CLUSTAL format seed alignment for MF_00601

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EUTC_BRADU      ------------------------------------------------------------
EUTC_PSEAE      --------------------------------------------------------MNDK
EUTC_PSESM      -----------------------------------------------MSDQPMNEVQ---
EUTC_PSEPK      -----------------------------------------------------------M
EUTC_RALSO      -----------------------------------------------MTD-------ERD
EUTC_XANAC      -----------------------------------------------------------M
EUTC_XANCP      -----------------------------------------------------------M
EUTC_RHOER      -----------------------------------------------------------M
EUTC_CLOAB      --------------------------------------------------------MENL
EUTC_FUSNN      MVSELELKEIIGKVLKEMAVEGK---TEGQAVTETKKTSESHIEDGIIDDITKEDLREIV
EUTC_CLOTE      MFSESDLKRLVEEVLVEMTTKEG---ANIKDTPVSQPTPTVVDEDGIIPDITEVDIRTNL
EUTC_CLOPE      -MNEKDLKLMVEQLVSQMVGQVDMQSVEKVVKEVSKN-QSQVESDEFIPDITEIDIKKQL
EUTC_LISIN      -MNEQELKQMIEGILTEMSGGKT---TDTVAAAPTKSVVETVVTEGSIPDITEVDIKKQL
EUTC_LISMO      -MNEQELKQMIEGILTEMSGGKT---TDTVAAVPTKSVVETVVTEGSIPDITEVDIKKQL
EUTC_ECOLI      -MDQKQIEEIVRSVMASMGQAAP---APSEAKCATTNCAAPVTSESCALDLGSAEAKAWI
EUTC_ECOL6      -MDQKQIEEIVRSVMASMGQTAP---APSEAKCATTNCAAPVTSESCALDLGSAEAKAWI
EUTC_ECO57      -MDQKQIEEIVRSVMASMGQTAP---APSEAKCATTTCAAPVTSESCALDLGSAEAKVWI
EUTC_SALTI      -MDQKQIEEIVRSVMASMGQDVPQPVAPSTQEGAKPQCAAPTVTESCALDLGSAEAKAWI
EUTC_SALTY      -MDQKQIEEIVRSVMASMGQDVPQPAAPSTQEGAKPQCAAPTVTESCALDLGSAEAKAWI
                                                                            

EUTC_BRADU      MSDPAVPRRPTLDLRSFTPARVALGRSGASVPTRALLDFTLDHARARDAVHAVFDVPRLL
EUTC_PSEAE      HLPDASAENPWLPLRQLTPARIALGRTGTSLPTRPQLDFQYAHAQARDAVHLPFDHAAIS
EUTC_PSESM      --DNAAPANPWLELRRLTPARIALGRTGTSLPTCAQLDFQAAHAQARDAVHLAFDHAAIS
EUTC_PSEPK      DHRTPTPDNPWLALRNLTPARIALGRTGTSLPTGAQLDFQFAHAQARDAVHLAFDHAGLA
EUTC_RALSO      DTPATVTQNPWQALRRLTPARIALGRAGVSLPTRPQLAFQAAHAQARDAVHLPFDPAALQ
EUTC_XANAC      SVPSTPPRDAWAQLRQLTPARIALGRVGTSLPTDAHLEFQLAHAQARDAVHLAFDPAPLQ
EUTC_XANCP      STPTTPPRDAWARLRALTPARIALGRAGTSLPTASHLEFQLAHAQARDAVHLAFDPAPLQ
EUTC_RHOER      TEDQAPILDFWGPLRKTTQSRIGLGRAGDSLPTKRVLEFKAAHAAARDAVHEPLDSETLA
EUTC_CLOAB      LKIYDIKEEELSELKALTPARICVGRAGTRLKTNTFLKFRADHAVAMDAVWSSVDEKLID
EUTC_FUSNN      ELKNATNKEEFLKYKRKTPARLGISRAGSRYTTHTMLRLRADHAAAQDAVLSSVNEDFLK
EUTC_CLOTE      LVDNPENAEEYLKMKKHTPARIGVGKAGTRYKTETILRFRADHAAAQDAVFTDVDEKILE
EUTC_CLOPE      LVDNPADREAYLEMKAKTPARLGSGRAGARYKTITALRMRADHAAAQDSVFSDVSEEFIK
EUTC_LISIN      LVPEPADREGYLKMKQMTPARLGLWRAGPRYKTETILRFRADHAVAQDSVFSYVSEDLVK
EUTC_LISMO      LVPEPADREGYLKMKQMTPARLGLWRAGPRYKTETILRFRADHAVAQDSVFSYVSEDLVK
EUTC_ECOLI      GVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVK
EUTC_ECOL6      GVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVK
EUTC_ECO57      GVENPHRADVLTELRRSTVARVCTGRAGPRPRTLALLRFLADHSRSKDTVLKEVPEEWVK
EUTC_SALTI      GVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWGK
EUTC_SALTY      GVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVK
                              :  * :*:   : *    *   * :   *: : *:*   .      

EUTC_BRADU      ADLGALG-LAVTEARSRAADRRDYLRRPDLGRQLDAGSIEALARIASRP---CQLAIVIG
EUTC_PSEAE      DGLRQRG-RDSLLLHSAAADRHVYLQRPDLGRRLDEASVQRLREHAAGYDGQIDLAIVVA
EUTC_PSESM      AQLAEKG-RETILLHSAAADRDSYLQRPDLGRRLNDESAQTLRDYAAAHPGGLDLAVVVA
EUTC_PSEPK      SQLSDRG-RESLVLHSAASDRHQYLQRPDLGRRLNEDSIATLRQHAQANPGGVDLAIVVA
EUTC_RALSO      AQLHAQG-HATLLLHSAARDRDQYLQRPDLGRQLDAPSAQLLGDHAAAHPGGVDIALVVA
EUTC_XANAC      AALEQRG-RSNILLQSAAADRHQYLQRPDLGRRLAEEAAAQLRGLTAVHGGRHDVAVVVA
EUTC_XANCP      AVLQQRG-RRSVLLHSAASDRHLYLQRPDLGRRLSDEAAEQLRGTTAVHGGGADLAVVVA
EUTC_RHOER      SRVDGVGIGAPVVVASSVSTRSEYLRRPDLGRQPAD--LSAIK------SSDKEIGFILA
EUTC_CLOAB      T-------LNFLKVQTLAKDKEEYITRPDLGRKFSEETLDYIKNNCINE---PDVQIIAG
EUTC_FUSNN      A-------NNLFIVKSRCEDKDQYITRPDLGRRLDEESVKTLKEKCVQN---PTVQVFVA
EUTC_CLOTE      E-------MNLETIQTMCSSKDEFITRPDLGRKISKEELSKLSSY-KKN---AQVQIYVS
EUTC_CLOPE      K-------NNFIPVKTMCTDKDEYVTRPDLGRRFSPETTEIIKEKCDKN---PKVQIMVG
EUTC_LISIN      E-------MNFIPVNTKCHDKDEYLTRPDLGREFDDEMVEVIRANTTKN---AKLQIVVG
EUTC_LISMO      E-------MNFIPVNTKCQDKDEYLTRPDLGREFDDEMVEVIRANTTKN---AKLQIVVG
EUTC_ECOLI      A-------QGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVAN---PDVQVVIS
EUTC_ECOL6      A-------QGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVAN---PDVQVVIS
EUTC_ECO57      A-------QGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVAN---PDVQVVIS
EUTC_SALTI      A-------QGLLEVRSEISDKNLYLTRPDMGRRLSPEAIDALKSQCVMN---PDVQVVVS
EUTC_SALTY      A-------QGLLEVRSEISDKNLYLTRPDMGRRLSPEAIDALKSQCVMN---PDVQVVVS
                               :    :  :: ***:**.        :            : .  .

EUTC_BRADU      DGLSAAAVHAHAVALVTRLLPLLAADDAVALGHVVVASGARVALGDQIGAILGARMVVTL
EUTC_PSEAE      DGLSALAVQRHTLPFLERLEEQALA-EGWSLSPVVLVEQGRVAVADEIGELLRAKMSVIL
EUTC_PSESM      DGLSALAVHRHAVPFLTRLEEQASA-EGWTLSPVLMVEQGRVAVADEIGELLGAKMVVIL
EUTC_PSEPK      DGLSALAVHRHTLPFLTRFDEQAAA-DGWTCAPVVLVQQGRVAVADEVGELLGARMTVML
EUTC_RALSO      DGLSALAVHRHAAPLIAGVAEGVRA-QGWSMAPIALVEQGRVAVADEVGERLGARMVVIL
EUTC_XANAC      DGLSALAVHRHAARMLDQIDALASQ-EGWSLAPVVLVRQGRVAIGDEVGELLDARTVIVL
EUTC_XANCP      DGLSALAVHRHAGAMLEQIDALAAH-EGWSLAPVTLIAQGRVAIGDEVGELLQARAVIVL
EUTC_RHOER      DGLSPRALMDHGEQLLSALVTALG--ERYSIAPPVIATNARVALGDHIAAAMGVQTAIVL
EUTC_CLOAB      DGLSATAINANLRKIYFVIVEKLKS-RGYKVGTPIFVKYARVATMDKISEELNAKVTIIL
EUTC_FUSNN      DGLSSTAIEANIEDCLPALLNGLKS-YGISVGTPFFAKLARVGLADDVSEVLGAEVTCVL
EUTC_CLOTE      DGLSSKAVEANVKNILPALIQGLEG-YGISVGKPFFVKLGRVGAMDVISEEFGADVTCVL
EUTC_CLOPE      DGLSSAAIEANVEDILPSIEQGLKM-YGLNVGPILFVKYCRVPAMDAVGEATGADVVCLL
EUTC_LISIN      DGLSSAAIEANIKDILPSIKQGLKM-YNLDFDNIIFVKHCRVPSMDQIGEITGADVVCLL
EUTC_LISMO      DGLSSAAIEANIKDILPSIKQGLKM-YNLDFDNIIFVKHCRVPSMDKIGEITGADVVCLL
EUTC_ECOLI      DGLSTDAITVNYEEILPPLMAGLKQ-AGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILL
EUTC_ECOL6      DGLSTDAITVNYEEILPPLMAGLKQ-AGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILL
EUTC_ECO57      DGLSTDAITVNYEEILPPLMAGLKQ-AGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILL
EUTC_SALTI      DGLSTDAITANYEEILPPLLAGLKQ-AGLNVGTPFFVRYGRVKIEDQIGEILGAKVVILL
EUTC_SALTY      DGLSTDAITANYEEILPPLLAGLKQ-AGLNVGTPFFVRYGRVKIEDQIGEILGAKVVILL
                ****. *:  :       .                .    **   * :.    .     *

EUTC_BRADU      IGERPGLSAPDSLGAYLTFAPTPGRT-DAERNCVSNIHH-AGLSNDEAAFKIAWLLREGL
EUTC_PSEAE      IGERPGLSSPDSLGLYFTWAPRVGLT-DAYRNCISNVRL-EGLSYGMAAHRLLYLMREAC
EUTC_PSESM      IGERPGLSSPDSLGLYFTYAPKVGLN-DAHRNCISNVRL-EGLSYAMAAHRLLYLMREAC
EUTC_PSEPK      IGERPGLSSPDSLGLYFTYAPKVGLT-DAYRNCISNIRL-EGLSYGMAAHRLLYLMREAC
EUTC_RALSO      IGERPGLSSPDSLGLYFTYAPRVGLT-DAARNCISNVRP-EGLGYAAAAHKLLYLMREAW
EUTC_XANAC      IGERPGLSSPDSLGLYLTYTPRVGLT-DAARNCISNIRA-EGLSYAEATHKLGYLLREAF
EUTC_XANCP      IGERPGLSSPDSLGLYLTYAPRVGHT-DAARNCISNIRG-EGLSYAEAGHKLGYLLREAF
EUTC_RHOER      IGERPGLSVADSVGIYLTHLPRVGRT-DADRNCISNVHPPEGLGYEQAARVVLGLVTGAR
EUTC_CLOAB      IGERPGLATGESMSSYMAYESSTKKP-ESQRTVVSNIHN-KGIPSVDAGKEIVRIIDIMM
EUTC_FUSNN      IGERPGLATAESMSAYITYKGYVGIP-EAKRTVVSNIHV-KGTPAAEAGAHIAHIIKKVL
EUTC_CLOTE      IGERPGLVTAESMSAYIAYKGTVGMP-ESRRTVVSNIHK-GGTPAVEAGAYIADIIKLML
EUTC_CLOPE      VGERPGLVTAESMSAYIAYKPKVGMP-EAKRTVISNIHK-GGTTAVEAGAHIAELIKTML
EUTC_LISIN      VGERPGLVTAESMSAYIAYKPTVGMP-EARRTVISNIHS-GGTPPVEAGAYIAELIHNML
EUTC_LISMO      VGERPGLVTAESMSAYIAYKPTVGMP-EARRTVISNIHS-GGTPPVEAGAYIAELIHNML
EUTC_ECOLI      VGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQ-GGTPPVEAAAVIVDLAKRML
EUTC_ECOL6      VGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQ-GGTPPVEAAAVIVDLAKRML
EUTC_ECO57      VGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQ-GGTPPVEAAAVIVDLAKRML
EUTC_SALTI      VGERPGLGQSESLSCYAVYSPRVATTVEADRTCISNIHQ-GGTPPVEAAAVIVDLAKRML
EUTC_SALTY      VGERPGLGQSESLSCYAVYSPRVATTVEADRTCISNIHQ-GGTPPVEAAAVIVDLAKRML
                :******   :*:. * .         :: *. :**::   *     *   :  :     

EUTC_BRADU      AREVTGVALKDESADRAPRRIGTSLPE----------------
EUTC_PSEAE      RRQLSGVNLKDEAEVQALDGEAPRTGNFLLARD----------
EUTC_PSESM      KRQISGVSLKDEAQLNTLESDDSAENSDRKIGNFLLDGPAVPH
EUTC_PSEPK      RRQLSGVNLKDEAEVHSLENEDSANQKGNFLLGKG--------
EUTC_RALSO      RRQGSGVLLKEAAEVPLLEAGRRNFLLD---------------
EUTC_XANAC      RRKLSGVQLKDEAEQPALLSGPADVAPRTFLLPD---------
EUTC_XANCP      RRKLSGVQLKDEADRPLLGTDTASQAAPRNFLLPE--------
EUTC_RHOER      QLGRSGVDLKDTSRADAVASGEVLTLD----------------
EUTC_CLOAB      KEKKSGVELRI--------------------------------
EUTC_FUSNN      DAKASGQDLKL--------------------------------
EUTC_CLOTE      EKKASGLDLKL--------------------------------
EUTC_CLOPE      DKKASGIDLK---------------------------------
EUTC_LISIN      EKKCSGIDLK---------------------------------
EUTC_LISMO      EKKCSGIDLK---------------------------------
EUTC_ECOLI      EQKASGINMTR--------------------------------
EUTC_ECOL6      EQKASGINMTR--------------------------------
EUTC_ECO57      EQKASGINMTR--------------------------------
EUTC_SALTI      EQKASGINMTR--------------------------------
EUTC_SALTY      EQKASGINMTR--------------------------------
                    :*  :