CLUSTAL format seed alignment for MF_00602

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MCSB_BACHD      MSLQRFISEAISPWMKKDGPDSDIVLSSRIRLARNLQSFRFPLLATIEES-KQLVEHVKH
MCSB_BACSU      MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRYSNEEA-SSIIQQFED
MCSB_LISIN      ---MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYDQKEE----VVDNIAE
MCSB_LISMO      ---MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYEQKEE----IVDNIAE
MCSB_STAAM      --MTHNIHDNISQWMKSN-EETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQD
MCSB_STAAW      --MTHNIHDNISQWMKSN-EETPIVMSSRIRLARNLENHVHPLMYATENDGFRVINEVQD
MCSB_CALS4      ----------------MLQYDKDVVLSSRIRLARNVKDIPFPTVMTEEQG-KKVIELARK
MCSB_CLOAB      ----------MKNWLNSDLKDNDIVITTRIRLARNIKGIPFPDKLSDDEG-RDVVKKIKD
MCSB_CLOPE      ------------MVQWISPLDNSIVIASKVKILRNIKGIKFTKLLNEEE----FNDLLSM
MCSB_CHLMU      --MLPNQILTDITTVKHSFKAETFRPISTLSLSRNLSVSKFVPCLSKENK-RDVLETIAK
MCSB_CHLTR      --MLPNHILTAIATIKHSLRTETPRPICTLSLSRNLSVSKFVPCLSKENK-RDVLETIAK
MCSB_CHLPN      -MTLPNDLLETLVKRKESPQANKVWPVTTFSLARNLSVSKFLPCLSKEQK-LEILQFITS
                                             . : **..   .      ::    . .    

MCSB_BACHD      HLAES-SYHTNRFELLCMDDMKPNVKRVLVEKHLISPHLAEESKHGAVMLSEDESISIMI
MCSB_BACSU      QFSEQEIPGIGKFVLIRMNDAQPLEKRVLVEKHLISPNLTE-SPFGGCLLSENEEVSVML
MCSB_LISIN      VFDDN-------FTLIKMNQISKLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIML
MCSB_LISMO      VFDDN-------FILIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSIML
MCSB_STAAM      ALPN--------FELMRLDQMDQQSKMKMVAKHLISPELIK-QPAAAVLVNDDESLSVMI
MCSB_STAAW      ALPN--------FELMRLDQMDQQSKMKMVAKHLISPELIK-QPAAAVLVNDDESLSVMI
MCSB_CALS4      AILGSNTILSTQFTEYEMKKLTPLDRQALVEKHLISPDLSQNIKTGYALIKDDNTVSIMV
MCSB_CLOAB      TLIVS-NDGKENFTCIDLWKNDNNCNAEYLEKHLISKKLIENYNRSAFILNKDETISVMV
MCSB_CLOPE      VLGRLKEIDILDKCYVVKLKDGEEKIIDYYKENFGLIKYFENKDNLIFIMNKNGEFNILL
MCSB_CHLMU      EFSNIEG---EEFFVLPLKDLPIWQRECLLEHYLCPYDLSGSLEGEALIVNRAGTLLAGI
MCSB_CHLTR      QFSAIEG---EEFFVLPLKDLPIWQRECLLEHYLFPYHLGSYLEGEALIVNQAGTLLAGI
MCSB_CHLPN      HFNHIEGF--GEFIVLPLKDTPLWQKEFLLEHFLLPYDLVGNPEGEALVVSRSGDFLAAI
                 :                 .           . :              ::.    .   :

MCSB_BACHD      NEEDHLRIQCLFPGFQLSEALVLASGIDDWIEGKVDYAFDEKRGYLTSCPTNVGTGLRAS
MCSB_BACSU      NEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGYLTSCPTNVGTGLRAS
MCSB_LISIN      NEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLTYAFDKQFGYLTSCVTNIGTGMRAS
MCSB_LISMO      NEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGMRAS
MCSB_STAAM      NEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRAS
MCSB_STAAW      NEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGTGMRAS
MCSB_CALS4      NEEDHLRIQCILPGLKLDESWDMADKIDDLIEETIDYAYDEKIGYLTSCPTNVGTGIRAS
MCSB_CLOAB      NEEDHLRLQAITAGLNLEEAYECIDRIDDKIEENLDYAFDEKIGYLTACPTNIGTGMRAS
MCSB_CLOPE      NEEEHIGIECTNSGLSLREVYSKVDKLDDLIEEKIHYSFDSELGYLTSNIKNLGTALRTK
MCSB_CHLMU      NLRDHLVLHGIDFVWQPEMLLQKLIDLDIRLQQSLSFAFSPDFGFLTTDPLRCGTALVAR
MCSB_CHLTR      NLRDHLVIHGVDFVWQPEVLLQKLIDLDIRLQQSLSFAFSSDFGFLTADPLRCGTALIAR
MCSB_CHLPN      NFQDHLVLHGIDFQGNVEKTLDQLVQLDSYLHSKLSFAFSSEFGFLTTNPKNCGTGLKSQ
                * .:*: :.                 :*  :. .:  ::. . *:**:   . **.: : 

MCSB_BACHD      VMMHLPALVMTQQINRILPAINQLGLVVRGIYGEGSEALGNLFQISNQMTLGKSEEDIVE
MCSB_BACSU      VMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQISNQITLGKSEQDIVE
MCSB_LISIN      VMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASSIFQVSNQVTLGKTETEIVE
MCSB_LISMO      VMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTEAEIVE
MCSB_STAAM      VMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIE
MCSB_STAAW      VMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKSELEIIE
MCSB_CALS4      VMVHLPALTITGQISNILNSVSKIGMAVRGIYGEGTQALGDIYQISNQVTLGQSEKEIIE
MCSB_CLOAB      VMIHLPALSMNNEMPRILNALSQIGITIRGLWGEGSKAIGSLYQISNQITLGMSENDIIS
MCSB_CLOPE      VFIHLPLLSSNNLIRIIKNALKEEGITLKSIYNSGNKDVGNIYEVSNIKTLGMSEKDILD
MCSB_CHLMU      AFIHVPALRYRNKLSELLVPHQR-EFACSSLLPLSQESLGDILCLSNICSLGVSEEQILS
MCSB_CHLTR      AFVHVPALKYGDALSELLVPYQR-EFASSSLLPLSQESLGDILCLSNICSLGLSEEQILS
MCSB_CHLPN      CFLHIPALLYSKEFTNL-IDEEV-EIITSSLLLGVTGFPGNIVVLSNRCSLGLTEELLLS
                 ::*:* *     :  :            .:        .    :**  :** :*  ::.

MCSB_BACHD      DLRGVVMQLIQQERAARKRLLESSRLQLEDRVYRSYGILAHSRIIESKEATQKLSDVRLG
MCSB_BACSU      DLNSVAAQLIEQERSAREAIYQTSKIELEDRVYRSYGVLSNCRMIESKETAKCLSDVRLG
MCSB_LISIN      DLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMQEASDAISDIRLG
MCSB_LISMO      DLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMKEAADAISDIRFG
MCSB_STAAM      TLTEVVNQIIHDEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLG
MCSB_STAAW      TLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYRLSEVKLG
MCSB_CALS4      NIEGVAKQIISSERRAREELYKKQRVQIEDRVGRAFGILSHAKVMSTKEYMTLMSDVRLG
MCSB_CLOAB      NLKTVVEQIINQENLSREQLMKKYKYELEDKIARSLGILKNSVILDSNECLNLISNVRMG
MCSB_CLOPE      SLISITNKLILREKNQRDNLSKDEYIELKDDILRALGVLRNTYSIDRDEALKYLSYVRLG
MCSB_CHLMU      SLRLVVSKILSAETEARNLLLKENSTEIKNRILRSIGMLTHSCYLDLQEALDATSWIQLG
MCSB_CHLTR      SLRLVVSKILSAEREARNQLVKENPTEIKNRILRSVGMLTHSCCLDLQEALDATSWIQLG
MCSB_CHLPN      SLRITASKLSVAEVAAKKRLSEENSGDLKNLILRSLGLLTHSCQLELKETLDALSWIQLG
                 :     ::   *   :  :        :: : *: *:* :   :  .*     * :::*

MCSB_BACHD      IDLGLLKGVSGNILNELMILTQPGFLQQYAGTVLTADQRDERRAALIRARLKLE------
MCSB_BACSU      IDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIRRAALIRERLHLEMNGKRQ
MCSB_LISIN      VELGFFEHISRQKMNELVLFSQPAFLRKEAGRDMDELEEKVIRAKVIREILGDK------
MCSB_LISMO      VELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK------
MCSB_STAAM      IDLNYIE-LQNFKFNELMVAIQSPFLLDEE----DDKSVKEKRADILREHIK--------
MCSB_STAAW      IDLNYIE-LQNFKFNELMVAIQSPFLLDEE----DDKSVKEKRADILREHIK--------
MCSB_CALS4      IVLGILS-VDLDKLDRLTTQIQPANLQKIYGMQLNPYERDVKRAEYVSTQLNKKE-----
MCSB_CLOAB      VEIGIINDISKKSLNNLLVNTQRATLQEIYNKELSKKEENIKRALYVRENLR--------
MCSB_CLOPE      VELGIIEDLTLKPVNSAMIEIQPDMINNSSIKRRDIQSLKIERAKIIRNALNT-------
MCSB_CHLMU      MSMQWIEDSEKHPLWSPMFWDLRRGHLALYNQDPANKTIEKEIIAQIRAQTTKPQAERLI
MCSB_CHLTR      MSMQWIEDSEKHPLWNPLFWDLRRGHLALYNQDTANRSIEKEVIAQIRAKATKPQAERLI
MCSB_CHLPN      IDLGLIKVTENHPLWNPLFWQIRRAHLALQKQAEDSRDLQKDTISHLRASVLKELTKGLS
                : :  :.      .                         .      :             

MCSB_BACHD      -DESN
MCSB_BACSU      EDESI
MCSB_LISIN      -----
MCSB_LISMO      -----
MCSB_STAAM      -----
MCSB_STAAW      -----
MCSB_CALS4      -----
MCSB_CLOAB      -----
MCSB_CLOPE      -----
MCSB_CHLMU      LRV--
MCSB_CHLTR      IRI--
MCSB_CHLPN      PESF-