE
CH60_THENE       DKAVERAVEEIKKLSKKLSGR-EDIAHVAAISAN-SPEIGELIAEAMDKVGED-GVITVE
CH601_MYCLE      SKAADAVSEALLAVATPVAGK-DAITQVATVSSR-DEQIGALVGEGMNKVGTD-GVVSVE
CH601_MYCTU      GKAADAVSEALLASATPVSGK-TGIAQVATVSSR-DEQIGDLVGEAMSKVGHD-GVVSVE
CH601_CORGL      SAAAEKTLEELKARATEVSDT-KEIANVATVSSR-DEVVGEIVAAAMEKVGKD-GVVTVE
CH601_STRCO      DAAVAAVSEDLLATARPIDEK-SDIAAVAALSAQ-DQQVGELIAEAMDKVGKD-GVITVE
CH601_STRLI      DAAVAAVSEDLLATARPIDEK-SDIAAVAALSAQ-DQQVGELIAEAMDKVGKD-GVITVE
CH601_STRAL      DAAVAAVSAELLDTARPIDDK-SDIAAVAALSAQ-DKQVGELIAEAMDKVGKD-GVITVE
CH602_MYCLE      EKAVDKVTETLLKDAKEVETK-EQIAATAAISAG-DQSIGDLIAEAMDKVGNE-GVITVE
CH602_MYCTU      EKAVEKVTETLLKGAKEVETK-EQIAATAAISAG-DQSIGDLIAEAMDKVGNE-GVITVE
CH602_MYCPA      EKAVEKVTETLLKSAKEVETK-DQIAATAAISAG-DQSIGDLIAEAMDKVGNE-GVITVE
CH602_STRAL      EKAVEAVSSALLEQAKDVETK-EQIASTASISAA-DTQIGELIAEAMDKVGKE-GVITVE
CH602_STRCO      EKAVEAVSAALLEQAKDVETK-EQIASTASISAA-DTQIGELIAEAMDKVGKE-GVITVE
CH601_CUTAK      EAAVQAVSARLSDMAIDIETK-DQIASTASISAA-DPTVGEIIAEAMDKVGKE-GVITVE
CH60_TROWT       EKSVAAVSKALLTSAKEVETE-AEIAACASISAG-DPQIGDIIAQALEKVGKE-GVVTVE
CH60_FUSNN       ELAAKEAVEVLKDKAKKIESN-EEISQVASISAG-DEEIGKLIAQAMAKVGET-GVITVE
CH60_MYCGE       EDASLLIIKELEKYSKKINTN-EEIEQVAAISSG-SKEIGKLIAQAMALVGKN-GVITTD
CH60_MYCPN       EDASQLIITELDKRSKKINTN-EEIEQVAAISSG-SKEIGKLIAQAMALVGKN-GVITTD
                           :             :   . ::.      *  :.     *    * :  :

CH60_BACHD       ESKGFS-TELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYVLITDKKISNI-QEVLPV
CH60_BACSU       ESKGFT-TELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNI-QEILPV
CH60_GEOSE       ESKGFA-TELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSI-QEILPI
CH60_PARTM       ESKGFT-TELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNI-QDILPI
CH60_BACP3       ESKGFT-TELDVVEGMQFDRGYVSPNMITDTEKMEAVLENPYILITDKKVSSI-QELLPA
CH60_LISIN       ESKGFA-TELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNI-QEILSV
CH60_LISMO       ESKGFA-TELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNI-QEILPV
CH60_STAAM       ESNGLN-TELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSF-QDILPL
CH60_STAES       ESNGFN-TELEVVEGMQFDRGYQSPYMVTDSDKMIAELERPYILVTDKKISSF-QDILPL
CH60_BRECH       ESKGFV-TELEVVEGMQFDRGYASPYMITDTDKMEAVLNNPFILITDKKISNI-QEVLPV
CH60_STRAG       ESRGME-TELEVVEGMQFDRGYLSQYMVTDNEKMVSELENPYILITDKKISNI-QEILPL
CH60_STRP1       ESRGME-TELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNI-QDILPL
CH60_STRAP       ESKGME-TELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNI-QEILPL
CH60_STRCV       ESKGME-TELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNI-QEILPL
CH60_STRSA       ESKGME-TELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNI-QEILPL
CH60_STRPN       ESRGME-TELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNI-QEILPL
CH60_LACLA       ESKGMQ-TELDVVEGMQFDRGYLSQYMVSNTEKMVAELDNPYILITDKKISNI-QEILPL
CH60_ENTFA       ESKGIE-TELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNI-QDILPL
CH60_LACAC       DSRGIN-TELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNI-QDILPL
CH60_LACHE       DSRGIN-TELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNI-QDILPL
CH60_LACZE       ESKGID-TELSVVEGMQFDRGYLSQYMVTDNDKMEADLDDPYILITDKKISNI-QDILPL
CH60_CLOAB       ESKSMG-TELDVVEGMQFDRGYLSPYMVTDQEKMEAVLDDPYILITDKKIANI-QEILPL
CH60_CLOPE       ESKSMG-TELDVVEGMQFDRGYVSAYMVTDTEKMEAVLDNPLVLITDKKISNI-QDLLPL
CH60_CLOBO       ESNTMA-TELEVVEGMQFDRGYLSPYMVTDAEKMEAVLENPYILLTDKKISNI-QEILPI
CH60_CLODI       ESQTMN-TELDAVEGMQFDRGFVSAYMVTDVDKMEAVLNDPYILITDKKISNI-QELLPV
CH60_THEBR       ESKTLG-TTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKISNI-QDLLPL
CH60_CALS4       ESKTIG-TTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKLSSV-QDLLPL
CH60_HUNT2       EAKTMG-TNLEIVEGMQFDRGYVSPYMVTDTEKMEAVLDEPYILITDKKISNI-QDILPL
CH601_NOSS1      EGKSVT-TELEITEGMRFDKGYISPYFATDPERMEAIFDEPFLLLTDKKIALV-QDLVPV
CH60_SYNE7       EGKSMT-TELEVTEGMRFDKGYISPYFATDTERMEAVFDEPFILITDKKIGLV-QDLVPV
CH601_THEVL      EAKSMT-TELEVTEGMRFDKGYISPYFATDTERMEAVLDEPFVLVTDKKITLV-QDLVPI
CH601_SYNY3      EGKSMT-TELEITEGMRFDKGYISPYFVTDAERMEAVLEDPRILITDKKINLV-QDLVPI
CH60_CYAPA       EGKSTT-TELEITEGMRFDKGYISPYFVTDPERMEVIQKDAMFLITDKKITLV-QDLVPI
CH60_GUITH       EGKSTI-TELEMTEGMCFEKGFISPYFVTDTERMEVIQDNPYILLTDKKITLVQQELLPT
CH60_PORPU       EGKSTS-TSLEITEGMQFEKGFISPYFVTDLDRMEVLQENPFILFTDKKITLVQQELVPL
CH60_GALSU       EGKSTT-TELEIKEGMKFERGYISPYFVTDSDRMEVVQENASVLITDKKITLVQQDLLPV
CH60_TRICV       EGKGII-TELEITEGMKLEKGFISPYFITNTEKMEVSYENPFILLTDKRITLVQQDLLPI
CH60_CYACA       EGKSAI-TELEITQGMKFEKGYISPYFITNSEKMEVVLENPYILMTDKKITLVKEDLLPV
CH602_NOSS1      ESKSLT-TELEVVEGMQIDRGYISPYFITNNERQTVELENVRILITDKKISSI-QELVPV
CH602_SYNY3      ESKSLN-TELEVVEGMQIDRGYISPYFITDSDRQLVEFDNPLILITDKKISAI-AELVPV
CH602_THEEB      ESKSLQ-TEMEIVEGMQFDRGYISPYFVTDPERMIVQLNNAYLLLTDKKITSI-QDLIPT
CH60_AGGAC       DGTGLE-DELDVVEGMQFDRGYLSPYFINKPETATVELDNPFILLVDKKISNI-RELLPV
CH60_PASMU       DGTGLE-DELAVVEGMQFDRGYLSPYFINKPETATVELDNPFILLVDKKVSNI-RELLPV
CH60_HAEIN       DGTGLE-DELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNI-RELLPV
CH60_ACTPL       DGTGLD-DALDVVEGMQFDRGYLSPYFINKPEAGTVELENPYIILVDKKISNI-REILPV
CH60_HAEDU       DGTGLD-DALDVVEGMQFDRGYLSPYFINKPEAGTVELDNPYIILVDKKISNI-REILPV
CH60_AERSA       DGQGLD-DELAVVEGMQFDRGYLSPYFVNKPETGAVELDDPFILLVDKKVSNI-REMLPV
CH601_VIBPA      EGQALQ-DELDVVEGMQFDRGYLSPYFINNQEAGSVELENPFILLVDKKISNI-RELLPT
CH601_VIBVU      EGQALH-DELDVVEGMQFDRGYLSPYFINNQESGSVELESPFILLVDKKISNI-RELLPA
CH601_VIBCH      EGQALQ-DELDVVEGMQFDRGYLSPYFINNQESGSVELDNPFILLVDKKISNI-RELLPV
CH60_BUCAI       EGTGLQ-DELEVVKGMQFDRGYLSPYFINKPETGIVELENPYILMADKKISNV-REMLPI
CH60_BUCAP       EGTGLQ-NELEVVKGMQFDRGYLSPYFINKPETGIVELENPYILMADKKISNV-REMLPI
CH60_BUCCM       EGTGLE-DELDVVKGMQFDRGYLSPYFINKPETGNIELENPYILMVDKKISNI-RDILSL
CH60_ECOLI       DGTGLQ-DELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNI-REMLPV
CH60_SALTY       DGTGLQ-DELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNI-REMLPV
CH60_STEMA       DGTGLQ-DELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNI-REMLPV
CH60_KLEPN       DGTGLE-DELDVVEGMQFDRGYLSPYFINKPDTGAVELESPFILLADKKISNI-REMLPV
CH60_BUCTS       EGTGLQ-DELDVVEGMQFDRGYLSPYFINKPDTGSIELDNPFILLADKKISNN-REMLPP
CH60_YERPE       EGSGLQ-DELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILLADKKISNI-REMLPV
CH60_SODGL       EGSGLQ-DELDVVEGMQFDRGYLSPYFVNKPETGAVELESPFILLADKKISNI-REMLPV
CH60_WIGBR       EGSGLQ-DELDVVEGMQFDRGYLSPYFVNKPEARSVELDNPFILLSDKKISNI-REMLPI
CH60_COLMA       EGQALT-DELDVVEGMQFDRGYLSPYFINKQENGTVELENPFILLVDKKISNI-RELLTT
CH60_PSEHT       EGQSLE-NELDVVEGMQFDRGYLSPYFINSPEKGTVELDNPFILLVDKKISNI-RELLPT
CH602_VIBCH      EGQALQ-NELSVVEGMQFDRGYLSPYFINQPKAGCVELENPYVLLVDKKISHI-RELLPI
CH60_PSEAE       EGSGLE-NELSVVEGMQFDRGYLSPYFVNKPDTMAAELDSPLLLLVDKKISNI-REMLPV
CH60_PSEPU       EGSGLE-NELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISTS-RAAAST
CH60_OLEAN       EGKGLE-DELDVVEGMQFDRGYLSPYFINNQEKMTVEMENPLILLVDKKIDNL-QELLPI
CH60_LEGJE       DGNGLE-NELSVVEGMQFDRGYISPYFINNQQNMSAELEHPFILLVDKKIATI-RDMLSV
CH60_TATMI       DGNSLE-NELAVVEGMQFDRGYISPYFINNQQNMSAELEHPFILLVDKKISTI-RDMLSV
CH60_LEGPH       DGNGLE-NELSVVEGMQFDRGYISPYFINNQQNMSCELEHPFILLVDKKVSSI-REMLSV
CH60_COXBU       DGSGLE-NALEVVEGMQFDRGYLSPYFINNQQNMSAELENPFILLVDKKISNI-RELIPL
CH60_XANAC       EGSGLE-NELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNV-RDLLPV
CH60_XANCP       EGSGLE-NELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILLHDKKISNV-RDLLPV
CH60_XYLFA       EGTTLE-NELDVVEGMQFDRGYSSPYFINNQQSQIVELDNPYILLHDKKISSV-RDLLTV
CH60_ALLVI       DGTSLQ-NELDVVEGMQFDRGYLSPYFINNQQSQSAELDAPYILLYDKKISNI-RDLLPV
CH60_FRATH       EGKGFE-DELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNI-RDLLPI
CH601_BURPS      DGKSLA-DELDVVEGMQFDRGYLSPYFINNPDKQVAVLENPFVLLHDKKVSNI-RDLLPV
CH60_BURTH       DGKSLA-DELDVVEGMQFDRGYLSPYFINNPDKQVAVLENPFVLLHDKKVSNI-RDLLPV
CH60_BURCE       DGKSLA-DELDVVEGMQFDRGYLSPYFINNPDKQVAVLDNPFVLLHDKKVSNI-RDLLPV
CH60_RALSO       DGKSLE-DELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLLFDKKISNI-RDLLPV
CH60_BORPE       DGKSLE-NELDVVEGMQFDRGYLSPYFINSPEKQVAALDDPYVLIYDKKVSNI-RDLLPV
CH60_NEIMA       DGKSLE-NELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNI-RDLLPV
CH60_NEIMB       DGKSLE-NELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNI-RDLLPV
CH60_TREPR       DGKSLA-DELEVVEGMQFDRGYLSPYFINNPDRQVAVLDSPFVLLCEKKVASI-RDLLPI
CH60_METSS       DGKSLD-NELDVVEGMQFDRGYLSPYFINNPEKQTVEFDDPLILLYDKKISSI-RDLLPT
CH601_RHIME      EAKTAE-TELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNL-QAMLPV
CH604_RHIME      EAKTAE-TELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILLHEKKLSNL-QAMLPV
CH60_AGRFC       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNL-QAMLPV
CH60_RHILV       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILLHEKKLSNL-QSMLPV
CH60_BRUAB       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNL-QALLPV
CH60_BRUME       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAYILLHEKKLSNL-QALLPV
CH603_RHILO      EAKTAE-TELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNL-QAMLPV
CH605_RHILO      EAKTAE-TELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNL-QAMLPI
CH604_RHILO      EAKTAE-TELEVVEGMQFDRGYLSPYFVTNADKMVADLEDAYILLHEKKLSNL-QAMLPV
CH60_BARHE       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNL-QSLLPV
CH60_BARQU       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNADKMVADLDDPYILIHEKKLSNL-QSLLPV
CH60_BARBA       EAKTAE-TELEVVEGMQFDRGYLSPYFVTNSEKMMVDLDDPYILIHEKKLSNL-QSLLPV
CH602_BRADU      EAKSLE-TELEVVEGMQFDRGYISPYFVTNADKMRVEMDDAYVLINEKKLSQL-NELLPL
CH603_BRADU      EAKSLE-TELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSL-NELLPL
CH601_BRADU      EAKSLD-TELEVVEGMQFDRGYASPYFVTNAEKMRVEFEDPYILIHEKKLSTL-QSMLPL
CH602_RHIME      EAKTAE-IELEVVEGMEFDRGYLSPYFITNQEKMRVELEDAYILLHEKKLSNL-QAMIPI
CH605_RHIME      EAKTAE-TELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNL-QAMLPV
CH602_RHILO      EAKTAE-TELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNL-QALLPV
CH601_RHILO      EAKTAE-TELDVVEGMQFDRGYLSPYFVTNADKMRVELEEPYVLIHEKKLGNL-QAMLPI
CH603_RHIME      EARTAD-TELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILIHEKKLGSL-QAMLPI
CH60_CAUVC       EAKTAE-TELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPLILLFEKKLSSL-QPLLPV
CH60_RHOPL       ENKGLE-TEVEVVEGMQFDRGYLSPYFVTNADKMTAELEDVFILLHEKKLSSL-QPMVPL
CH601_RHOSH      ENKGLE-TEVEVVEGMQFDRGYLSPYFVTNADKMTAELDDVYILLHEKKLSSL-QPMVPL
CH60_PARDE       ENKGME-TEVEVVEGMQFDRGYLSPYFVTNADKMIAELEDAYILLHEKKLSSL-QPMVPL
CH60_RHOCA       ENKGMD-TEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSL-QPMVPL
CH602_RHOSH      -NKGLE-TETEVVEGMQFDRGYLSPYFITHAQKMVVELDDCAILLHEGKLTSL-ASMVPL
CH60_EHRRW       ESKGFKELDVEKTDGMQFDRGYLSPYFVTNSEKMLVEFENPYILLTEKKLNII-QPLLPI
CH60_EHRCH       ESKGFKELDVEKTDGMQFDRGYLSPYFVTNSEKMLVEFENPYILLTEKKLNII-QPILPI
CH60_ORITS       DSKNFN-FEVEVVKGMRFDRGYISQYFATNREKMITEFENPYILLLDQKVSTV-QPLVPV
CH60_RICCN       EAKNFS-FDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNL-QPMLPI
CH60_RICPR       EAKNFS-FDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNL-QPMLPI
CH60_CAMJE       EAKSIN-DELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKITNL-KDLLPV
CH60_CAMRE       EAKSIQ-DELNVVEGMQFDRGYLSPYFITNAEKMQVELQSPYILLFDKKITNL-KDLLPV
CH60_HELPY       EAKGIE-DELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSM-KDILPL
CH60_HELPJ       EAKGIE-DELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSM-KDILPL
CH60_CHLMU       EAKGFE-TVLDVVEGMNFNRGYLSSYFATNPETQECVLEDALVLIYDKKISGI-KDFLPV
CH60_CHLTR       EAKGFE-TVLDIVEGMNFNRGYLSSYFATNPETQECVLEDALVLIYDKKISGI-KDFLPV
CH60_CHLPN       EAKGFE-TVLDVVEGMNFNRGYLSSYFSTNPETQECVLEDALILIYDKKISGI-KDFLPV
CH601_CHLCV      EAKGFE-TVLDVVEGMNFNRGYLSSYFSTNPETQECVLEEALVLIYDKKISGI-KDFLPV
CH60_AQUAE       ESKSAE-TTLEVVKGMQFDRGYLSPYFVTDPEKMECVLENPYILIYEKKITNV-KELLPI
CH60_TANFO       EAKGTE-TTVEVVEGMQFDRGYISAYFVTDTEKMETQFENPYILIYDKKISVL-KDLLPI
CH60_CHLTE       EAKGME-TELKVVEGMQFDRGYLSPYFVTNSETMEAELDEALILIHDKKISNM-KELLPI
CH60_RHOMR       EAKGTE-TTLEVVEGMQFDRGYLSPYFVTNPDTMEAVLEDAYILIHDKKISAM-KDLLPI
CH60_BORBU       ESKTFD-TTISYVEGMQFDRGYLSPYFSTNKENMSVNFDDAFILIYEKKISSI-KELLPV
CH60_TREPA       EAQTME-TVTEFVEGMQFDRGYISSYFVTDRDRMETVYENPYILIYDKSISTM-KDLLPL
CH60_LEPIN       EAKSIE-TTLDVVEGMQFDRGYISPYMVTDAESMVATLNDPFILIYDKKISSM-KDLIHI
CH60_DEIRA       ESKGFD-TEVDVVEGMQFDKGFINPYFITNPEKMEAVLEDAYILINEKKISNL-KDMLPV
CH60_THET8       ESKSLE-TELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNV-RELLPI
CH60_THEMA       DSKTLE-TYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPFILITDRKLSAV-KPLIPI
CH60_THENE       DSKTLE-TYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPSILITDRKLSAV-KPLIPI
CH601_MYCLE      ESSTLD-TELEFTEGVGFDKGFLSAYFVTDFDSQQAVLDDPLVLLHQEKISSL-PELLPM
CH601_MYCTU      ESSTLG-TELEFTEGIGFDKGFLSAYFVTDFDNQQAVLEDALILLHQDKISSL-PDLLPL
CH601_CORGL      ESQSIE-TALEVTEGISFDKGYLSPYFINDNDTQQAVLDNPAVLLVRNKISSL-PDFLPL
CH601_STRCO      ESNTFG-LELDFTEGMAFDKGYLSPYFVTDQERMEAVLDDPYILINQGKISSI-ADLLPL
CH601_STRLI      ESNTFG-LELDFTEGMAFDKGYRLRLLRTDQERMEAVLDDPYILINQGKISSI-ADLLPL
CH601_STRAL      ESNTFG-VDLDFTEGMAFDKGYLSPYMVTDQERMEAVLDDPYILIHQGKIGSI-QDLLPL
CH602_MYCLE      ESNTFG-LQLELTEGMRFDKGYISGYFVTDAERQEAVLEEPYILLVSSKVSTV-KDLLPL
CH602_MYCTU      ESNTFG-LQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTV-KDLLPL
CH602_MYCPA      ESNTFG-LQLELTEGMRFDKGYISGYFVTDAERQEAVLEDPFILLVSSKVSTV-KDLLPL
CH602_STRAL      ESQTFG-LELELTEGMRFDKGYISAYFATDMERMEASLDDPYILIVNSKIGNV-KDLLPL
CH602_STRCO      ESQTFG-LELELTEGMRFDKGYISAYFATDMERMEASLDDPYILIANSKIGNV-KDLLPL
CH601_CUTAK      ESNTFG-LELELTEGMRFDKGYISPYFVTDTERMEAVLEDPYILIVNSKISSL-KDLLPV
CH60_TROWT       ESNTFG-TELEITEGMRFDKGYLSAYFVTDAERQETVFENPYILICDSKISSV-KDLLPV
CH60_FUSNN       EAKSLE-TTLEIVEGMQFDKGYVSPYMVTDSERMTAELDNPLILLTDKKISSM-KELLPL
CH60_MYCGE       DAKTIN-TTLETTEGIEFKGTYASPYMVSDQEKMEVVLEQPKILVSSLKINTI-KEILPL
CH60_MYCPN       DAKTIN-TTLETTEGIEFKGTYASPYMVSDQEKMEVVLDQPKILVSAMKINTI-KEILPL
                              .*  :.  :    : .  .      .   .:.    :          

CH60_BACHD       LEQVVQQG--KPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAI
CH60_BACSU       LEQVVQQG--KPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAV
CH60_GEOSE       LEQVVQQG--RPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAI
CH60_PARTM       LEQVVQQG--KPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAI
CH60_BACP3       LEQVVQQG--RPLLIIAEDVEGEALATLVVNKLRGTFNAVRVKAPGFGDRRKAMLEDIAI
CH60_LISIN       LEQVVQQG--RPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAV
CH60_LISMO       LEQVVQQG--RPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_STAAM       LEQVVQSN--RPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAI
CH60_STAES       LEQVVQAS--RPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAI
CH60_BRECH       LEQVVQSG--KPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDIAA
CH60_STRAG       LEEVLKTN--RPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_STRP1       LEEVLKTN--RPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_STRAP       LENILKTS--RPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_STRCV       LENILKTS--RPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_STRSA       LENILKTN--RPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_STRPN       LESILQSN--RPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_LACLA       LEQILKTN--RPLLIVADDVDGEALPTLVLNKIKGVFNVVAVKAPGFGDRRKAQLEDLAI
CH60_ENTFA       LEQILQQS--RPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAI
CH60_LACAC       LQEIVQQG--KSLLIIADDVTGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIAA
CH60_LACHE       LQEIVQQG--KSLLIIADDITGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLQDIAA
CH60_LACZE       LQEIVQQG--KALLIIADDVAGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIAT
CH60_CLOAB       LEQIVQQG--KKLLIIADDVEGEALATLVVNKLRGTFNCVAVKAPGFGDRRKDMLRDIAI
CH60_CLOPE       LEQIVQAG--KKLLIIADDIEGEAMTTLVVNKLRGTFTCVGVKAPGFGDRRKEMLQDIAT
CH60_CLOBO       LEQIVQQG--KKLLIIAEDIEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLRDIAI
CH60_CLODI       LEQIVQQG--KKLLIIAEDVEGEALSTLVVNKLRGTFDVVAVKAPGFGDRRKEMLQDIAI
CH60_THEBR       LEQIVQQG--KKLLIIADDVEGEALATLIVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAI
CH60_CALS4       LEQIVQHG--KKLLIIADDVEGEALATLVVNKLRGTFSCVAVKAPGFGDRRKEMLQDIAI
CH60_HUNT2       LEQIVQQG--KKLVIIAEDVEGEALATLLVNKLRGTFTCVAVKAPGFGDRRKAMLEDIAI
CH601_NOSS1      LEQVARAG--RPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKAMLEDIAI
CH60_SYNE7       LEQVARAG--RPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKAMLEDIAV
CH601_THEVL      LEQVARAG--KPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRSKAMLEDIAV
CH601_SYNY3      LEQVARQG--KPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKQMLEDIAT
CH60_CYAPA       LEQVARAR--KPLFIIAEDIEKEALATLVVNKLRGNLNVSAVKAPGFGDRRKAMMQDIAV
CH60_GUITH       LELISKTS--RPLVIIAEDVEKEALATLVVNKLRGIVNVVAVRAPGFGDRRKAMLEDIAI
CH60_PORPU       LEQIAKTS--KPLLIIAEDIEKEALATIVVNKLRGILNVVAVRAPGFGDRRKSLLEDMSI
CH60_GALSU       LEQIAKTN--KPLLIIAEDIEKEALATLIVNKLRGILNVVAVKAPGFGDRRKSILEDIAI
CH60_TRICV       LEQITKTK--RPLLLIAEDVEKEALATLILNKLRGIVNVVAVRAPGFGELRKQMLEDIAV
CH60_CYACA       LTLINKTN--RPLLIIAEDVEKEALATLVINKLRGIVNVVAVRAPGFGDRKKALLEDIAI
CH602_NOSS1      LEKVARLG--QPLLIIAEDVEGDALATLVVNKARGVLSVAAIKAPGFGERRKALLQDIAI
CH602_SYNY3      LEAVARAG--RPLLIIAEDIEGEALATLVVNKARGVLNVAAIKAPAFGDRRKAVLQDIAI
CH602_THEEB      LERVARSG--RPLVIIAEDVEGEALATLVVNKLRGVLNVVAVKAPAFGERRKAMLQDIAI
CH60_AGGAC       LEGVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_PASMU       LEGVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_HAEIN       LEGVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_ACTPL       LEAVAKAG--KPLLIVAEDIEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_HAEDU       LEAVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_AERSA       LEGVAKAG--KPLLIVAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAM
CH601_VIBPA      LEAVAKAS--RPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH601_VIBVU      LEAVAKAS--RPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH601_VIBCH      LEGVAKAS--RPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_BUCAI       LESVAKSG--KPLLIISEDLEGEALATLVVNSMRGIVKVAAVKAPGFGDRRKAMLQDISI
CH60_BUCAP       LESVAKSG--KPLLIISEDLEGEALATLVVNSMRGIVKVAAVKAPGFGDRRKAMLQDISI
CH60_BUCCM       LESVAKSG--KPLLIIAEDLEGEALATLVVNSMRGIVKIAAVKAPGFGDRRKAMLQDISI
CH60_ECOLI       LEAVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAT
CH60_SALTY       LEAVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAT
CH60_STEMA       LEAVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAT
CH60_KLEPN       LEAVAKAG--KPLVIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAT
CH60_BUCTS       LESVAKAG--N-LLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAT
CH60_YERPE       LEAVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAT
CH60_SODGL       LEAVAKAG--KPLLIIAEDVEGEALATLVVNTMRGIVKIAAVKAPGFGDRRKAMLRDIAI
CH60_WIGBR       LESVAKAG--KPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_COLMA       LEGVAKAG--KPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDVAT
CH60_PSEHT       LEAVAKAS--KPLLIIAEDLEGEALATLVVNNMRGIVKVSAVKAPGFGDRRKAMLQDIAV
CH602_VIBCH      LESVAKAS--RSLLIIAEDVDGDALATLVVNSMRGIIKVAAVKAPGFGEQRKAMLEDIAA
CH60_PSEAE       LEAVAKAG--RPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAI
CH60_PSEPU       --ERASAG--RPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAV
CH60_OLEAN       LENVAKSG--RPLLIVAEDVEGQALATLVVNNLRGTFKVAAVKAPGFGDRRKAMLQDLAI
CH60_LEGJE       LEAVAKSG--RPLLIVAEDVEGEALATLVVNNMRGIVKVCAVKAPGFGDRRKAMLQDIAI
CH60_TATMI       LEAVAKSG--PSLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFGDRRKAMLQDIAI
CH60_LEGPH       LEGVAKSG--RPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFGDRRKAMLQDIAI
CH60_COXBU       LENVAKSG--RPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGFGDRRKAMLQDIAV
CH60_XANAC       LEGVAKAG--KPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAV
CH60_XANCP       LEGVAKAG--KPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGFGDRRKAMLEDMAV
CH60_XYLFA       LDAVAKES--KPLLIVAEEVEGEALATLVVNNIRGIIKVCAVKAPGFGDRRKAMLEDMAV
CH60_ALLVI       LEGVAKAG--KPLLIIAEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLQDIAI
CH60_FRATH       LEGVSKSG--RALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIAT
CH601_BURPS      LEQVAKAG--RPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAI
CH60_BURTH       LEQVAKAG--RPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAI
CH60_BURCE       LEQVAKAG--RPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAI
CH60_RALSO       LEQVAKAG--RPLLIVAEDVEGEALATLVVNNIRGILKTAAVKAPGFGDRRKAMLEDIAI
CH60_BORPE       LEQVAKSS--RPLLIIAEDVEGEALATLVVNNIRGILKTTAVKAPGFGDRRKAMLEDIAI
CH60_NEIMA       LEQVAKAS--RPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAI
CH60_NEIMB       LEQVAKAS--RPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAI
CH60_TREPR       MERVAKAG--RPLLIVAEDVEGEALATLVVNNARGILKAAAVKAPGFGDRRKAMLQDIAI
CH60_METSS       LENVAKAG--KPLLIIAEDLEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAI
CH601_RHIME      LEAVVQTG--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH604_RHIME      LEAVVQTG--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH60_AGRFC       LEAVVQTG--KPLVIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH60_RHILV       LEAVVQTG--KPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKRMLEDIAI
CH60_BRUAB       LEAVVQTS--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH60_BRUME       LEAVVQTS--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDCRKAMLEDIAI
CH603_RHILO      LEAVVQTS--KPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH605_RHILO      LEAVVQTS--KPLVIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH604_RHILO      LEAVVQTS--KPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH60_BARHE       LEAVVQSG--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH60_BARQU       LEAVVQSG--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAI
CH60_BARBA       LEAVAQSG--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAV
CH602_BRADU      LEAVVQSG--KPLVIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAI
CH603_BRADU      LEAVVQTG--KPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAI
CH601_BRADU      LEAVVQSG--KPLLVVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAI
CH602_RHIME      LESVIQSG--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKSMLEDIAI
CH605_RHIME      LEAVVQSG--KPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAI
CH602_RHILO      LEAVVQSS--KPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAI
CH601_RHILO      LEAVVQSG--RPLLIISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAV
CH603_RHIME      LEAAVQSG--KPLLIISEDVEGEVLATLVVNRLRGGLKIAAVKTPGFGDRRKAMLEDIAV
CH60_CAUVC       LEAVVQSG--RPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAI
CH60_RHOPL       LESVIQAQ--RPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAI
CH601_RHOSH      LEAVIQSQ--KPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAI
CH60_PARDE       LESVIQSQ--KPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAI
CH60_RHOCA       LEAVIQST--RPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAI
CH602_RHOSH      LEAVVQAE--KQLLVVAEDVEGEALTTLVVNKLRGGLKVAAAKAPGFGDGRAAMLEDLAV
CH60_EHRRW       LENIARSG--RPLLIIAEDVEGEALSTLVLNKLRGGLHVAAVKAPGFGDRRKDMLGDIAI
CH60_EHRCH       LENVARSG--RPLLIIAEDVEGEALSTLVLNKLRGGLHVAAVKAPGFGDRRKDMLGDIAI
CH60_ORITS       LEAVAHTG--KPLVLIADDVDGEALTALILNNLKGSIKVVAVKAPGFGDRKKEMLEDIAI
CH60_RICCN       LEAVVQSQ--RPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAI
CH60_RICPR       LEAVVQSQ--RPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAI
CH60_CAMJE       LEQIQKTG--KPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAI
CH60_CAMRE       LEQIQKTG--KPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAI
CH60_HELPY       LEKTMKEG--KPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAI
CH60_HELPJ       LEKTMKEG--KPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAI
CH60_CHLMU       LQQVAESG--RPLLIIAEDIEGEALATLVVNRIRGGFRVCAVKAPGFGDRRKAMLEDIAI
CH60_CHLTR       LQQVAESG--RPLLIIAEDIEGEALATLVVNRIRGGFRVCAVKAPGFGDRRKAMLEDIAI
CH60_CHLPN       LQQVAESG--RPLLIIAEEIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAI
CH601_CHLCV      LQQVAESG--RPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAI
CH60_AQUAE       LEQVVRSG--RPLLVIAEDVEGEALATLVVNHIKGVLKACAVKAPGFGQRRKDYLGDIAV
CH60_TANFO       LEQMVQSG--RALLIIAEDIDSEALATLVVNRLRGGLKVCAVKAPGFGDRRKAMLEDIAI
CH60_CHLTE       LEKAAQSG--RPLLIIAEDIEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKAMLEDIAI
CH60_RHOMR       LEKVVQTG--RPLLIIAEDVEGEALATLVVNKLRGVLKVAAVKAPGFGDRRKAMLEDIAI
CH60_BORBU       LEKVLGTN--KPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAV
CH60_TREPA       LEKIAQTG--RPLLIIAEDVEGEALATLVVNSLRGTLKTCAVKAPGFGDRRKEMLEDIAI
CH60_LEPIN       LEKVAQAG--KPLVIISEEVEGEALATIVVNTLRKTISCVAVKAPGFGDRRKSMLEDIAI
CH60_DEIRA       LEKVAQTG--RPLLIIAEDVEGEALATLVVNKLRGTLNIAAVKAPGFGDRRKEMLRDIAA
CH60_THET8       LEQVAQTG--KPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAA
CH60_THEMA       LEKVAQTG--KPLLVIAEDVEGEVLTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAI
CH60_THENE       LEKVAQTG--KPLLVIAEDVEGEALTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAI
CH601_MYCLE      LEKVTESG--KPLLIVAEDLEGEALATLVVNSIRKTLKAVAVKSPFFGDRRKAFLEDLAI
CH601_MYCTU      LEKVAGTG--KPLLIVAEDVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDLAV
CH601_CORGL      LEKVVESN--RPLLIIAEDVEGEPLQTLVVNSIRKTIKVVAVKSPYFGDRRKAFMDDLAI
CH601_STRCO      LEKVIQANASKPLLIIAEDLEGEALSTLVVNKIRGTFNAVAVKAPGFGDRRKAMLQDMAV
CH601_STRLI      LEKVIQANASKPLLIIAEDLEGEALSTLVVNQIRGTFNAVAVKAPGFGDRRKAMLQDMAV
CH601_STRAL      LEKVIQAGGSKPLLIIAEDVEGEALSTLVVNKIRGTFNAVAVKAPGFGDRRKAMLGDMAT
CH602_MYCLE      LEKVIQAG--KSLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAI
CH602_MYCTU      LEKVIGAG--KPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAI
CH602_MYCPA      LEKVIQAG--KPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAI
CH602_STRAL      LEKVMQSG--KPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLGDIAI
CH602_STRCO      LEKVMQSG--KPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLGDIAI
CH601_CUTAK      LEKVMQSG--KPLFVIAEDVEGEALAGLIVNKIRGTFKSVAVKAPGFGDRRKAMLNDIAI
CH60_TROWT       VDKVIQSG--KQLLIIAEDVDGEALATLVVNKIRGIFKSVAVKAPGFGDRRKMMLQDIAV
CH60_FUSNN       LEQTVQMS--KPVLIVADDIEGEALTTLVINKLRGTLNVVAVKAPAFGDRRKAILEDIAI
CH60_MYCGE       LEGSVENG--NPLLIVAPDFAEEVVTTLAVNKLRGTINVVAVKCNEYGERQKAALEDLAI
CH60_MYCPN       LEGSMENG--NPLLIVAPDFAEEVVTTLAVNKLRGTINVVAVKCNEYGERQKAALEDLAI
                             :.::: :.  :    : :*  :  .     :   :*:     : *:: 

CH60_BACHD       LT---GGE-VITEDLGLDLKSAN-ITQLGRASKVVVTKENTTIVEGAGES----DKIAAR
CH60_BACSU       LT---GGE-VITEDLGLDLKSTQ-IAQLGRASKVVVTKENTTIVEGAGET----DKISAR
CH60_GEOSE       LT---GGE-VISEELGRELKSAT-IASLGRASKVVVTKENTTIVEGAGDS----KRIKAR
CH60_PARTM       LT---GGE-VISEELGRELKSTT-IASLGRASKVVVTKENTTIVEGAGDS----ERIKAR
CH60_BACP3       LT---GGE-VISEELGRELKSTT-IASLGRASKVVVTKETTTIVEGAGDS----KRIKAA
CH60_LISIN       LT---GGQ-VITEDLGLELKTAT-VDQLGTANKVVVTKDDTTIVEGAGDS----TQISAR
CH60_LISMO       LT---GGQ-VITEDLGLELKTAT-VDQLGTANKVVVTKDDTTIVEGAGDS----TQISAR
CH60_STAAM       LT---GAQ-VITDDLGLDLKDAS-IDMLGTASKVEVTKDNTTVVDGDGDE----NSIDAR
CH60_STAES       LT---GAQ-VITDDLGLELKDAS-LDMLGTANKVEVTKDHTTVVDGNGDE----NNIDAR
CH60_BRECH       LT---GGE-VITEELGLDLKSTK-LEQLGRAGKIVVTKENTTVVEGAGDK----ANIESR
CH60_STRAG       LT---GGT-VVTEDLGLDLKDAT-MQVLGQSAKVTVDKDSTVIVEGAGDS----SAIANR
CH60_STRP1       LT---GGT-VITEDLGLELKDAT-MTALGQAAKITVDKDSTVIVEGSGSS----EAIANR
CH60_STRAP       LT---GGT-VITEDLGLELKDAT-IEALGQASKVTVDKDSTVIVEGSGDA----EAIANR
CH60_STRCV       LT---GGT-VITEDLGLELKDAT-IEALGQASKVTVDKDSTVIVEGSGAA----EAIANR
CH60_STRSA       LT---GGT-VITDDLGLELKDAT-IEALGQASKVTVDKDSTVIVEGSGNP----EAIANR
CH60_STRPN       LT---GGT-VITEDLGLELKDAT-IEALGQAARVTVDKDSTVIVEGAGNP----EAISHR
CH60_LACLA       LT---GGT-VITEELGLDLKDAT-LEALGQAAKATVDKDHTTIVEGAGSA----DAISDR
CH60_ENTFA       LT---GGT-VITDDLGLELKDTT-IENLGNASKVVVDKDNTTIVEGAGSK----EAIDAR
CH60_LACAC       LT---GGT-VITDDLGFELKDTK-IDQLGQARRVTVTKDSTTIVDGAGSK----DAIKER
CH60_LACHE       LT---GGT-VITEDLGLELKDTK-IDQLGQARRITVTKDSTTIVGGAGSK----EAIDER
CH60_LACZE       LT---GGT-VISSDLGLDLKDTK-LEQLGRAGKVTVTKDNTTIVDGAGSK----DAIAER
CH60_CLOAB       LT---GGE-VISEELGKDLKDVK-VEDLGSAESVKISKENTTIVNGRGDK----SAIHDR
CH60_CLOPE       LT---GGV-VISDEVGGDLKEAT-LDMLGEAESVKVTKESTTIVNGRGNS----EEIKNR
CH60_CLOBO       LT---GGE-VISEELGREIKDVT-LDMLGTAESIKVTKENTTIVNGKGSK----AEIEDR
CH60_CLODI       LT---GAQ-VISEELGYDLKEAD-LSMLGRASSVKVTKESTTIVDGSGDK----KAIEDR
CH60_THEBR       LT---GGQ-VISEELGYDLKDVR-LDMLGRARQVKVTKEYTTIVGGAGDP----SEIKKR
CH60_CALS4       LT---GGQ-VISEELGYDLKDVT-LDMLGRARQVKVTKEHTTIVGGAGNP----EDIKKR
CH60_HUNT2       LT---GGQ-VITSDLGLELKDTT-VEQLGRARQVKVQKENTIIVDGAGDP----KEIQKR
CH601_NOSS1      LT---GGQ-LITEDAGLKLENTK-LESLGKARRITITKDSTTIVAEGND-VA----VKGR
CH60_SYNE7       LT---GGQ-LITEDAGLKLDTTK-LDQLGKARRITITKDNTTIVAEGNE-AA----VKAR
CH601_THEVL      LT---AGQ-VIAEDAGLKLENAK-LDMLGKARRITITKDHTTIVAEGNE-KA----VKAR
CH601_SYNY3      LT---GGQ-VISEDAGLKLESAT-VDSLGSARRINITKDNTTIVAEGNE-AA----VKSR
CH60_CYAPA       LT---NTQ-VISEQTGLRLDSIK-LDVLGKARQVNITKDYTTVIAEGNE-EG----VSAR
CH60_GUITH       LT---GGQ-VISEDAGFSLETLT-LDMLGQARRITITKENTTIIAEGNE-KD----VKSR
CH60_PORPU       LT---GGQ-VITEDAGFSLDTVQ-LDMLGKARRVVVTKDSTTIIADGHE-AT----VKSR
CH60_GALSU       LT---GGQ-LITEDAGLSLDKVD-LSMLGQANKVIVNKESTTIISNANE-NN----VKAR
CH60_TRICV       LT---GGT-VITQDAGLSLENIQ-VNLLGQARRIIVNKDSTTIVGDGLEIEQ----IKAR
CH60_CYACA       LT---NGQ-VISEETGLNLETIT-LDVLGQARRATILRDSTTIVEDKNQ-QA----VHAR
CH602_NOSS1      LT---DGQ-LISEEIGLSLDTAS-LEALGTAQKITIEKDNTTIVAGNTTKPE----IQKR
CH602_SYNY3      LT---GGS-VISEDIGLSLDTVS-LDQLGQAVKATLEKDNTILVAGADKRASA--GVKER
CH602_THEEB      LT---GGQ-VISEEVGLTLEDVE-LTMLGEASSVTVTKDTTILVSEKGNKAD----IQKR
CH60_AGGAC       LT---AGT-VISEEIGMELEKAT-LEDLGQAKRIVINKDNTTIIDGIGDE----AQIQGR
CH60_PASMU       LT---AGT-VISEEIGMELEKAT-LEDLGQAKRVVINKDNTTIIDGIGDE----AQIQGR
CH60_HAEIN       LT---AGT-VISEEIGMELEKAT-LEDLGQAKRVVINKDNTTIIDGIGDE----AQIKGR
CH60_ACTPL       LT---AGT-VISEEIGMELEKAT-LEELGQAKRVVITKDNTTIIDGIGDE----AQIKAR
CH60_HAEDU       LT---AGT-VISEEIGMELEKAT-LEELGQAKRVVITKDNTTIIDGIGDE----AQIKAR
CH60_AERSA       LT---SGG-TVIEEVGMELEKAT-LEDLGRAKRIVITKENTTIIDGVGDA----ALIESR
CH601_VIBPA      LT---GGT-VISEEIGLELEKVT-LEDLGQAKRVSITKENSTIIDGAGEE----AMIQGR
CH601_VIBVU      LT---GGT-VISEEVGLELEKAT-LEDLGQAKRVSITKENTTIIDGVGEE----AMIQGR
CH601_VIBCH      LT---GGV-VISEEIGLELEKAT-LEDLGQAKRVSITKENSTIIDGAGDQ----AAIQGR
CH60_BUCAI       LT---GGS-VISEELAMELEKST-LEDLGQAKRVVISKDTTTIIGGVGEK----HSIQSR
CH60_BUCAP       LT---GGS-VISEELAMDLEKST-LEDLGQAKRVVINKDTTTIIGGSGEK----QAIQSR
CH60_BUCCM       LTFLYNSD-VISEELAMDLDKTT-LEDLGQAKGVVITKDHTIIVG-SGKK----EIFKQI
CH60_ECOLI       LT---GGT-VISEEIGMELEKAT-LEDLGQAKRVVINKDTTTIIDGVGEE----AAIQGR
CH60_SALTY       LT---GGT-VISEEIGMELEKAT-LEDLGQAKRVVINKDTTTIIDGVGEE----AAIQGR
CH60_STEMA       LT---GGT-VISEEIGMELEKAT-LEDLGQAKRVVINKDTTTIIDGVGEE----AAIQGR
CH60_KLEPN       LT---GGT-VISEEIGMELEKAT-LEDLGQAKRVVINKDTTTIIDGVGEE----SAIQGR
CH60_BUCTS       LT---GST-VISEEIGLELEKTT-IEDLGHAKRVVINKDTTTIIDGIGNE----SAIKGR
CH60_YERPE       LT---AGT-VISEEIGLELEKTT-LEDLGQAKRVVINKDTTIIIDGVGDE----AAIQGR
CH60_SODGL       LT---AGT-VISEEIGLELEKAT-LEDMGQAKRVVITKDTTTIIDGEGDK----ALIDSR
CH60_WIGBR       LT---SGT-VISEEMGLDLEKST-LEDMGQAKRVVITKDTTTIIDGTGNK----SMISSR
CH60_COLMA       LT---AGT-VISEEIGMELEKVT-LEDLGQAKRVVISKDTTIIIDGIGVE----ADIQAR
CH60_PSEHT       LT---GGT-VISEEIGLELEKAT-VEDLGTAKRVIITKDDTTIIDGAGEE----AGINGR
CH602_VIBCH      LT---AGR-VISEEIGLELEKVT-LDDLGSAKKVTINKDNTTIVDGAAEP----SALQDR
CH60_PSEAE       LT---GGT-VISEEVGLSLEGAT-LEHLGNAKRVVINKENTTIIDGAGVQ----ADIEAR
CH60_PSEPU       LT---GGQ-VISEEIGVSLETAT-LEHLGNAKRVILSKENTTIIDGAGAD----TEIEAR
CH60_OLEAN       LT---GGQ-VISEELGMSLETAD-PSSLGTASKVVIDKENTVIVDGAGTE----ASVNTR
CH60_LEGJE       LT---NGQ-VISEEIGTSLETAS-LESLGTAKRIVVTKENTTIIDGEGKA----TEINAR
CH60_TATMI       LT---AGE-VISEEVGTSLESAT-LDSLGTAKRVVVTKENTTIIDGEGKA----ADINAR
CH60_LEGPH       LT---KGQ-VISEEIGKSLEGAT-LEDLGSAKRIVVTKENTTIIDGEGKA----TEINAR
CH60_COXBU       LT---GGK-VISEEVGLSLEAAS-LDDLGSAKRVVVTKDDTTIIDGSGDA----GDIKNR
CH60_XANAC       LT---GGT-VISEEVGLALEKAT-IKDLGRAKKVQVSKENTTIIDGAGDS----AAIESR
CH60_XANCP       LT---GGT-VISEEVGLALEKAT-IKDLGRAKKVQVSKENTTIIDGAGDS----ATIEAR
CH60_XYLFA       LT---GGT-VISEEVGLSLEKAT-TSHLGKAKKVRVSKENTTIIDGIGDN----DAINGR
CH60_ALLVI       LT---GAT-VISEEVGLSLEKAT-LTDLGTAKRVQVGKDETTIIDGSGSE----IDIKAR
CH60_FRATH       LT---GAT-FVSEDLSMKLEETN-MEHLGTASRVQVTKDNTTIIDGAGEK----EAIAKR
CH601_BURPS      LT---GGQ-VIAEETGLTLEKAT-LAELGQAKRIEVGKENTTIIDGAGEA----VNIEAR
CH60_BURTH       LT---GGQ-VIAEETGLTLEKAT-LAELGQAKRIEVGKENTTIIDGAGEA----VNIEAR
CH60_BURCE       LT---GGQ-VIAEETGLTLEKAT-LAELGQAKRIEVGKENTTIIDGAGEA----ASIEAR
CH60_RALSO       LT---GGQ-VIAEEVGLTLEKAT-LNDLGQAKRVEIGKENTTIIDGAGDA----RNIEAR
CH60_BORPE       LT---GGT-VISEETGMSLEKAT-LQDLGQAKRIEVAKENTTIIDGAGDG----KSIEAR
CH60_NEIMA       LT---GGT-VISEEVGLSLEKAT-LDDLGQAKRIEIGKENTTIIDGFGDA----AQIEAR
CH60_NEIMB       LT---GGV-VISEEVGLSLEKAT-LDDLGQAKRIEIGKENTTIIDGFGDA----AQIEAR
CH60_TREPR       LT---GGH-VVSEETGLSLEKVS-LPELGQAKRAEVAKDTTTIIDGAGDA----KAINAR
CH60_METSS       LT---GAT-VISEETGKQLEKAS-LEDLGRAKRVELQKENTIIIDGAGEQ----KAIEAR
CH601_RHIME      LT---GGT-VISEDLGIKLESVT-LDMLGRAKKVSITKENTTIVDGAGQK----SDIEGR
CH604_RHIME      LT---GGT-VISEDLGIKLESVT-LDMLGRAKKVSITKENTTIVDGAGQK----SDIEGR
CH60_AGRFC       LT---GGT-VISEDLGIKLESVT-LDMLGKSKKVSISKENTTIVDGAGQK----SDIEGR
CH60_RHILV       LT---GGT-VISEDLGIKLESVT-LDMLGRAKKVSISKENTTIVDGSGAK----TDIEGR
CH60_BRUAB       LT---GGQ-VISEDLGIKLESVT-LDMLGRAKKVSISKENTTIVDGAGQK----AEIDAR
CH60_BRUME       LT---GGQ-VISEDLGIKLESVT-LDMLGRAKKVSISKENTTIVDGAGQK----AEIDAR
CH603_RHILO      LT---GGQ-VISEDLGIKLENVG-LDMLGRAKKVSISKENTTIVDGAGKK----EEIQGR
CH605_RHILO      LT---GGQ-VISEDLGIKLENVG-LNMLGRAKKVSISKENTTIVDGAGKK----AEIQGR
CH604_RHILO      LT---GGQ-VISEDLGIKLENVG-LNMLGRAKKVSISKENTTIVDGAGKK----AEIQGR
CH60_BARHE       LT---SGQ-VISEDVGIKLENVT-LDMLGRAKKVNISKENTTIIDGAGQK----SEINAR
CH60_BARQU       LT---SGQ-VISEDVGIKLENVT-LDMLGRAKKVNISKENTTIIDGAGKK----AEINAR
CH60_BARBA       LT---SGQ-VISEDVGIKLENVT-LEMLGRAKKVHVSKETTTIVDGAGQK----SEINAR
CH602_BRADU      LT---GGQ-AISEDLGIKLENVT-LNMLGRAKKVMIDKENTTIVSGAGKK----ADIEAR
CH603_BRADU      LT---GGQ-AISEDLGIKLENVT-LNMLGRAKKVMIDKENTTIVNGAGKK----ADIEAR
CH601_BRADU      LT---GGQ-AISEDLGIKLENVT-LKMLGRAKKVVIDKENTTIVNGAGSK----KDIEAR
CH602_RHIME      LT---GGT-VISEELGIKLENTT-MDTLGRAKRIMVDKETTTIVDGAGSK----EDIGGR
CH605_RHIME      LT---GGT-VVSEDLGIKLESVT-LDMLGRAKKVSIEKENTTIIDGAGSK----ADIEGR
CH602_RHILO      LT---GGT-AISEDLGIKLENVT-LEMLGRAKKVVIEKENTTIVDGAGSK----DEIQGR
CH601_RHILO      LT---AGQ-MISEDLGIKLENVT-IEMLGRAKRVLIEKDTTTIIDGAGTK----ATIQAR
CH603_RHIME      LT---AGQ-MISEDLGIKLENVT-LDMLGRARRVLIEKDTTTIIDGSGDK----ASIQAR
CH60_CAUVC       LT---GAQ-VVSEDIGIKLENVS-LEMLGRAKKVSITKDDTTIVDGVGEK----ADIEAR
CH60_RHOPL       LT---GGQ-VISEDLGMKLENVT-IDMLGRAKKVSINKDNTTIVDGAGEK----AEIEAR
CH601_RHOSH      LT---GGQ-VISEDLGMKLENVT-IDMLGRAKKISINKDNTTIVDGNGDK----AEIDAR
CH60_PARDE       LT---GGQ-VISEDLGMKLENVT-IDMLGRAKKVSINKDNTTIVDGAGEK----AEIEAR
CH60_RHOCA       LT---GGQ-VISDDLGMKLENVT-LDMLGRAKKVTISKENTTIVDGHGDK----AEINAR
CH602_RHOSH      LT---GAH-LISAELGTKLETVT-LDMLGFAKKVVLTKDSTILIDSAGDK----AAIASR
CH60_EHRRW       LT---GAKHVINDELAIKMEDLT-LCDLGTAKNIRITKDTTTIIGSVDNS---CAHVQSR
CH60_EHRCH       LT---GAKHVISDDLAIKMEDLT-LAELGTAKNIRITKDTTTIIGSVDNS---SANVQSR
CH60_ORITS       LT---NGE-VITEQLGIKLEKVNDTSKLGTANRVIVTKDHTTIVHDKNNSDI-EKKVNSR
CH60_RICCN       LT---KGE-LITEDLGMKLENVS-IKSLGTAKRVTISKENTVIVDGNGDK----KNIEDR
CH60_RICPR       LT---KGE-LITEDLGMKLENVN-IKNLGTAKRVTISKENTVIVDGNGDK----KNIEDR
CH60_CAMJE       LT---GGE-VISEELGRTLESAT-IQDLGQASSVIIDKDNTTIVNGAGEK----ANIDAR
CH60_CAMRE       LT---GGE-VVSEELGRTLESAT-LSDLGQASSVIIDKDNTTIVNGAGEK----SAIDAR
CH60_HELPY       LT---GGQ-VISEELGLSLENAE-VEFLGKAGRIVIDKDNTTIVDGKGHS----HDVKDR
CH60_HELPJ       LT---GGQ-VISEELGLSLENAE-VEFLGKAGRIVIDKDNTTIVDGKGHS----DDVKDR
CH60_CHLMU       LT---GGQ-LISEELGMKLENAS-LAMLGKAKKVIVSKEDTTIVEGMGEK----EALDAR
CH60_CHLTR       LT---GGQ-LISEELGMKLENAN-LAMLGKAKKVIVSKEDTTIVEGMGEK----EALEAR
CH60_CHLPN       LT---GGQ-LVSEELGMKLENTT-LAMLGKAKKVIVTKEDTTIVEGLGNK----PDIQAR
CH601_CHLCV      LT---GGQ-LISEELGMKLENTT-LAMLGKAKKVIVSKEDTTIVEGLGSK----EDIESR
CH60_AQUAE       LT---GGQ-AITEDLGIKLESVT-LDMLGQAEKVVVDKEHTTIIGGKGDP----EQIKAR
CH60_TANFO       LT---GGT-VITEEKGMKLEDAK-MDMLGSADKVTVNKDNTTIVKGNGDK----AAIESR
CH60_CHLTE       LT---GGT-VISEEKGYKLENAT-MAYLGQAARITIDKDNTTIVEGKGKQ----EEIKAR
CH60_RHOMR       LT---GGT-VISEEKGYRLENAT-LDYLGQAERIIVDKDNTTIVGGKGDP----AQIKAR
CH60_BORBU       LT---GGV-LISEELGLTLETVE-IEQLGQAKTIKVDKDNTTIIN-TGNK----EQIKER
CH60_TREPA       LS---GGQ-VISEDLGLKLESAD-IALLGQAKSVKVDKENTTIIDGSGKS----KDIKDR
CH60_LEPIN       LT---GGQ-VISEDLGMKLENTT-LQMLGRANKVTVDKENTTIIEGKGQT----KEIQGR
CH60_DEIRA       VT---GGE-VVSEDLGHKLENVG-MEMLGRAARIRITKDETTIVDGKGEQ----AQIDAR
CH60_THET8       VT---GGT-VISEELGFKLENAT-LSMLGRAERVRITKDETTIVGGKGKK----EDIEAR
CH60_THEMA       LT---GGQ-VASEELGINLEDLT-LEDLGRADLVRVKKDETIIIGGKGDP----EAIKKR
CH60_THENE       LT---GGQ-VASEELGINLEDLT-LEDLGRADLVRVKKDETIIIGGKGDP----EAIKKR
CH601_MYCLE      VT---GGQ-VVNPETGLVLREVG-TDVLGSARRVVVSKDDTIIVDGGGSN----DAVAKR
CH601_MYCTU      VT---GGQ-VVNPDAGMVLREVG-LEVLGSARRVVVSKDDTVIVDGGGTA----EAVANR
CH601_CORGL      VT---KAT-VVDPEVGINLNEAG-EEVFGTARRITVSKDETIIVDGAGSA----EDVEAR
CH601_STRCO      LT---GAT-VISEEVGLKLDQVG-LEVLGTARRITVTKDDTTIVDGAGKR----DEVQGR
CH601_STRLI      LT---GAT-VISEEVGLKLDQVG-LEVLGTARRITVTKDDTTIVDGPGKR----DEVQAR
CH601_STRAL      LT---GAT-VIAEEVGLKLDQAG-LDVLGTARRVTVTKDDTTIVDGGGNA----EDVQGR
CH602_MYCLE      LT---GAQ-VISEEVGLTLENTD-LSLLGKARKVVMTKDETTIVEGAGDT----DAIAGR
CH602_MYCTU      LT---GGQ-VISEEVGLTLENAD-LSLLGKARKVVVTKDETTIVEGAGDT----DAIAGR
CH602_MYCPA      LT---GGQ-VISEEVGLSLESAD-ISLLGKARKVVVTKDETTIVEGAGDS----DAIAGR
CH602_STRAL      LT---GGT-VISEEVGLKLENAG-LDLLGRARKVVITKDETTIVDGAGDT----DQVNGR
CH602_STRCO      LT---GGE-VISEEVGLKLENAT-LDLLGSARKVVITKDETTIVDGAGSA----DQVQGR
CH601_CUTAK      LT---GGQ-VISEEVGLSLDAVT-LDLLGRARQVVVTKDEATIVDGAGDS----EQIAGR
CH60_TROWT       LT---GGQ-VISEEVGLKLENAT-LDLLGRARKVVVSKDETTIVDGAGSS----DQIAGR
CH60_FUSNN       LT---GGE-VISEEKGMKLEEAT-IEQLGKAKTVKVTKDLTVIVDGGGQQ----KDISAR
CH60_MYCGE       SS----GTLAYNNEINSGFKDVT-VDNLGDARKVQIAKEKTTVIGGKGNK----DKIKKH
CH60_MYCPN       ST----GTLAYNNELGGGFKDVT-VNHLGEARRVQVAKEKTTVIGGKGSK----ETIQKH
                  :           :    :        :* :    : :  : ::            .   

CH60_BACHD       VNQIKAQIEETTSDFDKEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALNSTRA
CH60_BACSU       VTQIRAQVEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRA
CH60_GEOSE       INQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRA
CH60_PARTM       INQIRAQLEETTSEFDRGKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRA
CH60_BACP3       INQIRAQLKETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRA
CH60_LISIN       VNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRA
CH60_LISMO       VNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRA
CH60_STAAM       VSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRA
CH60_STAES       VGQIKAQIEETDSEFDKEKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRA
CH60_BRECH       VAQIRQQIEDTTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALNSTRA
CH60_STRAG       VAIIKSQMEATTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRA
CH60_STRP1       IALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRA
CH60_STRAP       VAVIKSQIESSTSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRA
CH60_STRCV       VAVIKSQIESATSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRA
CH60_STRSA       VAVIKSQIESSTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRA
CH60_STRPN       VAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRA
CH60_LACLA       VAIIKAQIEKTTSDFDREKLQERLAKLAGGVAVVKVGAATETELKAMKLLIEDALNATRA
CH60_ENTFA       VHLIKNQIGETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRA
CH60_LACAC       EDSIRKQIEESTSDFDKKKLQERLAKLTGGVAVIHVGAATETELKERRYRIEDALNSTRA
CH60_LACHE       VDTIRKQIEDSTSDFDKKKLQERLAKLTGGVAVIHVGAATETELKERRYRIEDALNSTRA
CH60_LACZE       VNIIKKQIDDTTSDFDREKLQERLAKLAGGVAVVKVGAATETELKERKYRIEDALNATRA
CH60_CLOAB       VAQIRGQIEETTSDFDREKLQERLAKLAGGVAVVKVGAASETELKERKMRIEDALAATKA
CH60_CLOPE       VNQIKLQLEATTSEFDKEKLQERLAKLAGGVAVVKVGAATETELKESKLRIEDALAATKA
CH60_CLOBO       IGQIKRQIEETTSEFDKEKLQERLAKIAGGVAVVKVGAATETELKERKLRIEDALAATKA
CH60_CLODI       VTQIKHQVEQTTSDFDREKLMERLAKLAGGVAVVKVGAATEVELKERKLRIEDALNATRA
CH60_THEBR       VNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKA
CH60_CALS4       INQIKAQIEETTSDYDREKLQERLAKLAGGVAVIQVGAATETELKEKKHRIEDALAATKA
CH60_HUNT2       IASIKSQIEETTSDFDREKLQERLAKLAGGVAVIQVGAATETEMKEKKLRIEDALAATKA
CH601_NOSS1      VEQIRRQMEETESSYDKEKLQERLAKLSGGVAVVKVGAATETEMKDKKLRLEDAINATKA
CH60_SYNE7       VDQIRRQIEETESSYDKEKLQERLAKLSGGVAVVKVGAATETEMKDRKLRLEDAINATKA
CH601_THEVL      CEQIRRQIEETDSSYDKEKLQERLAKLAGGVAVIKVGAATETEMKDRKLRLEDAINATKA
CH601_SYNY3      CEQIRRQIEETDSSYDKEKLQERLAKLAGGVAVIKVGAATETEMKDRKLRLEDAINATKA
CH60_CYAPA       CEQIRRQIEETDSAYEKEKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAINATKA
CH60_GUITH       CEQIRRQIEASDSSYEREKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAINATKA
CH60_PORPU       CEQIKRQIETSDSLYEREKLQERLAKLSGGVAVIKVGAATETEMKDKKLRLEDAINATKA
CH60_GALSU       CEQIRKQIEITDSSYEKEKLQERLAKLAGGIAVIKVGAATETEMKDKKLRLEDAINATKA
CH60_TRICV       CEQLRKQVNIADTGYEKEKLQDRIAKLSGGIAVIRVGAVTETEMKDKKLRLEDAINATRA
CH60_CYACA       CEQLKNQLLIAKSSYEKEKLQERLAKLIGGVAVIKVGAATETEMKEKKLRLEDSINATKA
CH602_NOSS1      IAQIRRQLEETDSEYDSEKLQERIAKLAGGIAVIKVGAATETELKDRKLRIEDALNATKA
CH602_SYNY3      IEQLRKEYAASDSDYDKEKIQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKA
CH602_THEEB      VEQLKQQLAETDSEYDKEKLQERIAKLVGGVAVIKVGAATETELKDRKLRLEDALNATKA
CH60_AGGAC       VAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_PASMU       VAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_HAEIN       VAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRA
CH60_ACTPL       VAQIRQQIEDSTSDYDKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRA
CH60_HAEDU       VVQIRQQIEDSTSDYDKEKLQERVAKLAGGVAVIKVGAATEVAMKEKKDRVDDALHATRA
CH60_AERSA       VAQIRQQIEETSSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALHATRA
CH601_VIBPA      VAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRA
CH601_VIBVU      VAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRA
CH601_VIBCH      VAQIRQQIEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRA
CH60_BUCAI       ISQIRQEIQEATSDYDKEKLNERLAKLSGGVAVLKVGAATEVEMKEKKARVEDALHATRA
CH60_BUCAP       IGQIRQEIQEATSDYDKEKLNERLAKLSGGVAVLKVGAATEVEMKEKKARVEDALHATRA
CH60_BUCCM       L--IRQQLIESTSDYDKEKLNERLAKLSGGVAVLKVGAATEVEMKEKKARVEDALHATRA
CH60_ECOLI       VAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_SALTY       VAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_STEMA       VAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_KLEPN       VAQIRKQIEEATSDYDREKLQERVAKVAGGVAVIKVGAATEVEMKEKKARVDDALHATRA
CH60_BUCTS       VVQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_YERPE       VAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_SODGL       VTQINQQRDEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_WIGBR       VSQINQERDEATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_COLMA       VSQIRGQIEDSSSDYDKEKLQERLAKLAGGVAVIKIGAATEMEMKEKKSRVEDALHATRA
CH60_PSEHT       VSQIKAQIEEATSDYDKEKLQERMAKLAGGVAVIKVGAATEMEMKEKKDRVEDALNATRA
CH602_VIBCH      IAQIQHQLEHTTSQYDRDKLQQRIAKLSGGVAVIKIGAATEVEMKEKKDRVDDALHATRA
CH60_PSEAE       VLQIRKQIEETTSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_PSEPU       VKQIRAQIEETSSDYDREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRA
CH60_OLEAN       VDQIRAEIESSTSDYDIEKLQERVAKLAGGVAVIKVGAGSEMEMKEKKDRVDDALHATRA
CH60_LEGJE       IAQIRAQMEETSSDYDREKLQERVAKLAGGVAVIKVGAATEIEMKEKKARVEDALHATRA
CH60_TATMI       ITQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKLVLLPNRMK--RKARVEDALHATRA
CH60_LEGPH       ITQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_COXBU       VEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_XANAC       VGQIKTQIEDTSSDYDREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRA
CH60_XANCP       VGQIKTQIEDTSSDYDREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDALHATRA
CH60_XYLFA       VKQIKTQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALLATRA
CH60_ALLVI       CEQIRAQVEETSSDYDREKLQERLAKLAGGVAVIKVGAATEIEMKEKKARVEDALHATRA
CH60_FRATH       INVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRA
CH601_BURPS      VKQIRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_BURTH       VKQIRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_BURCE       VKQVRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_RALSO       VKQVRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRA
CH60_BORPE       VKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRA
CH60_NEIMA       VAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRA
CH60_NEIMB       VAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRA
CH60_TREPR       IKHIRLQIEEAASDYDKEKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRA
CH60_METSS       VKAIQAQIDESTSDYDREKLQERVAKLSGGVAVIKVGAATEVEMKEKKDRVDDALHATRA
CH601_RHIME      VAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRA
CH604_RHIME      VAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRIDDALNATRA
CH60_AGRFC       VAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRA
CH60_RHILV       VAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRA
CH60_BRUAB       VGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH60_BRUME       VGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH603_RHILO      VAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH605_RHILO      VAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH604_RHILO      VAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH60_BARHE       VNQIKVQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH60_BARQU       VNQIKVQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRA
CH60_BARBA       VSQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRA
CH602_BRADU      VAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRA
CH603_BRADU      VAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRA
CH601_BRADU      VTQIKMQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRA
CH602_RHIME      VAQIKAQIEDTTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRA
CH605_RHIME      TAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRA
CH602_RHILO      VSQIKSQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRA
CH601_RHILO      VAQIKGQIEETTSDYDKEKLQERLAKLSGGVAVIRVGGVTESEVKEKKDRIDDALNATRA
CH603_RHIME      VSQIKAQIEETASDYDKEKLQERLAKLAGGVAVIRVGGATELEVKEKKDRIDDALNATRA
CH60_CAUVC       IAQIKRQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRA
CH60_RHOPL       VSQIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRA
CH601_RHOSH      VAQIRNQIEETSSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRA
CH60_PARDE       VSQIRQQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEIEVKERKDRVDDALNATRA
CH60_RHOCA       VAHIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRA
CH602_RHOSH      IGQIRNQIEDTTSAYNKEKLQERLARLAGGVAVIRVGGATEIEVKERRDRVEDTLNATRA
CH60_EHRRW       ICQIRMQIDNSTSDYDKEKLQERLAKLSGGVAVLKVGGSSEVEVKERKDRVEDALHATRA
CH60_EHRCH       INQIKMQIEASTSDYDKEKLRERLAKLSGGVAVLKVGGSSEVEVKERKDRVEDALHATRA
CH60_ORITS       CEQIREAIKDTTSDYEKEKLQERLAKLRNGVAVLKVGGATEVEQKERKDRVEDALHATRA
CH60_RICCN       VLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRA
CH60_RICPR       VLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRA
CH60_CAMJE       VNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKA
CH60_CAMRE       IIQIKAQIAETTSDYDKEKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKA
CH60_HELPY       VAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKA
CH60_HELPJ       VAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKA
CH60_CHLMU       CESIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATIA
CH60_CHLTR       CESIKKQIEDSSSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATIA
CH60_CHLPN       CDNIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATIA
CH601_CHLCV      CESIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATLA
CH60_AQUAE       IEQIKRQIQETTSDYDREKLQERLAKLSGGVAIIRVGAATEAELKEKKYRVEDAVHATKA
CH60_TANFO       IGQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAPSEVEMKEKKDRVDDALHATRA
CH60_CHLTE       INEIKGQIEKSTSDYDTEKLQERLAKLSGGVAVLKIGASTEVEMKEKKARVEDALHATRA
CH60_RHOMR       ANQIRQQIEETTSDYDREKLQERLAKLAGGVAVLKIGAATEPEMKEKKARVEDALHATRA
CH60_BORBU       SELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRA
CH60_TREPA       IEQIKKQIEASTSDYDSEKLKERLAKLSGGVAVIKIGAVTEVEMKEKKHRVEDALNATRA
CH60_LEPIN       IGQIKKQIEDTTSEYDREKLQERLAKLAGGVAVIHVGAATEVEMKEKKARVEDALSATRA
CH60_DEIRA       VNAIKGELDSTDSDYAREKLQERLAKLSGGVAVIRVGAATETELKEKKHRYEDALSTARS
CH60_THET8       INGIKKELETTDSEYAREKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRA
CH60_THEMA       IAQIKAQIEETTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRA
CH60_THENE       IAQIKAQIEETTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRA
CH601_MYCLE      VNQLRAEIEVSDSEWDREKLQERVAKLAGGVAVIKVGAVTETALKKRKESVEDAVAAAKA
CH601_MYCTU      AKHLRAEIDKSDSDWDREKLGERLAKLAGGVAVIKVGAATETALKERKESVEDAVAAAKA
CH601_CORGL      RGQIRREIANTDSTWDREKAEERLAKLSGGIAVIRVGAATETEVNDRKLRVEDAINAARA
CH601_STRCO      IAQIKAEIENTDSDWDREKLQERLAKLAGGVCVIKVGAATEVELKERKHRLEDAISATRA
CH601_STRLI      IAQIKAEIENTDSDWDREKLQERLAKLAGGVCVIKVGAATEVELKERKHRLEDAISATRA
CH601_STRAL      VAQIKAEIESTDSDWDREKLQERLAKLAGGVCVIRVGAATEVELKERKHRLEDAISATRA
CH602_MYCLE      VAQIRTEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKA
CH602_MYCTU      VAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKA
CH602_MYCPA      VAQIRTEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKA
CH602_STRAL      VAQIRAEIENSDSDYDREKLQERLANVAGGVAVIKAGAATEVELKERKHRIEDAVRNAKA
CH602_STRCO      VNQIRAEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKA
CH601_CUTAK      VSQIRKEIENSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKERKHRIEDAVRNAKA
CH60_TROWT       VSQIRKELENSDSDYDREKLQERLAKLSGGVAVIRSGAATEVELKERKHRIEDAVRNAKA
CH60_FUSNN       VNSIKAQIAETTSDYDKEKLQERLAKLSGGVAVIKVGAATEVEMKDKKLRIEDALNATRA
CH60_MYCGE       VELLNGRLKQTTDKYDSDLIKERIAYLSQGVAVIRVGGATELAQKELKLRIEDALNSTKA
CH60_MYCPN       LDLLNGRLKQTTEKYDTDLLKERIAHLSQGVAVVRVGGATELAQKELKLRIEDALNSTKA
                    :.     :   :      :*:* :  *:.::     .:      :   :*:   : :

CH60_BACHD       AVEEGIVAGGGTALVNVIKAVSSI---------GAE--G-DEATGVNIVLRALEEPVRQI
CH60_BACSU       AVEEGIVSGGGTALVNVYNKVAAV---------EAE--G-DAQTGINIVLRALEEPIRQI
CH60_GEOSE       AVEEGIVAGGGTALMNVYSKVAAI---------EAE--G-DEATGVKIVLRAIEEPVRQI
CH60_PARTM       AVEEGIVAGGGTALMNVYNKVAAI---------EAE--G-DEATGVKIVLRAIEEPVRQI
CH60_BACP3       AVEEGIGAGGGTALMNIHNKVAAI---------EAE--G-DEATGVKIVLRAIEEPVRQI
CH60_LISIN       AVEEGIVAGGGTALVSIYNKVAAL---------EAE--G-DVETGINIVLRSLEEPVRQI
CH60_LISMO       AVEEGIVAGGGTALVSIYNKVAAL---------EAE--G-DVETGINIVLRSLEEPVRQI
CH60_STAAM       AVEEGIVAGGGTALVNVYQKVSEI---------EAE--G-DIETGVNIVLKALTAPVRQI
CH60_STAES       AVEEGIVAGGGTALVNIYQKVSEI---------KAE--G-DVETGVNIVLKALQAPVRQI
CH60_BRECH       AVEEGIVPGGGTTLINAIKAVEGV---------KVE--G-EEAVGVHIVLRSLEEPVRQI
CH60_STRAG       AVEEGIVSGGGTALVNVIEKVAAL---------KLN--G-DEETGRNIVLRALEEPVRQI
CH60_STRP1       AVEEGIVAGGGTALITVIEKVAAL---------ELE--G-DDATGRNIVLRALEEPVRQI
CH60_STRAP       AVEEGIVSGGGTAFVNVLSAVEAL---------DLS--G-DEATGRNIVLRALEEPVRQI
CH60_STRCV       AVEEGIVSGGGTAFVNVLNTVEAL---------DLS--G-DEATGRNIVLRALEEPIRQI
CH60_STRSA       AVEEGIVSGGGTAYINVLDAVAGL---------ELA--G-DEGTGRNIVLRALEEPVRQI
CH60_STRPN       AVEEGIVAGGGTALANVIPAVATL---------ELT--G-DEATGRNIVLRALEEPVRQI
CH60_LACLA       AVEEGIVSGGGTALVNAIAALDKL---------SEE--G-DIQTGINIVRRALEEPVRQI
CH60_ENTFA       AVEEGMVSGGGTALVNVIGKVAAL---------EAE--G-DVATGIKIVVRALEEPIRQI
CH60_LACAC       AVDEGYVAGGGTALVDVEKAIKDL---------KGE--TSDEQTGINIVLRALSAPVRQI
CH60_LACHE       AVDEGYVAGGGTALVNVEKAVREV---------KGE--TTDEQTGINIVLRALSAPVRQI
CH60_LACZE       AVEEGYVAGGGTALVDVLPAVAAL---------KEE--G-DVQTGINIVLRALEEPVRQI
CH60_CLOAB       AVEEGIIAGGGTAYINVLPEVREL---------TSD--EPDVQVGINIIVKALEEPVRQI
CH60_CLOPE       AVEEGIVPGGGTAYVNVINEVAKL---------TSD--IQDEQVGINIIVRSLEEPMRQI
CH60_CLOBO       AVEEGIVAGGGTAYLRAIKEVEKL---------TDN--NSEIRLGIAIIRRALEEPVRQI
CH60_CLODI       AVEEGIVAGGGTAFVSVIPAIGTL---------IESL-EGEVKLGAQIVKKALEEPLRQI
CH60_THEBR       AVEEGIVPGGGIALLNVIEDVQKV---------VDSL-EGDFKTGAKIVLRALEEPVRQI
CH60_CALS4       AVEEGIVPGGGVALLNVIEDVQKV---------VDSL-EGDFKTGAKIVLKALEAPVRQI
CH60_HUNT2       AVEEGIVAGGGTALVNVIPKVAKV---------LDTV-SGDEKTGVQIILRALEEPVRQI
CH601_NOSS1      AVEEGIVPGGGTTLAHLTPELEVW---------ANSNLKDEELTGALIVARALPAPLKRI
CH60_SYNE7       AVEEGIVPGGGTTLAHLAPQLEEW---------ATANLSGEELTGAQIVARALTAPLKRI
CH601_THEVL      AVEEGIVPGGGTTLVHLAPELSNW---------AAEHLTGEELIGANIVERALSAPLRRI
CH601_SYNY3      AVEEGIVPGGGTTLAHLAPQLEDW---------ATGNLKDEELTGALIVARALPAPLKRI
CH60_CYAPA       AVEEGIVPGGGTTLAHLAIELENW---------VQSNLEHEELIGGMIVARSLTAPLKRI
CH60_GUITH       AVEEGIVPGGGSTLTHLANDLKDW---------AEDNLIEDELIGALIVERSLTSPLRRI
CH60_PORPU       AIEEGIVPGGGSTNVHISGELFVW---------AKNNLFEDELIGALIVQRALTYPLRRI
CH60_GALSU       AIEEGIVPGGGATLVHLANDLFNW---------AKGVLKEDELIGALIVEKSITAPLKRI
CH60_TRICV       AVEEGIVPGGGATLAHLAENLLTW---------AKINLKEDELIGAMIISRAIVAPLKRI
CH60_CYACA       AIEEGIVPGGGTALVHISANLKQW---------AKINLSSDELLGANIVEQASLAPLHKI
CH602_NOSS1      AVAEGIVPGGGKTLIYLASKVDEI---------KKNFD-EEEKIGADIVKRALEAPLRQI
CH602_SYNY3      AVEEGIVPGGGTTLIRLAGKIESF---------KAQLSNDEERVAADIIAKALEAPLHQL
CH602_THEEB      AVAEGIVPGGGVTLLHLASRIDAL---------LPSLS-PEEQTGARIVASALAAPVAQI
CH60_AGGAC       AVEEGIVAGGGVALIRAAGRVVG----------LQ-GENEEQNVGIKLALRAMEAPLRQI
CH60_PASMU       AVEEGIVAGGGVALIRAASKVAG----------LQ-GDNEEQNVGIKLALRAMEAPLRQI
CH60_HAEIN       AVEEGIVAGGGVALVRAAAKVAAS---------LK-GDNEEQNVGIKLALRAMEAPLRQI
CH60_ACTPL       AVEEGIVPGGGVALVRAASKVATT---------LT-GDNEEQNVGIKLALRAMEAPLRQI
CH60_HAEDU       AVEEGIVPGGGVALVRAANKVSAT---------LT-GDNEEQNVGIKLALRAMEAPLRQI
CH60_AERSA       AVEEGVVAGGGVALVRVAAKLAG----------LR-GDNEDQNVGIKVALRAMEAPLRQI
CH601_VIBPA      AVEEGVVAGGGVALIRAASKIVD----------LE-GDNEEQNVGIRVALRAMEAPIRQI
CH601_VIBVU      AVEEGIVAGGGVALIRAASKIVD----------LQ-GDNEEQNVGIRVALRAMEAPLRQI
CH601_VIBCH      AVEEGVVAGGGVALIRAASKLSS----------LV-GDNEEQNVGIRVALRAMEAPLRQI
CH60_BUCAI       AVEEGVVAGGGVALVRVAGKIAD----------LR-GQNEDQNVGIRVALRAMEAPLRQI
CH60_BUCAP       AVEEGVVAGGGVALVRVAGKISN----------LR-GHNEDQNVGIRVALRAMEAPLRQI
CH60_BUCCM       AVEEGVVAGGGVALVRVAEKISR----------LK-GQNEDQNVGIRVAVRSMEAPLRQI
CH60_ECOLI       AVEEGVVAGGGVALIRVASKLAD----------LR-GQNEDQNVGIKVALRAMEAPLRQI
CH60_SALTY       AVEEGVVAGGGVALIRVASKIAD----------LK-GQNEDQNVGIKVALRAMEAPLRQI
CH60_STEMA       AVEEGVVAGGGVALIRVASKLAD----------LR-GQNEDQNVGIKVALRAMEAPLRQI
CH60_KLEPN       AVEEGVVAGGGVALVRVAAKLAG----------LT-GQNEDQNVGIKVALRAMEAPLRQI
CH60_BUCTS       AVEEGVVAGGGVALIRVAGKISS----------LT-GENEDQNVGIKVAIRAMESPLRQI
CH60_YERPE       AVEEGVVAGGGVALIRAAHAIAG----------LK-GDNEDQNVGIKVALRAMESPLRQI
CH60_SODGL       AVEEGVVAGGGVALIRVANRIAE----------LR-GDNEDQNVGIKVARRAMEAPLRQI
CH60_WIGBR       AVEEGVVAGGGVALIRVANRIVN----------LR-GENEDQNVGIRVARRAMEAPLRQI
CH60_COLMA       AVEEGVVAGGGVALIRAADAIKD----------LE-GANEDQTHGINVAIRAMEAPLRQI
CH60_PSEHT       AVEEGVVPGGGVALVRAASKLVD----------LV-GDNEDQNHGIKVALRAMEAPLRQI
CH602_VIBCH      AVEEGIVAGGGVALLKIANELSN----------LQ-GDNDDQNVGIRIALRAMEEPLRQI
CH60_PSEAE       AVEEGVVPGGGVALVRALQAIEG----------LK-GDNEEQNVGIALLRRAVESPLRQI
CH60_PSEPU       AVEEGVVPGGGVALVRALNAIVD----------LK-GDNEDQNVGIALLRRAVESPLRQI
CH60_OLEAN       AVEEGVVAGGGVALIRALSSVTV----------V--GDNEDQNVGIALALRAMEAPIRQI
CH60_LEGJE       AVEEGIVAGGGVALIRAQKVLDG----------LK-GDNADQDMGINILRRAIESPLRQI
CH60_TATMI       AVEEGIVAGGGVALIRAQKALDG----------LK-GENADQDMGINILRRAIESPLRQI
CH60_LEGPH       AVEEGIVAGGGVALIRAQKALDS----------LK-GDNDDQNMGINILRRAIESPMRQI
CH60_COXBU       AVEEGVVPGGGVALIRVLKSLDS----------VE-VENEDQRVGVEIARRAMAYPLSQI
CH60_XANAC       AVEEGVVPGGGVALVRALVAVGD----------LK-GANEDQTHGIQIALRAMEAPLREI
CH60_XANCP       AVEEGVVPGGGVALVRALVAVGN----------LT-GANEDQTHGIQIALRAMEAPLREI
CH60_XYLFA       AVEEGVIPGGGVALIRAITAISN----------LK-GANEDQTHGIQIALRAMEAPLREI
CH60_ALLVI       AVEEGIVPGGGVALVRAIAAVKD----------LK-GANHDQDVGIAIARRAMEEPLRQI
CH60_FRATH       AVEEGIVAGGGVALIRAQKALDG----------LT-GENDDQNHGIALLRKAIEAPLRQI
CH601_BURPS      AVEEGIVPGGGVALIRARTAIAG----------LT-GVNADQNAGIKIVLRAMEEPLRQI
CH60_BURTH       AVEEGIVPGGGVALIRARTAIAA----------LT-GVNADQNAGIKIVLRAMEEPLRQI
CH60_BURCE       AVEEGIVAGGGVALIRARTAIAG----------LT-GANADQNAGIKIVLRAMEEPLRQI
CH60_RALSO       AVEEGIVAGGGVALLRARALISG----------LK-GANADQDAGIKIVLRAMEEPLRQI
CH60_BORPE       AVEEGVVPGGGVALLRAKQAITG----------LK-GDTADQNAGIKLILRAVEEPLRTI
CH60_NEIMA       AVEEGVVAGGGVALLRARAALEN----------LH-TGNADQDAGVQIVLRAVESPLRQI
CH60_NEIMB       AVEEGVVAGGGVALLRARAALEN----------LH-TGNADQDAGVQIVLRAVESPLRQI
CH60_TREPR       AVEEGIVPGGGVALIRARNAISN----------LR-CDNPDQDAGIRIVLRAMEEPLRQI
CH60_METSS       AVEEGIVPGGGVALLRARSRIVN----------LK-GDNGDQDAGIRIVLRAIEAPLRAI
CH601_RHIME      AVQEGIVPGGGVALLRSSVKITV----------KG-E-NDDQDAGVNIVRRALQSPARQI
CH604_RHIME      AVQEGIVPGGGVALLRSSVKITV----------KG-E-NDDQDAGVNIVRRALQSPARQI
CH60_AGRFC       AVQEGIVPGGGVALLRSSTKITV----------KG-V-NDDQEAGINIVRKALQSLVRQI
CH60_RHILV       AVQEGIVPGGGIALARSSTKITV----------KG-A-NDDQEAGINIVRRALQSLVRQI
CH60_BRUAB       AVEEGIVAGGGTALLRASTKITA----------KG-V-NADQEAGINIVRRAIQAPARQI
CH60_BRUME       AVEEGIVAGGGTALLRASTKITA----------KG-V-NADQEAGINIVRRAIQAPARQI
CH603_RHILO      AVEEGIVPGGGVALLRASLSINA----------VG-A-NSDQTAGISIVRRALQAPARQI
CH605_RHILO      AVEEGIVPGGGVALLRASLSINA----------VG-A-NSDQTAGISIVRRALQAPARQI
CH604_RHILO      AVEEGIVAGGGVALLRASANIKA----------AG-A-NADQAAGINIVRRALQAPARQI
CH60_BARHE       AVEEGIVAGGGTALLRAANALTV----------KG-S-NPDQEAGINIVRRALQAPARQI
CH60_BARQU       AVEEGIVAGGGTALLRAANALAI----------KG-S-NPDQEAGINIVRRALQAPARQI
CH60_BARBA       AVEEGIVPGGGTPLLRAAKALSI----------KG-K-NPDQEAGIGIIRRALQAPARQI
CH602_BRADU      AVEEGILPGGGVALLRASEHLKG----------IR-TKNDDQKTGVEIVRKALSYPARQI
CH603_BRADU      AVEEGIVPGGGVALLRASEQLKG----------LR-TENDDQKTGVEIVRKALSWPARQI
CH601_BRADU      AVEEGILPGGGVALLRGLKALDA----------IK-TVNADQKAGVDIVRRAIQVPARQI
CH602_RHIME      AVEEGILPGGGVALLRVVSALNG----------LA-TANDDQRVGIEIVRRAIEAPVRQI
CH605_RHIME      AVEEGILPGGGVALLRAVKALDG----------LK-TANNDQRVGVDLVRRAIEAPVRQI
CH602_RHILO      AVEEGVLPGGGVALLRAAKALDS----------VQ-AENEDQKHGIEIVRRAIEAPVRQI
CH601_RHILO      AVEEGIVPGGGVALLRARSALSG----------LN-GANADVTAGISIVLRALEAPIRQI
CH603_RHIME      AVEEGIVPGGGVALLRAKSALVG----------LT-DDNADVTAGISIVRRALEAPIRQI
CH60_CAUVC       AADEGIVPGGGTALLKASKALAG----------VV-GDNDDQTAGIAIVRRALQAPIRQI
CH60_RHOPL       AVQEGIVVGGGVALIQAGKVLDG----------LT-GENPDQNAGITIVRRALEAPLRQI
CH601_RHOSH      AVQEGIVVGGGVALIQGGKALDG----------LT-GENPDQNAGITIVRRALEAPLRQI
CH60_PARDE       AVQEGIVVGGGVALVQGAKVLEG----------LS-GANSDQDAGIAIIRRALEAPMRQI
CH60_RHOCA       AVQEGIIVGGGVALVQAAKKLND----------LT-GANSDQDAGISIVRRALEAPLRQI
CH602_RHOSH      AVQEGVVPGGGAALIHAGKALAG----------LK-GDNPDQDAGIKIIRRAIQAPLRQI
CH60_EHRRW       AVEEGVVPGGGAALLYTLSALDN----------LK-SKNDDEQLGINIVKRALQAPIKRI
CH60_EHRCH       AVEEGVVPGGGAALLYTLSVLEN----------LK-SKNDDEQLGINIVKRALQAPIKRI
CH60_ORITS       AVEEGIVPGGGVALFYASRVLDS----------LK-FDNEDQRVGINIIKKVLEAPVRQI
CH60_RICCN       AVEEGVVAGGGVTLLHASQPLTK----------LK-VENKDQQAGIEIVIEALKDPLKQI
CH60_RICPR       AVEEGVVAGGGVTLLHASQTLTK----------LK-VENKDQQAGIEIVIEALKDPLKQI
CH60_CAMJE       AVEEGIVIGGGAALIKAKAKIKLD---------LQ-G---DEAIGAAIVERALRAPLRQI
CH60_CAMRE       AVEEGIVIGGGAAFIKAGAKVDLN---------LS-G---DEAIGADIVRRALTAPLRQI
CH60_HELPY       AVEEGIVIGGGAALIRAAQKVHLN---------LH-D---DEKVGYEIIMRAIKAPLAQI
CH60_HELPJ       AVEEGIVIGGGAALIRAAQKVHLN---------LH-D---DEKVGYEIIMRAIKAPLAQI
CH60_CHLMU       AVEEGILPGGGTALIRCIPTLEAF---------LPMLTNEDERIGARIVLKALSAPLKQI
CH60_CHLTR       AVEEGILPGGGTALIRCIPTLEAF---------LPMLTNEDEQIGARIVLKALSAPLKQI
CH60_CHLPN       AVEEGILPGGGTALVRCIPTLEAF---------LPMLANEDEAIGTRIILKALTAPLKQI
CH601_CHLCV      AVEEGILPGGGTALVRCIPTLEAF---------IPILTNEDEQIGARIVLKALSAPLKQI
CH60_AQUAE       AVEEGIVPGGGVALVRASEALEDL---------KG--DNHDQQLGIDIIKKAVRTPLKQI
CH60_TANFO       AIEEGTVPGGGVAYLRAIPALEGL---------KG--ENEDETTGIEIVKRAIEEPLRQI
CH60_CHLTE       AVQEGIVVGGGVALIRAAKGLAKA---------VA--DNEDQKTGIEIIRRALEEPLRQI
CH60_RHOMR       AVEEGIVPGGGVAYIRAIAALDKV---------EV--ENEDQKIGVQIVQRALEEPLRQI
CH60_BORBU       AVEEGVVPGGGSTLIEVAMYLDTI---------DTSKLSYEEKQGFEIVKRSLEEPMRQI
CH60_TREPA       AIEEGIVAGGGLALIQAAAALEKA---------DLSGLTPDEAVGFKIVRRALEEPIRQI
CH60_LEPIN       AVEEGIVPGGGLTLLKAQEAVGSL---------KLDG---DEATGAKIIFRALEEPIRMI
CH60_DEIRA       AVEEGIVAGGGTTLLRVIPAVRKA---------AESLTG-DEATGARILIRALEEPARQI
CH60_THET8       AVEEGIVPGGGVTLLRAISAVEEL---------IKKLEG-DEATGAKIVRRALEEPARQI
CH60_THEMA       AVEEGIVPGGGVTLLRARKAVEKV---------IEELEG-DEKIGAQIVYKALSAPIKQI
CH60_THENE       AVEEGIVPGGGVTLLRSRKAVEKL---------LEELDG-DEKIGAQIVYKALSAPIRQI
CH601_MYCLE      SIEEGIIAGGGSALV-QCGAALKQ---------LRTSLTGDEALGIDVFFEALKAPLYWI
CH601_MYCTU      AVEEGIVPGGGASLIHQARKALTE---------LRASLTGDEVLGVDVFSEALAAPLFWI
CH601_CORGL      AAQEGVIAGGGSALV-QIAETLKA---------YAEEFEGDQKVGVRALATALGKPAYWI
CH601_STRCO      AVEEGIVSGGGSALV--HAVKVLE---------GNLGKTGDEATGVAVVRRAAVEPLRWI
CH601_STRLI      AVEEGIVSGGGSALV--HAVKVLE---------GNLGKTGDEATGVAVVRRAAVEPLRWI
CH601_STRAL      AVEEGIVSGGGSALV--HAVKVLD---------DNLGRTGDEATGVAVVRRAAVEPLRWI
CH602_MYCLE      AVEEGIVAGGGVTLL--QA-APAL---------DKLKLTGDEATGANIVKVALEAPLKQI
CH602_MYCTU      AVEEGIVAGGGVTLL--QA-APTL---------DELKLEGDEATGANIVKVALEAPLKQI
CH602_MYCPA      AVEEGIVAGGGVALL--HA-IPAL---------DELKLEGEEATGANIVRVALEAPLKQI
CH602_STRAL      AVEEGIVAGGGVALL--QA-SSVF---------EKLELEGDEATGAAAVKLALEAPLKQI
CH602_STRCO      AVEEGIVAGGGVALL--QA-SQVF---------EKLELTGDEATGANAVKLALEAPLKQI
CH601_CUTAK      AVEEGIIPGGGVALL--QA-SKAA---------EIEGLEGDELTGAQIVLAACTAPLKQI
CH60_TROWT       AVEEGIVAGGGAALL--QSGTSAL---------KDLQLTSEEAVGRNIVRSAIEAPLRQI
CH60_FUSNN       AVEEGIVAGGGTILLDIIESMKDF---------NE---TDEIAMGIEIVKRALEAPIKQI
CH60_MYCGE       AVEEGIIAGGGVGLLNASCVLTNSKLKERYENETSVENIKEILLGFEIVQKSLEAPARQI
CH60_MYCPN       AVEEGIISGGGIALLNVSTILNDSKLADKYKAETSAENLKEILVGYEIVRKSLEAPVRQI
                 :  **   ***                             :   .              :

CH60_BACHD       AHNAGLE-GSVIVERLKKE-EAGF----GFNAATGEWV-NMVEAGIVDPTKVT----RSA
CH60_BACSU       AHNAGLE-GSVIVERLKNE-EIGV----GFNAATGEWV-NMIEKGIVDPTKVT----RSA
CH60_GEOSE       AQTAGLE-GSIIVERLKTE-KPGI----GFNAATGEWV-DMIEAGIVDPTKVT----RSA
CH60_PARTM       AQNAGLE-GSVIVERLKSE-KPGI----GFNAATGEWV-NMIEAGIVDPTKVT----RSA
CH60_BACP3       AQNAGLE-GSIIVERLKNE-KPGI----GFNAATGEWV-DMIEAGIVDPTKVT----RSA
CH60_LISIN       AHNAGLE-GSVIVERLKHE-AVGV----GFNAANGEWV-NMIDAGIVDPTKVT----RSA
CH60_LISMO       AHNAGLE-GSVIVERLKHE-AVGV----GFNAANGEWV-NMIDAGIVDPTKVT----RSA
CH60_STAAM       AENAGLE-GSVIVERLKNA-EPGV----GFNAATNEWV-NMLEAGIVDPTKVT----RSA
CH60_STAES       AENAGLE-GSIIVERLKHA-EAGV----GFNAATNEWV-NMLEEGIVDPTKVT----RSA
CH60_BRECH       AANAGLE-GSVIVERLKKE-PVGI----GFNAATEEYV-NMLEAGIVDAAKVT----RSA
CH60_STRAG       AYNAGYK-GSVIIARLKQS-EIGT----GFNAANGEWV-DMVTTGIIDPVKVT----RSA
CH60_STRP1       ALNAGYE-GSVVIDKLKNS-PAGT----GFNAATGEWV-DMIKTGIIDPVKVT----RSA
CH60_STRAP       ALNAGFE-GSIVIDRLKNS-EAGT----GFNAATGEWV-NMIDAGIIDPVKVT----RSA
CH60_STRCV       AINAGFE-GSIVIDRLKNS-EVGT----GFNAATGEWV-DMIEAGIIDPVKVT----RSA
CH60_STRSA       ALNAGFE-GSIVIDRLKNS-EVGT----GFNAATGEWV-NMIEAGIIDPVKVT----RSA
CH60_STRPN       AHNAGFE-GSIVIDRLKNA-ELGI----GFNAATGEWV-NMIDQGIIDPVKVS----RSA
CH60_LACLA       AANAGYE-GSVIIDKLRSE-EVGT----GFNAATGQWV-NMIEEGIVDPAKVT----RSA
CH60_ENTFA       AENAGYE-GSVIVDKLKNV-DLGI----GFNAANGEWV-NMVEAGIVDPTKVT----RSA
CH60_LACAC       AENAGKD-GAVVLNKLESQ-ENEI----GYNAATDKWE-NMVEAGIIDPTKVT----RTA
CH60_LACHE       AENAGKD-GSVILDKLEHQ-ENEI----GYNAATDKWE-NMVDAGIIDPTKVT----RTA
CH60_LACZE       AENAGKE-GSVIVEQLKKE-KQGV----GYNAATDEWE-DMAKSGIIDPTKVT----RSA
CH60_CLOAB       AANAGLE-GSVIIEKIINS-EKGI----GFDALHEKYV-DMLSVGIVDPTKVT----RSA
CH60_CLOPE       AHNAGLE-GSVIIEKVKNS-DAGV----GFDALRGEYK-DMIKAGIVDPTKVT----RSA
CH60_CLOBO       ASNAGLE-GSVIIDKIMNG-QEGM----GFDALEGEYV-NMVQKGIVDPAKVT----RSA
CH60_CLODI       AINAGLE-GAVIVQNVVNS-EAET----GFDALNEKYV-NMIEAGIVDPTKVS----RSA
CH60_THEBR       ATNAGVD-GSVIVEKIKAAKDPNF----GYDAYKEEFT-DMFKAGIVDPTKVT----RTA
CH60_CALS4       AENAGVD-GSIIVEKIKAAKDPNF----GYDAYREEFT-DMIKRGIIDPTKVT----RTA
CH60_HUNT2       AENAGLE-GSVIVEKVKAS-EPGI----GFDAYNEKYV-NMIEAGIVDPAKVT----RSA
CH601_NOSS1      AENAGQN-GAVIAERVKEKAF-NV----GFNAATNEFV-DMFEAGIVDPAKVT----RSA
CH60_SYNE7       AENAGLN-GAVISERVKELPF-DE----GYDASNNQFV-NMFTAGIVDPAKVT----RSA
CH601_THEVL      AENAGQN-GAIIVERVKEKPF-DV----GYDAAKDEYV-NMFDAGIVDPAKVT----RSA
CH601_SYNY3      AENAGQN-GAVISERVKEKEF-NV----GYNAASLEYV-DMLAAGIVDPAKVT----RSA
CH60_CYAPA       VENAGQN-GAVIAEQVKDKPF-NI----GYNAANAQFV-DMFEAGIVDPAKVT----RSG
CH60_GUITH       IENTGQN-SAIIIEQIKESEF-NI----GYDAAKGEIV-DMYDVGIIDPAKVT----RSG
CH60_PORPU       AFNAGDN-GAVVVEKVKTNDF-CI----GYDASNGKIV-NMYDAGIIDPAKVA----RSA
CH60_GALSU       VQNEGKN-GAIVVDEIKNLDF-SI----GYDASTSKFV-NMYESGIIDPAKVT----RSA
CH60_TRICV       AENAGIN-GPVIIEKVQQQEF-EI----GYNAAKNVFG-NMYDEGIVDPAKVT----RSG
CH60_CYACA       AENSGKN-GSLIVEALEHKNF-EI----GYDALSNSLV-DMYDAGIIDPAKVT----RSA
CH602_NOSS1      ADNAGAE-GSVIVSRVKDSDF-NI----GYNAATGEFE-DLIAAGIIDPAKVV----RSA
CH602_SYNY3      ASNAGVE-GSVIVEKVKEATG-NQ----GYNVITGKIE-DLIAAGIIDPAKVV----RSA
CH602_THEEB      ADNAGAE-GAVVVENVRAGDF-NY----GFNAATGAYE-DLVSAGIIDPAKVV----RSA
CH60_AGGAC       VANAGEE-ASVIASAVKNGEG-NF----GYNAGTEQYG-DMIAMGILDPTKVT----RSA
CH60_PASMU       VANAGEE-ASIVASAVKNGEG-NF----GYNAGTEQYG-DMIEMGILDPTKVT----RSA
CH60_HAEIN       VTNAGEE-ASVVASAVKNGEG-NF----GYNAGTEQYG-DMIEMGILDPTKVT----RSA
CH60_ACTPL       VTNAGEE-ASVVARNVKDGNG-NY----GYNAGTEQYG-DMLEMGILDPPKVT----RSA
CH60_HAEDU       VENSGED-ASVVARDVKDGSG-NF----GYNATTEEYG-DMLEMGILDPTKVT----RSA
CH60_AERSA       VINAGEE-ASVIANAVKNGEG-NF----GYNAYTEQYG-DMLAMGILDPTKVT----RSA
CH601_VIBPA      TKNAGDE-DSVVANNVKAGEG-SY----GYNAATGEYG-DMLEMGILDPTKVT----RSA
CH601_VIBVU      TKNAGDE-ESVVANNVRAGEG-SY----GYNAATGVYG-DMLEMGILDPTKVT----RSA
CH601_VIBCH      VKNAGDE-ESVVANNVRAGEG-NY----GYNAATGVYG-DMIEMGILDPTKVT----RSA
CH60_BUCAI       VSNSGEE-PSVVTNNVKDGKG-NY----GYNAATDEYG-DMIDFGILDPTKVT----RSA
CH60_BUCAP       VSNSGEE-PSVVTNNVKDGKG-NY----GYNAATDEYG-DMIDFGILDPTKVT----RSA
CH60_BUCCM       VANSGEE-PSVVTNNVKDGVG-NY----GYNAATDQYG-DMIKFGILDPTKVT----RSA
CH60_ECOLI       VLNCGEE-PSVVANTVKGGDG-NY----GYNAATEEYG-NMIDMGILDPTKVT----RSA
CH60_SALTY       VLNCGEE-PSVVANTVKGGDG-NY----GYNAATEEYG-NMIDMGILDPTKVT----RSA
CH60_STEMA       VLNCGEE-PSVVANTVKGGDG-NY----GYNAVXRRIR-QHDRHGYPGSNQIT----RSA
CH60_KLEPN       VSNAGEE-PSVVANNVKAGDG-NY----GYNAATEEYG-NMIDFGILDPTKVT----RSA
CH60_BUCTS       VINAGEE-ASVIANNVKAGKG-NY----GYNAYSEQYG-DMIKMGILDPTKVT----RSA
CH60_YERPE       VVNAGEE-ASVIANKVKAGEG-SF----GYNAYTEEYG-DMIAMGILDPTKVT----RSA
CH60_SODGL       VANAGEE-PSVIANKVKAGEG-NT----GYNAATEEYG-NMIDMGILDPTKVT----RSA
CH60_WIGBR       VANAGEE-PSVIANKVKAGEG-NT----GYNAATEVYG-NMIDMGILDPTKVT----RSA
CH60_COLMA       VANCGDE-PSVVLNEVRNGKG-NY----GYNAGNSTYG-DMIEMGILDPTKVT----RSA
CH60_PSEHT       VTNAGDE-ASVVINAVKAGSG-NF----GYNAATGEYN-DMIEMGILDPTKVT----RSA
CH602_VIBCH      AINAGDE-ASVIANQVKTGDE-HY----GYNAATGQFG-NMLEMGILDPAKVT----RSA
CH60_PSEAE       VANAGDE-PSVVVDKVKQGSG-NY----GFNAATGVYG-DMIEMGILDPAKVT----RSA
CH60_PSEPU       TANAGDE-PSVVANKVKQGSG-NF----GYNAATGEYG-DMIEMGILDPAKVT----RSA
CH60_OLEAN       AGNAGAE-GSVVVDKVKSGTG-SF----GFNASTGEYG-DMIAMGILDPAKVT----RSS
CH60_LEGJE       VANAGYE-SSVIVNKVAEHKD-NF----GFNAATGQYG-DMVEMGILDPTKVT----RTA
CH60_TATMI       VANAGYE-PSVIVNKVAESKD-NF----GFNAATGEYG-DMVEMGILDPTKVT----RTA
CH60_LEGPH       VTNAGYE-ASVVVNKVAEHKD-NY----GFNAATGEYG-DMVEMGILDPTKVT----RMA
CH60_COXBU       VKNTGVQ-AAVVADKVLNHKDVNY----GYNAATGEYG-DMIEMGILDPTKVT----RTA
CH60_XANAC       VANAGEE-PSVILNKVKEGTG-NY----GYNAANGEFG-DMVEFGILDPTKVT----RSA
CH60_XANCP       VANAGEE-PSVILNKVKEGTG-NY----GYNAANGEFG-DMVEFGILDPTKVT----RSA
CH60_XYLFA       VANAGEE-PSVILNKVKEGKD-NF----GYNAATGEFG-DMVNLGILDPTKVT----RSA
CH60_ALLVI       VANAGEE-PSVILHKVAEGTG-NF----GYNAANGEYG-DMVEMGILDPTKVT----RSA
CH60_FRATH       VSNAGGE-SSVVVNQVKANQG-NY----GYNAANDTYG-DMVEMGILDPTKVT----RSA
CH601_BURPS      VTNGGEE-ASVVVAAVAAGKG-NY----GYNAATGEYV-DMVEAGVVDPTKVT----RTA
CH60_BURTH       VTNGGEE-ASVVVAAVAAGKG-NY----GYNAATGEYV-DMVEAGVVDPTKVT----RTA
CH60_BURCE       VTNGGEE-ASVVVAAVAAGKG-NY----GYNAATGEYV-DMVEAGVVDPTKVT----RTA
CH60_RALSO       VTNAGDE-ASVVVANVIAGKG-NY----GYNASTGEYG-DLVEMGVLDPTKVT----RTA
CH60_BORPE       VTNAGDE-ASVVVNTVLNGKG-NY----GYNAATGEYG-DLVEQGVLDPTKVT----RTA
CH60_NEIMA       VANAGGE-PSVVVNKVLEGKG-NY----GYNAGSGEYG-DMIEMGVLDPAKVT----RSA
CH60_NEIMB       VANAGGE-PSVVVNKVLEGKG-NY----GYNAGSGEYG-DMIEMGVLDPAKVT----RSA
CH60_TREPR       VANGGEE-ASVVASSVASGKSISY----GYNAAMRVYG-DLMDAGVVDPTKVT----RSA
CH60_METSS       AANAGDE-PSVVINKVLAGSG-NF----GYNAATGEYA-DLVETGVVDPTKVT----RTA
CH601_RHIME      VENAGDE-ASIVVGKILEKNTDDF----GYNAQTGEYG-DMIAMGIIDPVKVV----RTA
CH604_RHIME      VENAGDE-ASIVVGKILEKNTDDF----GYNAQTGEYG-DMIAMGIIDPVKVV----RTA
CH60_AGRFC       AENAGDE-ASIVVGKILDKNEDNY----GYNAQTGEYG-DLIALGIVDPVKVV----RTA
CH60_RHILV       AENAGDE-ASIVVGKVLDKNEDNF----GYNAQTSEYG-DMIAMGIVDPLKVV----RTA
CH60_BRUAB       TTNAGEE-ASVIVGKILENTSETF----GYNTANGEYG-DLISLGIVDPVKVV----RTA
CH60_BRUME       TTNAGEE-ASVIVGKILENTSETF----GYNTANGEYG-DLISLGIVDPVKVV----RTA
CH603_RHILO      AANAGAE-ASIVAGKILENKGATF----GFNAQTGEYG-DMIAMGIVDPVKVV----RTA
CH605_RHILO      AANAGAE-ASIVAGKILENKGATY----GYNAQTGEYG-DMIAMGIVDPVKVV----RTA
CH604_RHILO      ASNAGAE-ASIVAGKILENKGATF----GYNAQTGEYG-DMIAMGIVDPVKVV----RTA
CH60_BARHE       ATNAGEE-AAIIVGKVLENNADTF----GYNTATGEFG-DLIALGIVDPVKVV----RSA
CH60_BARQU       ATNAGEE-AAIIVGKVLENNADTF----GYNTATGQFG-DLIALGIVDPVKVV----RSA
CH60_BARBA       AHNAGEE-AAVIVGKVLENCSDTF----GYNTATAQFR-DLISFGIVDPVKVV----RSA
CH602_BRADU      AINAGED-GSVIVGKILEKDQYSY----GYDSQTGEYG-NLVSKGIIDPTKVV----RVA
CH603_BRADU      AINAGED-GSIVVGKVLDNEQYSF----GFDAQTGEYS-NLVSKGIIDPAKVV----RIA
CH601_BRADU      VQNAGED-GSLVVGKLLENSSYNW----GFNAASGEYQ-DLAKAGVIDPAKVV----RTA
CH602_RHIME      AENAGAE-GSIIVGKLREKQDFAF----GWNAQTGEFG-DLFQMGVIDPAKVV----RAA
CH605_RHIME      AENAGAE-GSIIVGKLREKTEFSY----GWNAQTNEYG-DLYAMGVIDPAKVV----RTA
CH602_RHILO      AENAGAE-GSIIVGKLREKPEFGW----GWNAQTNAFG-DLYNEGVIDPVKVV----RTA
CH601_RHILO      AENSGVE-GSIVVGKLADSKDHNL----GFDAQNETYV-DMIKAGIVDPAKVV----RTA
CH603_RHIME      ADNAGVE-GSIVVGKLVDGRDHNQ----GFDAQTETYV-DMIKAGIVDPAKVV----RTA
CH60_CAUVC       AENAGVE-GSIVVGKILENDNSAF----GFNAQTEQYV-DLVVDGVIDPAKVV----RTA
CH60_RHOPL       AQNAGVD-GSVVAGKVRESDDKAF----GFNAQTEEYG-DMFKFGVIDPAKVV----RTA
CH601_RHOSH      AQNAGVD-GSVVAGKVRESNEKSF----GFNAQTEEYG-DMFKFGVIDPAKVV----RTA
CH60_PARDE       AENAGVD-GAVVAGKVRESSDKAF----GFNAQTEEYG-DMFKFGVIDPAKVV----RTA
CH60_RHOCA       AENAGVD-GAVVAGKVRESADPAF----GFNAQTEEYG-DMFGFGVIDPAKVT----RTA
CH602_RHOSH      ADNAGID-GSVVAGKVIENDSATF----GFDAQLETYG-DMLQAGIIDPTKVV----RIA
CH60_EHRRW       IKNAGSENAPCVIAHLLKQNDKEL----IFNVDVMNFA-NAFTSGVIDPLKVV----RIA
CH60_EHRCH       IKNSGSENAPCVIAHLLKQNDKEL----IFNVDTMNFA-NAFTSGVIDPLKVV----RIA
CH60_ORITS       VKNAGGK-EDVVVNELSKSTDKNR----GFDARTMQYV-DMIKAGIVDPTKVV----RTA
CH60_RICCN       VENAG-ENGGVVVGKLLEHKDKNY----GFNAQDMQYV-DMIKAGIIDPAKVV----RTA
CH60_RICPR       VKNAG-ENGGVVVGKLLEHNDKNY----GFNAQDMQYV-DMIKAGIIDPAKVV----RTA
CH60_CAMJE       AENAGFD-AGVVVNSVENAKDENT----GFDAAKGEYV-NMLESGIIDPVKVE----RVA
CH60_CAMRE       AENAGFD-AGVVANSVSVSKDDNY----GFNAATGEYV-DMFKAGIIDPVKVE----RIA
CH60_HELPY       AINAGYD-GGVVVNEVEK-HEGHF----GFNASNGKYV-DMFKEGIIDPLKVE----RIA
CH60_HELPJ       AINAGYD-GGVVVNEVQK-HEGHF----GFNASNGKYV-DMFKEGIIDPLKVE----RIA
CH60_CHLMU       AANAGK-EGAIIFQQVMSRSA-NE----GYDALRDAYT-DMIEAGILDPAKVT----RSA
CH60_CHLTR       AANAGK-EGAIIFQQVMSRSA-NE----GYDALRDAYT-DMLEAGILDPAKVT----RSA
CH60_CHLPN       ASNAGK-EGAIICQQVLARSA-NE----GYDALRDAYT-DMIDAGILDPTKVT----RSA
CH601_CHLCV      AANAGK-EGAIICQQVLSRSS-SE----GYDALRDAYT-DMIEAGILDPTKVT----RCA
CH60_AQUAE       AYNAGY-DGSVVLEKVIELGK-EKGVSWGFNAATGEYV-DMYEAGIIDPTKVV----RTA
CH60_TANFO       VNNAGK-EGAVVVQKVKEGTG-AF----GYNARTDVYE-DLSEAGVVDPAKVT----RIA
CH60_CHLTE       VANTGTTDGAVVLEKVKNAEG-DY----GFNARTEQYE-NLIEAGVVDPTKVT----RSA
CH60_RHOMR       AANAGW-EGSIVVQRVKEGQG-DF----GFNAQTEEFG-NLLEQGVIDPTKVA----RTA
CH60_BORBU       ISNAGFE-GSIYIHQIKTEKK-GL----GFDASSFKWV-NMIESGIIDPAKVT----RSA
CH60_TREPA       SENAGID-GAVVAEKAK-EKR-GI----GFDASKMEWV-DMIKVGIIDPAKVT----RSA
CH60_LEPIN       TSNAGLE-GSVIVEHAKAKKG-NE----GFNALTMVWE-DMIQAGVVDPAKVV----RSA
CH60_DEIRA       AANAGEE-GSVIVNAVVGSDK-AR---YGFNAATGEYVEDMVAAGIVDPAKVT----RTA
CH60_THET8       AENAGYE-GSVIVQQILAETKNPR---YGFNAATGEFV-DMVEAGIVDPAKVT----RSA
CH60_THEMA       AENAGYD-GAVIIEKILSNDD-PA---YGFDALRGEYC-NMFERGIIDPAKVT----RSA
CH60_THENE       AENAGYD-GAVIIEKILASDD-PA---YGFDALRGEFG-NMFEKGIIDPAKVT----RSA
CH601_MYCLE      ATNAGLD-GAVVVDKVSGLPA-GH----GLNASTLGYG-DLVADGVVDPVKVT----RSA
CH601_MYCTU      AANAGLD-GSVVVNKVSELPA-GH----GLNVNTLSYG-DLAADGVIDPVKVT----RSA
CH601_CORGL      ASNAGLD-GSVVVARTAALPN-GE----GFNAATLEYG-NLINDGVIDPVKVT----HSA
CH601_STRCO      AENAGLE-GYVITSKVADLDK-GQ----GFNAATGEYG-DLVKAGVIDPVKVT----RSA
CH601_STRLI      AENPGLE-GYVITSKVADLDK-GQ----GFNAATGEYG-DLVKAGVIDPVKVT----RSA
CH601_STRAL      AENAGLE-GYVITTKVAELDK-GQ----GFNAATGEYG-DLVKAGVIDPVKVT----RSA
CH602_MYCLE      AFNSGME-PGVVAEKVRNLSV-GH----GLNAATGEYE-DLLKAGVADPVKVT----RSA
CH602_MYCTU      AFNSGLE-PGVVAEKVRNLPA-GH----GLNAQTGVYE-DLLAAGVADPVKVT----RSA
CH602_MYCPA      AFNGGLE-PGVVAEKVRNSPA-GT----GLNAATGEYE-DLLKAGIADPVKVT----RSA
CH602_STRAL      AVNGGLE-GGVVVEKVRNLSV-GH----GLNAATGQYV-DMIAEGILDPAKVT----RSA
CH602_STRCO      AVNGGLE-GGVVVEKVRNLTV-GH----GLNAATGEYV-DMIAEGIIDPAKVT----RSA
CH601_CUTAK      AINAGLE-GGVVAEKVAGLPA-GQ----GLNAANDEYV-DMVEAGIIDPAKVT----RSA
CH60_TROWT       SLNAGLE-PGVVVGKVSSLPQ-GH----GLDASTGEYV-DMLSRGISDPVKVT----RSA
CH60_FUSNN       AENCGLN-GGVVLEKVRMSPK-GF----GFDAKNEKYV-NMIESGIIDPAKVT----RAA
CH60_MYCGE       IQNSGVDPVKILSELKNEKTG------VGFDAETKKKV-DMIANGIIDPTKVT----KTA
CH60_MYCPN       IENSGVNPVKVFAELRSEADG------VGFDAETKKKV-DMIRSGIIDPTKVT----KTA
                   . *                         :        :    *  .. ::     : .

CH60_BACHD       LQHAASVSAMFLTTEAVIADKPE----ENE-------G-GG-----------GMPDMGGM
CH60_BACSU       LQNAASVAAMFLTTEAVVADKPE----ENG-------G-GA-----------GMPDMGGM
CH60_GEOSE       LQNAASVAAMFLTTEAVVADKPE----ENK-------G-GNP----------GMPDMGGM
CH60_PARTM       LQNAASVAAMFLTTEAVVADKPE----ENK-------G-GNS----------GMPDMGGM
CH60_BACP3       LQNAASVAAMVLTTEACVADKPE----ENK-------G-NN-----------NMPDMGGM
CH60_LISIN       LQNASSVAALLLTTEAVVADQPD----ENGP----AAG-PDM----------GMGGMGGM
CH60_LISMO       LQNASSVAALLLTTEAVVADKPD----ENGP----AAV-PDM----------GMGGMGGM
CH60_STAAM       LQHAASVAAMFLTTEAVVASIPE----KNN---------DQP----------NMGGMPGM
CH60_STAES       LQHAASVAAMFLTTEAVVASIPEP---ENN---------EQP----------GMGGMPGM
CH60_BRECH       LSNAASVAAMFLTTEAVIADKPE----ENK---------APM----------GMPDMGGM
CH60_STRAG       LQNAASVASLILTTEAVVANKPEPE--APTA----PA--MDP----------SM--MGGF
CH60_STRP1       LQNAASVASLILTTEAVVANKPEPATPAPAM----PAG-MDP----------GM--MGGF
CH60_STRAP       LQNAASVASLILTTEAVVANQPEP---ASPT----PA--MDP----------SM--MGGM
CH60_STRCV       LQNAASVASLILTTEAVVASQPEP---ASPA----PA--MDP----------SM--MGGM
CH60_STRSA       LQNAASVASLILTTEAVVANQPEP---ASPA----PA--MDP----------GM--MGGM
CH60_STRPN       LQNAASVASLILTTEAVVANKPEP---VAPA----PA--MDP----------SM--MGGM
CH60_LACLA       LQNAASVAGLILTTEAVVANKPEP---AAPA----MPP-MDP----------SMG-MGGM
CH60_ENTFA       LQNAASVSALLLTTEAVVADKPEP---AAPA----PM--MDP----------SMG-MGGM
CH60_LACAC       LQNAASIAALLLTTEAVVADIPED--KPEAP----QAG-AAG----------APG-MGM-
CH60_LACHE       LQNAASIAALLLTTEAVVAEIPEP--KQAAP----QGG-AGA----------PMG-M---
CH60_LACZE       LQNAASVAALMLTTEAVVADKPDPN-ANNNA----AAG-ANP----------AAG-MGGM
CH60_CLOAB       LQNAASVASTFLTTECAVADIPEKDKPEMPG----G----AP----------GMG-MGGM
CH60_CLOPE       LQNAASVASTFLTTEAAVADIPEK---EMPQ----G----A-----------GMG-MDGM
CH60_CLOBO       LQNAASVASTFLTTECVVAEIPEKNPAPQAP----G----MG----------GMG-MEGM
CH60_CLODI       LQNAASIASTFLTTEAAVADLPEK----EDA----G----MP----------GTG-MDGM
CH60_THEBR       LQNAASIASMILTTEAIVVDIPEK---NTGM----P----NP----------GAG-MDMM
CH60_CALS4       LQNAASIASMILTTEAIVVDVPEK---EKSN---------IP----------GAG-MDMM
CH60_HUNT2       LQNAASVASMVLTTESVVADIPEK---ETSG----G----PG----------GAG-MGGM
CH601_NOSS1      LQNAASIAGMVLTTECIVVDKPEP--KDNAP-----AGAGAGG----------G-DFDY-
CH60_SYNE7       LQNAASIAAMVLTTECIVVDKPEP--KEKAP-----AGAGGGM----------G-DFDY-
CH601_THEVL      LQNAASIAGMVLTTECIIVDKPEP--KENNP-----AGSGAGM----------GGDFDY-
CH601_SYNY3      LQNAASIAGMVLTTECIVVDKPE---KEKAP-----AGAPGG-------------DFDY-
CH60_CYAPA       LQNAASIAGMVLTTECIVVDKAES--QQKAA-----SVNRNS--------------FDY-
CH60_GUITH       LQNAASIASMILTTECIVVDKQDE--K---------------------------------
CH60_PORPU       LQNATSIAAMVLTTECIVVDKLEA------------------------------------
CH60_GALSU       LQNASSIAGMILTTECLVVDEMNR--NMEVR-----K-----------------------
CH60_TRICV       LQNATSIASMILTTECIIVDETD-------------------------------------
CH60_CYACA       IQNAASIASMVLTTECVIVNRDKK--NN--------------------------------
CH602_NOSS1      LQNAASIAGLVLTTEAIVVEKPEK--KSAAP-----ADAGMGG----------MGGMGGM
CH602_SYNY3      LQNAASIAGMVLTTEALVVEKPE----PAAP-----AMPDMGG----------MGGMGGM
CH602_THEEB      LQNAGSIAGMVLTTEALVVEKPEP--KPAAP-----ANGGMGG----------MGGMM--
CH60_AGGAC       LQFAASVAGLMITTECMVTELP----KDDKA----DLG-AAG-M-------GGMGGMGGM
CH60_PASMU       LQFAASVAGLMITTECMVTDLP----KEDKA----DLG-AAG-M-------GGMGGMGGM
CH60_HAEIN       LQFAASVAGLMITTECMVTDLP----KDDKA----DLG-AAG-M-------GGMGGMGGM
CH60_ACTPL       LQFAASIAGLMITTECMITDLP----KEEKL----DPA-AA--M-------GGMGGMGGM
CH60_HAEDU       LQFAASIAGLMITTECMITDLP----KEDKL----DAQ-AA--M-------GGMGGMGGM
CH60_AERSA       LQFASSIAGLMITTECMITELP----KKD------TPA-MPD-M-------GGMGGMGMM
CH601_VIBPA      LQFAASVAGLMITTEAMVTDLP----QKESA----GMP-DMGGM-------GGMGGMGMM
CH601_VIBVU      LQFAASVAGLMITTEAMVTDLP----QKD-S----GMP-DMGGM-------GGMGGMGMM
CH601_VIBCH      LQFAASVAGLMITTEAMITELP----KKDAP----AMP-DM-----------GMGGMGGM
CH60_BUCAI       LQYAASVAGLMITTECMVTDLP----KEDKS----SDS-SSSP-------AGGMGGMGGM
CH60_BUCAP       LQYAASVAGLMITTECMVTDLP----REDKS----SDV-ASSP-------AGGMGGMGGM
CH60_BUCCM       LQYAASVAGLMITTECMVTDSP----KEDKS----SDM-PSPS-------AGGMGGMGGM
CH60_ECOLI       LQYAASVAGLMITTECMVTDLP----KNDAA----DLG-AAGGM-------GGMGGMGGM
CH60_SALTY       LQYAASVAGLMITTECMVTDLP----KSDAP----DLG-AAGGM-------GGMGGMGGM
CH60_STEMA       LQYAASVAGLMITTECMVTDLP----KNDAA----DLG-AAGGM-------GGMGGMGGM
CH60_KLEPN       LQYAASVAGLMITTECMVTDLP----KSDAP----DLG-AAGGM-------GGMGGMGGM
CH60_BUCTS       LQYAASVAGLMITTECMITDLP----KSDSS----DLS-NAGNGGM----GGGMGGMGGM
CH60_YERPE       LQYAASIAGLMITTECMVTDLP----RDDKG----ADM-GAGGM-------GGMGGMGGM
CH60_SODGL       LQYAASIAGLMITTECMVTDLP----KEDKP----DLG-GAG----------GMGGMGGM
CH60_WIGBR       LQYAASIAGLMITTECMITDLP----KEEKP----DLS-GAGA---------GMGGMGGM
CH60_COLMA       LQFAASVAGLMLTTEAMITDAP----VKDAG----GMP-DMSGM------GGGMGGMGGM
CH60_PSEHT       LQFAGSIAGLMITTEAMVAEIP----KDD------SAP-DMGGM-------GGMGGMGGM
CH602_VIBCH      LQFAASIAGLMITTEAMVSEVD----KESAA-----------------------------
CH60_PSEAE       LQAAASIGGLMITTEAMVAEIV----EDKP-----AMG-GMPDM-------GGMGGMGGM
CH60_PSEPU       LQAAASIGGLMITTEAMIADAP----SDAP-----AGG-GMPDM-------GGMGGMGGM
CH60_OLEAN       LQAAASIAGLMITTEAMVADAP----VEE------GAG-GMPDM-------GGMGGMGGM
CH60_LEGJE       LQNAASVRSLMLTTECMVADLP----KKDEG-----MA-GAGDM-------GGMGGMGGM
CH60_TATMI       LQNAASVASLMLTTECMVADLP----KKEE------PM-GAGEM-------GGMGGMGGM
CH60_LEGPH       LQNAASVASLMLTTECMVADLP----KKEE------GV-GAGDM-------GGMGGMGGM
CH60_COXBU       LQNAASIAGLMITTECMVTEAP----KKKEE----SMP-GGGDM-------GGMGGMGGM
CH60_XANAC       LQNAASIAGLMITTEAMVADAP----KKDEP----ALP-A-G---------GGMGGMGGM
CH60_XANCP       LQNAASIAGLMITTEAMVADAP----KKDEP----AMP-A-G---------GGMGGMGGM
CH60_XYLFA       LQNAASIAGLMITTEAMVAEAP----KKDEP----TPP-AAG---------GGMGGMGGM
CH60_ALLVI       LQNSCSVAGLMITTEAMIADEP----KDDAP----AMP-G-----------GGMGDMGGM
CH60_FRATH       LQHAASIAGLMITTEAMIGEIK----EAAPA----MPM-G-----------GGMGGMPGM
CH601_BURPS      LQNAASVAGLLLTTDAAVAELP----KEDAP----MPG-GMP---------GGMGGMGMD
CH60_BURTH       LQNAASVAGLLLTTDAAVAELP----KEDAP----MPG-GMP---------GGMGGMGMD
CH60_BURCE       LQNAASVAGLLLTTDAAVAELP----KEDAP----MPG-GMP---------GGMGGMGMD
CH60_RALSO       LQNAASVASLMLTTDCAVAELP----KDDAAP--AMPG-GM----------GGMGGMDGM
CH60_BORPE       LQNAASVASLLLTAEAAVVELMEN--KPAAAP--AMPG-GM----------GGMGGMDF-
CH60_NEIMA       LQHAASIAGLMLTTDCMIAEIP-----EDKP----AMP-DM----------GGMGGMGGM
CH60_NEIMB       LQHAASIAGLMLTTDCMIAEIP-----EDKP----AVP-DM----------GGMGGMGGM
CH60_TREPR       LQNAASVAGLMLTTDVAVCDSPKR--EEAAP-----TQ-PVH---------GGVG-----
CH60_METSS       LQNAASVASLILTTDASIAELP----KEEKA--------A-V---------PAMPDMGY-
CH601_RHIME      LQDAASVASLLITTEAMIAELP----KKD------APA--MPGG-M-----GGMGGMDMM
CH604_RHIME      LQDAASVASLLITTEAMIAELP----KKD------APA--MPGG-M-----GGMGGMDMM
CH60_AGRFC       LQNAASVASLLITTEAMIAELP----KKESA----MPQ--MPG--------GGMGGMDF-
CH60_RHILV       LQNAASVASLLITTEAMIAELP----KKD-A----PAG--MPGG-M-----GGMGGMDMM
CH60_BRUAB       LQNAASVAGLLITTEAMIAELP----KKDAA----PAG--MPGG-M-----GGMGGMDF-
CH60_BRUME       LQNAASVAGLLITTEAMIAELP----KKDAA----PAG--MPGG-M-----GGMGGMDF-
CH603_RHILO      LQDAASVAGLLVTTEAMIAEAP----KKESA----GGGG-MPGG-MGGGGMGGMGGMDF-
CH605_RHILO      LQDAASVAGLLVTAEAMIAEAP----KKESA----GGG--MPGG-MPGGGMGGMGGF---
CH604_RHILO      LQDAASVAGLLVTTEAMIAEAP----KKESA----GGG--MPGG-MGGGGMGGMGGMDF-
CH60_BARHE       LQNAASIASLLITTEAMVAEVP----KKDTP----VPP--MPGGGM-----GGMGGMDF-
CH60_BARQU       LQNAASIASLLITTEAMVAEVP----KKDTP----MPP--MPGGGM-----GGMGGMDF-
CH60_BARBA       LQNAASIASLLITTEAMVAEVP----KKEAA----APA--MPGG-------G-MGGMDF-
CH602_BRADU      IQNAASVAALLITTEAMVAEVP----KKNTG----AGG--MPPGGGG---MGGMGGMDF-
CH603_BRADU      VQNASSVAGLLITTEAMVAELP----KKATA----GPA--MPAAPG-------MGGMDF-
CH601_BRADU      LQDAASVAALLITTEALIAEKP----KKSEP----APA--APP-------------MDF-
CH602_RHIME      LQDAASIAGLLVTTEAMIAEKP----KKDGQ----PQM--PPG-----------GGMDF-
CH605_RHIME      LQDAASVAGLLVTTEAMIAEKP----KKEAA----PAL--PAG-----------GGMDF-
CH602_RHILO      LQDAASVAGLLVTTEAMVAEKP----KKEPA----VPA--MPA-----------GGMDF-
CH601_RHILO      LQDAGSIAALLITAEAMITDIP----AKDAA----PAG--GGGG-------GMGGY----
CH603_RHIME      LRDAGSIASLLITAEAMIADIP----ERGSP----QST--GNGAV------DSMGY----
CH60_CAUVC       LQNAASVAGLLITTEAAIVEAP----KKGGG----APA--GGGMP------GGMGDMDF-
CH60_RHOPL       LEDAASVASLLITTEAMIADKP----EPKSA----PAG-GMGGM-------GGMDGMM--
CH601_RHOSH      LEDAASVASLLITTEAMIADKP----EPKSP----AGGPGMGGM-------GGMDGMM--
CH60_PARDE       LEDAASVAGLLITTEAMIAEKP----EPKAP----AGG--MPDM-------GGMGGMM--
CH60_RHOCA       LEDAASIAGLLITTECMIAEKP----EPKAA----PAG-GMGGM-------GGMDMM---
CH602_RHOSH      LEDAASIAGLLITTEVIIAHKP----E---R----GER--MSQM-------DEMGGMM--
CH60_EHRRW       FDFAVSLAAVFMTLNAIVVDIP----SKDDN--SAAGGAGMGGM-------GGMGGF---
CH60_EHRCH       FDFAVSLAAVFMTLNAIVVDVP----SKDD---ANAGAGGMGGM-------GGMGGF---
CH60_ORITS       LQDAFSVASLVIATSAMITDHE----EDNNTGNRSGGGVGGGHH-------GGMGGMDF-
CH60_RICCN       LQDAASVASLIITTETLIVDEP----SSDKA-EPMPMRGGMGGM-------GGMDF----
CH60_RICPR       LQDAASVASLIITTETLIVDEP----S-DKE-EPMPMRGGMGGM-------GGMGGMDF-
CH60_CAMJE       LLNAVSVASMLLTTEATISEIK----EDK------PTMPDMSGM-------GGMGGMGGM
CH60_CAMRE       LQNAVSVASLLLTTEATISELK----EDKPM----PAMPDMSGM-------GGMGGMGGM
CH60_HELPY       LQNAVSVSSLLLTTEATVHEIK----EEKAA----PAMPDMGGM-------GGMGGMGGM
CH60_HELPJ       LQNAVSVSSLLLTTEATVHEIK----EEKAA----PAMPDMGGM-------GGMGGMGGM
CH60_CHLMU       LESAASVAGLLLTTEALIAEIP-----EEKP----AAAPAMPG-----------AGMDY-
CH60_CHLTR       LESAASVAGLLLTTEALIAEIP-----EEKP----AAAPAMPG-----------AGMDY-
CH60_CHLPN       LESAASIAGLLLTTEALIADIP-----EEKS----SSAPAMPS-----------AGMDY-
CH601_CHLCV      LESAASVAGLLLTTEALIADIP-----EEKS----SSAPAMPG-----------AGMDY-
CH60_AQUAE       IENAASVAGTMLTAEALIADLP-----EEKK----KDITPTDM-----------PELD--
CH60_TANFO       LENAASIAGMFLTTECVVADKK-----EE------APAPPMNPG---------MGGMGGM
CH60_CHLTE       LENAASVASILLTTEAAITDVK-----EDK-----ADMPAMPP-----------GGMGGG
CH60_RHOMR       LENAASVAGLLLTTEAVVAEKP-----E-K-----EKAAAPSP-----------GDMDF-
CH60_BORBU       LQNAASIAGLLLTTECAITDIK----EE--K----NTSGGGGY--------PMDPGMGMM
CH60_TREPA       LQNAASVSGLLLTTECAIAAIP----EK--------SSSTPPA--------PDMGGMGGM
CH60_LEPIN       LQNAASIGSMILTTEVTITDKP----DKDAP----NPMAGMGG--------GGMGGMGGM
CH60_DEIRA       LQNAASIGALILTTEAIVSDKP----EKAAP----AMPQGGGDM-------GGMGGMDF-
CH60_THET8       LQNAASIGALILTTEAVVAEKP----EKKES----TPASAGA---------G---DMDF-
CH60_THEMA       LQNAASIAGMLLTTEVLIVEKP----EEKKE----TPSMPEEF-----------------
CH60_THENE       LQNAASIAGMLLTTEVLVVEKP----EEKKE----TPSLPEEY-----------------
CH601_MYCLE      VLNAASVARMMLTTETAVVDKP----AKTE-----EH-------------DHH--GHAH-
CH601_MYCTU      VLNASSVARMVLTTETVVVDKP----AKAE-----DH-------------DHHH-GHAH-
CH601_CORGL      VVNATSVARMVLTTEASVVEKP----AEEA-----AD-------------AHAG-HHHH-
CH601_STRCO      LENAASIASLLLTTETLVVEKK----EEEE-----PAA---G--------GHSH-GHSH-
CH601_STRLI      LENPASIASLLLTTETLVVEKK----EEEE-----PAA---G--------GHSHLGHSH-
CH601_STRAL      LENAASIASLLLTTETLVVEKP----AEEE-----PE----A--------GHGH-GHSH-
CH602_MYCLE      LQNAASIAGLFLTTEAVVADKP----EKTAA----PAS---DP-------TGGMGGMDF-
CH602_MYCTU      LQNAASIAGLFLTTEAVVADKP----EKEKA----SVP---G--------GGDMGGMDF-
CH602_MYCPA      LQNAASIAGLFLTTEAVVADKP----EKAAA----PAG---DP-------TGGMGGMDF-
CH602_STRAL      LQNAASIAALFLTTEAVIADKP----EKAA-----AAA---PG-------GMPGGDMDF-
CH602_STRCO      LQNAASIAALFLTTEAVIADKP----EKAAP----AGA---PG-------GMPGGDMDF-
CH601_CUTAK      LQNAASIAALFLTTEAVIADKP----EPVKA----PAG---GGD------MDGMGGMGGM
CH60_TROWT       LENAASIAGLFLTTEAVVAEKP----EPKPA----PGP---A---------DPGAGMDF-
CH60_FUSNN       IQNSTSVASLLLTTEVVIANKK----EEEK-----AP---M----------GAGGMMPGM
CH60_MYCGE       LEKAASVASSLITTNVAVYDVK-----ERKD-----------------------NSFSE-
CH60_MYCPN       LEKAASVASSLITTSVAVYDIK-----ENKE-----------------------GSFQE-
                 .  . *:   .:: .  :                                          

CH60_BACHD       GGMGGMM--------
CH60_BACSU       GGMGGMM--------
CH60_GEOSE       M--------------
CH60_PARTM       M--------------
CH60_BACP3       M--------------
CH60_LISIN       M--------------
CH60_LISMO       M--------------
CH60_STAAM       M--------------
CH60_STAES       M--------------
CH60_BRECH       GGMGMM---------
CH60_STRAG       ---------------
CH60_STRP1       ---------------
CH60_STRAP       M--------------
CH60_STRCV       M--------------
CH60_STRSA       M--------------
CH60_STRPN       M--------------
CH60_LACLA       M--------------
CH60_ENTFA       M--------------
CH60_LACAC       ---------------
CH60_LACHE       ---------------
CH60_LACZE       M--------------
CH60_CLOAB       Y--------------
CH60_CLOPE       Y--------------
CH60_CLOBO       Y--------------
CH60_CLODI       Y--------------
CH60_THEBR       ---------------
CH60_CALS4       ---------------
CH60_HUNT2       Y--------------
CH601_NOSS1      ---------------
CH60_SYNE7       ---------------
CH601_THEVL      ---------------
CH601_SYNY3      ---------------
CH60_CYAPA       ---------------
CH60_GUITH       ---------------
CH60_PORPU       ---------------
CH60_GALSU       ---------------
CH60_TRICV       ---------------
CH60_CYACA       ---------------
CH602_NOSS1      GGMGGMGGMGGMGMF
CH602_SYNY3      GGMGMM---------
CH602_THEEB      ---------------
CH60_AGGAC       M--------------
CH60_PASMU       M--------------
CH60_HAEIN       M--------------
CH60_ACTPL       M--------------
CH60_HAEDU       M--------------
CH60_AERSA       ---------------
CH601_VIBPA      ---------------
CH601_VIBVU      ---------------
CH601_VIBCH      M--------------
CH60_BUCAI       M--------------
CH60_BUCAP       M--------------
CH60_BUCCM       GGMM-----------
CH60_ECOLI       M--------------
CH60_SALTY       M--------------
CH60_STEMA       M--------------
CH60_KLEPN       M--------------
CH60_BUCTS       M--------------
CH60_YERPE       M--------------
CH60_SODGL       M--------------
CH60_WIGBR       M--------------
CH60_COLMA       M--------------
CH60_PSEHT       M--------------
CH602_VIBCH      ---------------
CH60_PSEAE       M--------------
CH60_PSEPU       M--------------
CH60_OLEAN       PGMM-----------
CH60_LEGJE       GGMGMM---------
CH60_TATMI       GGMM-----------
CH60_LEGPH       GGMM-----------
CH60_COXBU       GGMM-----------
CH60_XANAC       DF-------------
CH60_XANCP       DF-------------
CH60_XYLFA       DF-------------
CH60_ALLVI       GMM------------
CH60_FRATH       M--------------
CH601_BURPS      M--------------
CH60_BURTH       M--------------
CH60_BURCE       M--------------
CH60_RALSO       M--------------
CH60_BORPE       ---------------
CH60_NEIMA       M--------------
CH60_NEIMB       M--------------
CH60_TREPR       ---------------
CH60_METSS       ---------------
CH601_RHIME      ---------------
CH604_RHIME      ---------------
CH60_AGRFC       ---------------
CH60_RHILV       ---------------
CH60_BRUAB       ---------------
CH60_BRUME       ---------------
CH603_RHILO      ---------------
CH605_RHILO      ---------------
CH604_RHILO      ---------------
CH60_BARHE       ---------------
CH60_BARQU       ---------------
CH60_BARBA       ---------------
CH602_BRADU      ---------------
CH603_BRADU      ---------------
CH601_BRADU      ---------------
CH602_RHIME      ---------------
CH605_RHIME      ---------------
CH602_RHILO      ---------------
CH601_RHILO      ---------------
CH603_RHIME      ---------------
CH60_CAUVC       ---------------
CH60_RHOPL       ---------------
CH601_RHOSH      ---------------
CH60_PARDE       ---------------
CH60_RHOCA       ---------------
CH602_RHOSH      ---------------
CH60_EHRRW       ---------------
CH60_EHRCH       ---------------
CH60_ORITS       ---------------
CH60_RICCN       ---------------
CH60_RICPR       ---------------
CH60_CAMJE       M--------------
CH60_CAMRE       M--------------
CH60_HELPY       M--------------
CH60_HELPJ       M--------------
CH60_CHLMU       ---------------
CH60_CHLTR       ---------------
CH60_CHLPN       ---------------
CH601_CHLCV      ---------------
CH60_AQUAE       ---------------
CH60_TANFO       M--------------
CH60_CHLTE       MY-------------
CH60_RHOMR       ---------------
CH60_BORBU       ---------------
CH60_TREPA       Y--------------
CH60_LEPIN       M--------------
CH60_DEIRA       ---------------
CH60_THET8       ---------------
CH60_THEMA       ---------------
CH60_THENE       ---------------
CH601_MYCLE      ---------------
CH601_MYCTU      ---------------
CH601_CORGL      ---------------
CH601_STRCO      ---------------
CH601_STRLI      ---------------
CH601_STRAL      ---------------
CH602_MYCLE      ---------------
CH602_MYCTU      ---------------
CH602_MYCPA      ---------------
CH602_STRAL      ---------------
CH602_STRCO      ---------------
CH601_CUTAK      M--------------
CH60_TROWT       ---------------
CH60_FUSNN       M--------------
CH60_MYCGE       ---------------
CH60_MYCPN       ---------------